GCR020

Overview
NameGCR020
Smed IDSMED30003867
Length (bp)1789
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR020 (SMED30003867) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR020 (SMED30003867) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR020 (SMED30003867) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR020 (SMED30003867) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003867

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30003867h1SMcG0021033 dd_Smed_v4_15878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR020 vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 120.939 bits (302), Expect = 6.815e-29
Identity = 80/221 (36.20%), Postives = 122/221 (55.20%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKN-SVIGSDALSTTFASDICYSKSTASPFPQSE 853
             + GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++A+ +V  KW LG   CD++I  DVL CT+SI HL  IA+DRY +IT  + Y   R+     A+I+ +W+   L+SIP    L      +R   +    C I++ + YTI + F +F  PL+LM ++Y    IF   + + RK +K     G+D            ++  ASP PQ +
Sbjct:   50 AVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPP--MLGWRTPEDRSDPD---ACTISKDHGYTIYSTFGAFYIPLLLMLVLY--GRIFRAARFRIRKTVKKVEKTGAD------------TRHGASPAPQPK 251          

HSP 2 Score: 76.2554 bits (186), Expect = 4.730e-14
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +++   RE K V+TL II G FI+CWLPF I  L+  +  S    +  ++ +I  W GY NS LNP+IY  F+ +FQ AFKKI+
Sbjct:  333 RKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESS-CHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of GCR020 vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 114.005 bits (284), Expect = 2.141e-26
Identity = 66/170 (38.82%), Postives = 101/170 (59.41%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            AGN LV++++     ++  SN+LI SLA+ DL VAVAVMP  ++ + +  KW  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      MI S W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M  +Y
Sbjct:   97 AGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMY 259          

HSP 2 Score: 63.929 bits (154), Expect = 3.655e-10
Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL II G F +CWLPF + +  R ++  +  S I   ++  FLW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  320 KREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLL 399          
BLAST of GCR020 vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 113.62 bits (283), Expect = 2.487e-26
Identity = 66/170 (38.82%), Postives = 101/170 (59.41%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            AGN LV++++     ++  SN+LI SLA+ DL VAVAVMP  ++ + +  KW  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      MI S W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M  +Y
Sbjct:   97 AGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMY 259          

HSP 2 Score: 63.5438 bits (153), Expect = 4.500e-10
Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL II G F +CWLPF + +  R ++  +  S I   ++  FLW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  320 KREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLL 399          
BLAST of GCR020 vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 113.62 bits (283), Expect = 3.442e-26
Identity = 66/170 (38.82%), Postives = 101/170 (59.41%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            AGN LV++++     ++  SN+LI SLA+ DL VAVAVMP  ++ + +  KW  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      MI S W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M  +Y
Sbjct:   97 AGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMY 259          

HSP 2 Score: 63.929 bits (154), Expect = 4.310e-10
Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL II G F +CWLPF + +  R ++  +  S I   ++  FLW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  320 KREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLL 399          
BLAST of GCR020 vs. Ensembl Human
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 111.309 bits (277), Expect = 7.241e-26
Identity = 66/172 (38.37%), Postives = 94/172 (54.65%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGN-SYTILANFLSFCFPLILMGIVY 706
            T+  N  V+ TI+    +   +N+LI SLA TDL V++ VMP+S    ++  W  G  LCDIW+ +D+  CTASI HL VIA+DRY +IT  L Y++ R+      MI   W  +  +SIP  F+ Q     E         CL+N    SYTI +   +F  P +L+ I+Y
Sbjct:   52 TVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEM------SDCLVNTSQISYTIYSTCGAFYIPSVLLIILY 217          

HSP 2 Score: 86.6557 bits (213), Expect = 1.253e-17
Identity = 47/120 (39.17%), Postives = 69/120 (57.50%), Query Frame = 2
Query: 1418 KNHNHSNNE-----HFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            + H+HS        H + +++DS         A+  KRI+  RE K  + L II G FIICWLPF + +L+   +  D   I+  +   F W GY+NS +NPIIYT+F+ EF+ AF+KI+
Sbjct:  262 EGHSHSAGSPLFFNHVKIKLADS---------ALERKRISAARERKATKILGIILGAFIICWLPFFVVSLVLP-ICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKIV 371          
BLAST of GCR020 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 144.821 bits (364), Expect = 2.994e-37
Identity = 152/539 (28.20%), Postives = 236/539 (43.78%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEV-SIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVS-----IPS-RFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEXXXXXXXXXXXXXXENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTS---NLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDP---SEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL-FG 1768
            TI GN+LV++++V    ++  +N L+ SLA  DL V + VMP+S +  + + +W LG  LC +W  +DVL CTASI +L VI++DRY +IT  L Y R RS      ++T+ W  + +V      IPS   ++  NN       + +  C  +   +Y I +   SF  PL++M  VYFKIF         R+A+    +G+  LS                             ++     N+  +           VN  C    Y+    E  ++  N+L  +         D +  E  P +   L   T    S    T+   N  + E  +++E E   L     DI+ S ++      P   N+    +P+LS          RQ    ++   N ++             K H     EH+Q      +N    A    + K +  + E K ++T+ I+   FIICW+PF I  L+  + ISDP   S I RI    FLW GY NS LNPIIYT+++ +F+  F+ +L FG
Sbjct:    6 TIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHNHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTGS---SEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVYFKIFRV----ASEREALMRQSVGTCRLSNRLTK------------------------TQQKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSVRPVEYANRVENSLKPSHER-----FDSTDCEDSPPNGDSLEAGTTCNISMSLVTNSPPNGLQKEAKNSMERECHSL----ADIVNSADT------PVRKNTEVGVAPSLSKRA-------RQCNARLQPN-NLLQ-------------KAH-----EHYQ------INGPGKAVRGSKEKMVYMR-ERKALKTIGIVVLGFIICWMPFFIMYLVEVF-ISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFG 464          
BLAST of GCR020 vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 118.627 bits (296), Expect = 2.255e-28
Identity = 78/216 (36.11%), Postives = 117/216 (54.17%), Query Frame = 2
Query:  206 GNVLVMVTIVTELNIKNSSNH-LIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQS 850
            GN+ V++ I+ E +++    + LIFSLAV DL V + V PL A   V+  W LG+ +CD WI  DVL CTASI HLV IA+DRY SIT + Y +NR+    T M+   W  + L+S+      +     +R+  ++   CLI++  SY + +   +F  PLI +  VY+KI    KK+ K R+  + +VI     +      +   KS   P P +
Sbjct:   68 GNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFSDRVLKSH--VCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKRFK-RERDRRTVIRPPPDAIDEKKAMMPKKSKKCPLPPA 280          

HSP 2 Score: 87.8113 bits (216), Expect = 3.248e-18
Identity = 47/118 (39.83%), Postives = 69/118 (58.47%), Query Frame = 2
Query: 1421 NHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQ----KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            NH   +    +T+I D  N  S   +  R +R  +    KRE K  RTL IITG F+ CW PF + ++ R        +I+ +++ + LW GY+NS LNPIIYT+FS +F+ AFK+I+
Sbjct:  323 NHAPGDVTTQETKI-DEENGRSKPGIVKRRRRTKESNEMKRERKAWRTLAIITGTFVACWTPFFLVSIYRPIC---GCQISPVLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of GCR020 vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 118.627 bits (296), Expect = 2.255e-28
Identity = 78/216 (36.11%), Postives = 117/216 (54.17%), Query Frame = 2
Query:  206 GNVLVMVTIVTELNIKNSSNH-LIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQS 850
            GN+ V++ I+ E +++    + LIFSLAV DL V + V PL A   V+  W LG+ +CD WI  DVL CTASI HLV IA+DRY SIT + Y +NR+    T M+   W  + L+S+      +     +R+  ++   CLI++  SY + +   +F  PLI +  VY+KI    KK+ K R+  + +VI     +      +   KS   P P +
Sbjct:   68 GNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFSDRVLKSH--VCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKRFK-RERDRRTVIRPPPDAIDEKKAMMPKKSKKCPLPPA 280          

HSP 2 Score: 87.8113 bits (216), Expect = 3.248e-18
Identity = 47/118 (39.83%), Postives = 69/118 (58.47%), Query Frame = 2
Query: 1421 NHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQ----KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            NH   +    +T+I D  N  S   +  R +R  +    KRE K  RTL IITG F+ CW PF + ++ R        +I+ +++ + LW GY+NS LNPIIYT+FS +F+ AFK+I+
Sbjct:  323 NHAPGDVTTQETKI-DEENGRSKPGIVKRRRRTKESNEMKRERKAWRTLAIITGTFVACWTPFFLVSIYRPIC---GCQISPVLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of GCR020 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 105.145 bits (261), Expect = 4.418e-24
Identity = 64/185 (34.59%), Postives = 101/185 (54.59%), Query Frame = 2
Query:  200 IAGNVLVMVTIVTELNIK-NSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNR 748
            I GN+LV+VT+  +  ++    N LI SLAV D+ V + VMPL+   E+  +W +G  LC+IW+  DVL  TASI H+  I++DRY S+T  LTY   R+ +     I  SWI + L+ +P  F  +             G C ++    Y + ++  SF  P++++ IVY KI+    + ++ R
Sbjct:   36 IFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERA--------EGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQR 212          

HSP 2 Score: 59.6918 bits (143), Expect = 3.184e-9
Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 2
Query: 1421 NHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            NHN        + ++  L +  F     + KR  + +E +    L II   FI+ WLPF +  ++ A+    P  + +     F W GY NSG+NP+IYT+F+ EF+    K L
Sbjct:  289 NHNSPP----ASDLTRKLEEKKFCE---KRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAPPLVFKF----FFWLGYCNSGINPVIYTVFNREFKRGLCKQL 391          
BLAST of GCR020 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 105.145 bits (261), Expect = 5.007e-24
Identity = 64/185 (34.59%), Postives = 101/185 (54.59%), Query Frame = 2
Query:  200 IAGNVLVMVTIVTELNIK-NSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNR 748
            I GN+LV+VT+  +  ++    N LI SLAV D+ V + VMPL+   E+  +W +G  LC+IW+  DVL  TASI H+  I++DRY S+T  LTY   R+ +     I  SWI + L+ +P  F  +             G C ++    Y + ++  SF  P++++ IVY KI+    + ++ R
Sbjct:   36 IFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERA--------EGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQR 212          

HSP 2 Score: 59.3066 bits (142), Expect = 3.378e-9
Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 2
Query: 1421 NHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            NHN        + ++  L +  F     + KR  + +E +    L II   FI+ WLPF +  ++ A+    P  + +     F W GY NSG+NP+IYT+F+ EF+    K L
Sbjct:  291 NHNSPP----ASDLTRKLEEKKFCE---KRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAPPLVFKF----FFWLGYCNSGINPVIYTVFNREFKRGLCKQL 393          
BLAST of GCR020 vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0086577)

HSP 1 Score: 146.747 bits (369), Expect = 1.205e-36
Identity = 74/170 (43.53%), Postives = 107/170 (62.94%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA+DRY ++T + Y  +R++     MI   W AA +VS+  +F  +  + ++RI       C++++  SY + A   +F  PL+++  +Y
Sbjct:  240 TIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQFGWKDPDYLQRIEQQ---KCMVSQDVSYQVFATCCTFYVPLLVILALY 406          

HSP 2 Score: 98.2117 bits (243), Expect = 5.629e-21
Identity = 45/90 (50.00%), Postives = 60/90 (66.67%), Query Frame = 2
Query: 1505 RVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSN 1774
            R + +  KRE K  +TL IITG F++CWLPF +  L      +   +I+  + S+FLW GY NS LNP+IYTIFS EF+ AFK+ILFG +
Sbjct:  737 RKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCAA--CQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGH 824          
BLAST of GCR020 vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0474126)

HSP 1 Score: 146.747 bits (369), Expect = 1.392e-36
Identity = 74/170 (43.53%), Postives = 107/170 (62.94%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA+DRY ++T + Y  +R++     MI   W AA +VS+  +F  +  + ++RI       C++++  SY + A   +F  PL+++  +Y
Sbjct:  240 TIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQFGWKDPDYLQRIEQQ---KCMVSQDVSYQVFATCCTFYVPLLVILALY 406          

HSP 2 Score: 97.8265 bits (242), Expect = 7.029e-21
Identity = 45/90 (50.00%), Postives = 60/90 (66.67%), Query Frame = 2
Query: 1505 RVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSN 1774
            R + +  KRE K  +TL IITG F++CWLPF +  L      +   +I+  + S+FLW GY NS LNP+IYTIFS EF+ AFK+ILFG +
Sbjct:  737 RKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCAA--CQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGH 824          
BLAST of GCR020 vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330055)

HSP 1 Score: 142.51 bits (358), Expect = 7.834e-36
Identity = 75/170 (44.12%), Postives = 105/170 (61.76%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA DRY ++T + YN  R+      MI   W AA +VS+  +F  +  + ++RI   +   C++++   Y I A   +F  PL+++  +Y
Sbjct:  104 TIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQH---CMVSQDVGYQIFATCCTFYVPLLVILFLY 270          

HSP 2 Score: 98.5969 bits (244), Expect = 2.656e-21
Identity = 49/96 (51.04%), Postives = 63/96 (65.62%), Query Frame = 2
Query: 1481 NSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
            N    LA R + +  KRE K  +TL IITG F+ICWLPF +  L  +  +    EI+  + S+FLW GY NS LNP+IYTIF+ EF+ AFK+ILFG
Sbjct:  457 NPHQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMS--LCKECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 550          
BLAST of GCR020 vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330056)

HSP 1 Score: 142.895 bits (359), Expect = 1.025e-35
Identity = 75/170 (44.12%), Postives = 105/170 (61.76%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA DRY ++T + YN  R+      MI   W AA +VS+  +F  +  + ++RI   +   C++++   Y I A   +F  PL+++  +Y
Sbjct:  104 TIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQH---CMVSQDVGYQIFATCCTFYVPLLVILFLY 270          

HSP 2 Score: 98.9821 bits (245), Expect = 2.112e-21
Identity = 49/96 (51.04%), Postives = 63/96 (65.62%), Query Frame = 2
Query: 1481 NSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
            N    LA R + +  KRE K  +TL IITG F+ICWLPF +  L  +  +    EI+  + S+FLW GY NS LNP+IYTIF+ EF+ AFK+ILFG
Sbjct:  512 NPHQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMS--LCKECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of GCR020 vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0086599)

HSP 1 Score: 142.51 bits (358), Expect = 1.150e-35
Identity = 75/170 (44.12%), Postives = 105/170 (61.76%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA DRY ++T + YN  R+      MI   W AA +VS+  +F  +  + ++RI   +   C++++   Y I A   +F  PL+++  +Y
Sbjct:  104 TIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQH---CMVSQDVGYQIFATCCTFYVPLLVILFLY 270          

HSP 2 Score: 98.9821 bits (245), Expect = 2.102e-21
Identity = 49/96 (51.04%), Postives = 63/96 (65.62%), Query Frame = 2
Query: 1481 NSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
            N    LA R + +  KRE K  +TL IITG F+ICWLPF +  L  +  +    EI+  + S+FLW GY NS LNP+IYTIF+ EF+ AFK+ILFG
Sbjct:  512 NPHQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMS--LCKECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of GCR020 vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 123.635 bits (309), Expect = 4.542e-30
Identity = 67/171 (39.18%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            +I GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++A+ +V  KW LG   CDI+I  D+L CT+SI HL  IA+DRY +IT  + Y + R+      +IT +W     +SIP    ++         +     C+I+    YTI + F +F  PLILM ++Y
Sbjct:   49 SIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMKSQPKSRAEDMANPEACMISHDPWYTIYSTFCAFYIPLILMLVLY 219          

HSP 2 Score: 74.7146 bits (182), Expect = 8.688e-14
Identity = 38/85 (44.71%), Postives = 53/85 (62.35%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRI-MDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +++   RE K V+TL II G FI+CWLPF I  L+  +    P+ +  + +  +  W GY NS LNPIIY  F+ +FQ AFKKI+
Sbjct:  325 RKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFC---PTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 406          
BLAST of GCR020 vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 122.865 bits (307), Expect = 6.731e-30
Identity = 69/172 (40.12%), Postives = 105/172 (61.05%), Query Frame = 2
Query:  194 WTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            + I GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++A+ +V  KW LG E+CDI+I  DVL CT+SI HL  IA+DRY +IT  + Y   R+      +I+ +W+    +SIP     ++    +R   +    C I++ + YTI + F +F  PLILM ++Y
Sbjct:   41 FAILGNACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISLTWLIGFSISIPPMLGWRKPE--DRADPD---ACTISQDHGYTIYSTFGAFYIPLILMLVLY 207          

HSP 2 Score: 71.633 bits (174), Expect = 6.970e-13
Identity = 37/84 (44.05%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +++   RE K V+TL II G FI CWLPF I  L+  +       +   + ++  W GY NS LNP+IY  F+ +FQ AFKKIL
Sbjct:  310 RKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPF--CQDCFMPEWLGAVINWLGYSNSLLNPVIYAYFNKDFQNAFKKIL 391          
BLAST of GCR020 vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 122.479 bits (306), Expect = 9.675e-30
Identity = 68/171 (39.77%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            +I GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++A+ +V  KW LG   CDI+I  D+L CT+SI HL  IA+DRY +IT  + Y + R+      +IT +W     +SIP    ++              TC+I+    YTI + F +F  PLILM ++Y
Sbjct:   49 SIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMKSQPK----------TCMISHDPWYTIYSTFCAFYIPLILMLVLY 209          

HSP 2 Score: 74.3294 bits (181), Expect = 9.925e-14
Identity = 38/85 (44.71%), Postives = 53/85 (62.35%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRI-MDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +++   RE K V+TL II G FI+CWLPF I  L+  +    P+ +  + +  +  W GY NS LNPIIY  F+ +FQ AFKKI+
Sbjct:  315 RKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFC---PTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of GCR020 vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 122.479 bits (306), Expect = 9.675e-30
Identity = 68/171 (39.77%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            +I GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++A+ +V  KW LG   CDI+I  D+L CT+SI HL  IA+DRY +IT  + Y + R+      +IT +W     +SIP    ++              TC+I+    YTI + F +F  PLILM ++Y
Sbjct:   49 SIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMKSQPK----------TCMISHDPWYTIYSTFCAFYIPLILMLVLY 209          

HSP 2 Score: 74.3294 bits (181), Expect = 9.925e-14
Identity = 38/85 (44.71%), Postives = 53/85 (62.35%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRI-MDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +++   RE K V+TL II G FI+CWLPF I  L+  +    P+ +  + +  +  W GY NS LNPIIY  F+ +FQ AFKKI+
Sbjct:  315 RKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFC---PTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of GCR020 vs. Ensembl Zebrafish
Match: htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:ZFIN;Acc:ZDB-GENE-081022-141])

HSP 1 Score: 116.316 bits (290), Expect = 8.320e-28
Identity = 66/172 (38.37%), Postives = 98/172 (56.98%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNS-YTILANFLSFCFPLILMGIVY 706
            TI  N  V+ TI     ++  +N LI SLAVTDL V+V VMP+  +  V+ +W LG  +CDIW+ +D+  CTASI HL VIA+DRY +IT  + Y + R+      M+ ++WI A  +S+P  F+ Q       +      TC +N  +  YTI + F +F  P +L+  +Y
Sbjct:   60 TILSNAFVIATISQSRKLQTPANFLIASLAVTDLLVSVLVMPICVLYTVTREWTLGQVICDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYAKKRTQARAAGMVATAWIIAISISLPPFFWRQ-------VKAGELTTCSVNTDHIFYTIYSTFGAFYIPTLLLIALY 224          

HSP 2 Score: 74.3294 bits (181), Expect = 9.740e-14
Identity = 44/110 (40.00%), Postives = 61/110 (55.45%), Query Frame = 2
Query: 1433 SNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
             ++   +  +SDSL +          KRI+  RE K  +TL II G +I+CWLPF I  LL     S  S    + D  F W GYVNS +NPIIYT+ + +F+ AF K++
Sbjct:  281 GSDNQIRVTVSDSLLEK---------KRISAARERKATKTLGIILGAYIVCWLPFFIYTLLIPLCSSCFSP--ELFD-FFTWLGYVNSLINPIIYTMSNDDFKKAFHKVI 378          
BLAST of GCR020 vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 114.39 bits (285), Expect = 7.800e-27
Identity = 71/171 (41.52%), Postives = 97/171 (56.73%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
             I GN  V+  I  E  ++  +N+LI SLAVTDL V+V V+P++A  +V  KW LG   CDI+I  DVL CT+SI HL  IA+DRY +IT  + Y   R+      +I+ +WI    +SIP    L      +R   N    C I+E   YTI + F +F  PLILM ++Y
Sbjct:   43 AIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPP--MLGWRTPEDRSDPN---ACKISEDPGYTIYSTFGAFYIPLILMLVLY 208          

HSP 2 Score: 80.8777 bits (198), Expect = 1.170e-15
Identity = 55/175 (31.43%), Postives = 85/175 (48.57%), Query Frame = 2
Query: 1253 IKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNG-----FNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            + P+ +  +    P+ +W   +   P      +I++G        +E ++ + S     L NH H   +      S+  ND   A+ A R  ++   RE K V+TL II G FI CWLPF I  L+  +   +   +  ++  +  W GY NS LNPIIY  F+ +FQ AFKKI+
Sbjct:  238 VSPAVAERKSNGEPSKNWKRTVEPKPSACVNGAIRHGEDGAVLEIIEVHHYVNSKSHLDLPNHAH---DMAVAPCSEKRNDR--ATDAKR--KVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPF--CETCHMPHLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 403          
BLAST of GCR020 vs. Ensembl Xenopus
Match: exd2 (exonuclease 3'-5' domain containing 2 [Source:Xenbase;Acc:XB-GENE-5752408])

HSP 1 Score: 112.464 bits (280), Expect = 5.876e-26
Identity = 65/172 (37.79%), Postives = 102/172 (59.30%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TIAGN LV++++     ++  SN+LI SLA+ DL VA+AVMP  ++ + +  +W  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      MI   W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M  +Y
Sbjct:   92 TIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAIAVMPFVSVTDLIGGEWIFGHVFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGRCMAKMILCVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMY 256          

HSP 2 Score: 65.4698 bits (158), Expect = 1.116e-10
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL II G F ICWLPF + +  R ++  ++ S I   ++  FLW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  318 KREQKAATTLGIIVGAFTICWLPFFLLSTARPFICGTECSCIPLWLERTFLWLGYANSLINPFIYAFFNRDLRTTYRNLL 397          
BLAST of GCR020 vs. Ensembl Xenopus
Match: HTR1F (5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [Source:NCBI gene;Acc:100494586])

HSP 1 Score: 109.383 bits (272), Expect = 2.508e-25
Identity = 64/172 (37.21%), Postives = 93/172 (54.07%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGN-SYTILANFLSFCFPLILMGIVY 706
            T A N LV+  I+    + + +N+LI SLAVTD  VAV VMP S +  +   W +G  +CDIW+  D+  CT SI HL  IA+DRY +IT  + Y R R+      MI   WI +  +S+P  F+  +        +N    C+I   +  +TI + F +F  PL L+ I+Y
Sbjct:   37 TTAINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIMYIMKETWIMGQAICDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAAFMIAVVWIISIFISMPPLFWRHQ-------ALNKEDECIIKHDHIVFTIYSTFGAFYIPLALILILY 201          

HSP 2 Score: 74.7146 bits (182), Expect = 8.019e-14
Identity = 36/88 (40.91%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 1499 AVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            A R ++I+  RE K   TL +I G F+ICWLPF +  ++    I +   I+  M +   W GY+NS +NP+IYTIF+ +F+ AF+K++
Sbjct:  269 AYRKQKISSTRERKAATTLGLILGAFVICWLPFFVKEVIVN--ICESCYISDDMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLM 354          
BLAST of GCR020 vs. Ensembl Xenopus
Match: HTR1E (5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [Source:NCBI gene;Acc:100380026])

HSP 1 Score: 108.227 bits (269), Expect = 5.059e-25
Identity = 65/168 (38.69%), Postives = 91/168 (54.17%), Query Frame = 2
Query:  209 NVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNS-YTILANFLSFCFPLILMGIVY 706
            N  V++ I T   +   +N+LI SLAVTD  VA+ VMPLS    V   W LG  +C+IW+  D+  CT SI HL VIA+DRY +IT  + Y R R+      MI + W  +  +SIP  F+   +N      +N    C+I   +  YTI +   +F  PL L+ I+Y
Sbjct:   34 NSAVILAICTTKKLHQPANYLICSLAVTDFLVAILVMPLSITYIVMDTWTLGYVICEIWLSVDMTCCTCSILHLCVIALDRYWAITDAIEYARKRTVKRAGIMILTVWTISVFISIPPLFWRNHHN------INIPSKCIIQHDHLIYTIYSTCGAFYIPLTLILILY 195          

HSP 2 Score: 68.9366 bits (167), Expect = 5.921e-12
Identity = 37/95 (38.95%), Postives = 54/95 (56.84%), Query Frame = 2
Query: 1478 DNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            DN       R ++I+  RE K  R L +I G FI+ WLPF I  L+    +   S    + D    W GYVNS +NP++YT F+ +F++AFKK++
Sbjct:  262 DNDIDIFGDRQQQISSSRERKAARILGLILGAFILSWLPFFIKELVVGIQLCTVSP--EVAD-FLTWLGYVNSLVNPLLYTSFNDDFKLAFKKLI 353          
BLAST of GCR020 vs. Ensembl Xenopus
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 105.916 bits (263), Expect = 4.256e-24
Identity = 70/172 (40.70%), Postives = 99/172 (57.56%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGN-SYTILANFLSFCFPLILMGIVY 706
            T+  NV V++TIV    +   +N+LI SLA TDL V++ VMP+S    V+  W  G  +CDIW+ +D+  CTASI HL VIA+DRY +IT  L Y ++R+      MI   WI +  +SIP  F+ Q     E +TV     C IN    SYTI +   +F  P +L+ ++Y
Sbjct:   48 TLLSNVFVIITIVMTRKLHTPANYLIGSLAFTDLLVSILVMPISIAYTVTHTWTFGQIVCDIWLLSDITCCTASILHLCVIALDRYWAITDALEYTKHRTARRAAVMILVVWIISICISIPPLFWRQAKAH-EELTV-----CTINTDQISYTIYSTCGAFYIPTVLLILLY 213          

HSP 2 Score: 81.2629 bits (199), Expect = 5.942e-16
Identity = 42/125 (33.60%), Postives = 72/125 (57.60%), Query Frame = 2
Query: 1421 NHNHSNNE-----HFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTS 1780
             H H++       H + +++DS+ +          KR++  RE K  +TL II G FI+CWLPF + +L+   +  D    + ++   F W GY+NS +NP+IYT+F+ +F+ AF+K++  +N S
Sbjct:  259 EHPHTSETPVCINHIKIKLADSIIER---------KRLSAAREKKATKTLGIILGAFIVCWLPFFVVSLVLP-ICRDACWFDPLLFDFFTWLGYLNSLINPVIYTVFNEDFKKAFQKLIRLNNAS 373          
BLAST of GCR020 vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 120.939 bits (302), Expect = 4.158e-29
Identity = 70/175 (40.00%), Postives = 104/175 (59.43%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPS----RFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
             + GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++A+ +V  KW LG   CD++I  DVL CT+SI HL  IA+DRY +IT  + Y   R+     A+I+ +W+   L+SIP     R    R+N  E         C I++ + YTI + F +F  PL+LM ++Y
Sbjct:   50 AVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPNE---------CTISKDHGYTIYSTFGAFYIPLLLMLVLY 215          

HSP 2 Score: 76.6406 bits (187), Expect = 2.322e-14
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +++   RE K V+TL II G FI+CWLPF I  L+  +  S    +  ++ +I  W GY NS LNP+IY  F+ +FQ AFKKI+
Sbjct:  333 RKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESS-CHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of GCR020 vs. Ensembl Mouse
Match: Htr1f (5-hydroxytryptamine (serotonin) receptor 1F [Source:MGI Symbol;Acc:MGI:99842])

HSP 1 Score: 112.464 bits (280), Expect = 1.700e-26
Identity = 69/184 (37.50%), Postives = 102/184 (55.43%), Query Frame = 2
Query:  209 NVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSY-TILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKA 754
            N LV+  I+    + + +N+LI SLAVTD  VAV VMP S +  V   W +G  LCDIW+  D++ CT SI HL  IA+DRY +IT  + Y R R+      MIT  W+ +  +S+P  F+  R+    R     +  C+I   +   TI + F +F  PL+L+ I+Y+KI+   +     R+A
Sbjct:   41 NSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFW--RHQGTSR-----DDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQA 217          

HSP 2 Score: 77.411 bits (189), Expect = 7.426e-15
Identity = 52/163 (31.90%), Postives = 88/163 (53.99%), Query Frame = 2
Query: 1319 TFFPYRQSKPSIK---NGFNFVEAN----------YSLLSSISSPLKNHN--HSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            T +  RQ+   IK   NG  F+E+           Y L  S+S P  + +  HS  +  ++++    ++ S+     R ++I+  RE K   TL +I G F+ICWLPF +  L+    + +  +I+  M +   W GY+NS +NP+IYTIF+ +F+ AF+K++
Sbjct:  210 TLYHKRQASRMIKEELNGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELK---HEKSW-----RRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVN--VCEKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLV 362          
BLAST of GCR020 vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 113.62 bits (283), Expect = 1.882e-26
Identity = 66/170 (38.82%), Postives = 101/170 (59.41%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            AGN LV++++     ++  SN+LI SLA+ DL VAVAVMP  ++ + +  KW  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      MI S W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M  +Y
Sbjct:  100 AGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMY 262          

HSP 2 Score: 61.2326 bits (147), Expect = 2.097e-9
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL II G F +CWLPF + +  R ++  +  S I   ++   LW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  323 KREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLL 402          
BLAST of GCR020 vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 113.62 bits (283), Expect = 1.888e-26
Identity = 66/170 (38.82%), Postives = 101/170 (59.41%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            AGN LV++++     ++  SN+LI SLA+ DL VAVAVMP  ++ + +  KW  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      MI S W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M  +Y
Sbjct:  100 AGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMY 262          

HSP 2 Score: 60.8474 bits (146), Expect = 2.570e-9
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL II G F +CWLPF + +  R ++  +  S I   ++   LW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  323 KREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLL 402          
BLAST of GCR020 vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 113.235 bits (282), Expect = 3.200e-26
Identity = 66/170 (38.82%), Postives = 101/170 (59.41%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            AGN LV++++     ++  SN+LI SLA+ DL VAVAVMP  ++ + +  KW  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      MI S W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M  +Y
Sbjct:  100 AGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMY 262          

HSP 2 Score: 60.8474 bits (146), Expect = 2.494e-9
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL II G F +CWLPF + +  R ++  +  S I   ++   LW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  323 KREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLL 402          
BLAST of GCR020 vs. UniProt/SwissProt
Match: sp|Q25414|5HTR_LYMST (5-hydroxytryptamine receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 4.559e-37
Identity = 76/170 (44.71%), Postives = 105/170 (61.76%), Query Frame = 2
Query:  200 IAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRF-YLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            I GN  V+  ++ E ++ N +N+LI SLAV DL VAV VMPLS + E+S  W+L  E+CD+WI  DVL CTASI HLV IA+DRY ++T + Y R RS      MI   WI A  +SIP  F +   NN  ++      GTC+I++   YTI +   +F  P+++M I+Y
Sbjct:  110 IIGNCFVIAAVMLERSLHNVANYLILSLAVADLMVAVLVMPLSVVSEISKVWFLHSEVCDMWISVDVLCCTASILHLVAIAMDRYWAVTSIDYIRRRSARRILLMIMVVWIVALFISIPPLFGWRDPNNDPDK-----TGTCIISQDKGYTIFSTVGAFYLPMLVMMIIY 274          

HSP 2 Score: 100.138 bits (248), Expect = 5.596e-21
Identity = 51/91 (56.04%), Postives = 59/91 (64.84%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG 1783
            +++  KRE K  RTL IITG F+ICWLPF I  L+  +V  DP  I     S  LW GY NS LNPIIYTIFS EF+ AF+KILFG    G
Sbjct:  419 EKLELKRERKAARTLAIITGAFLICWLPFFIIALIGPFV--DPEGIPPFARSFVLWLGYFNSLLNPIIYTIFSPEFRSAFQKILFGKYRRG 507          
BLAST of GCR020 vs. UniProt/SwissProt
Match: sp|P28285|5HT2A_DROME (5-hydroxytryptamine receptor 2A OS=Drosophila melanogaster OX=7227 GN=5-HT1A PE=2 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 1.208e-35
Identity = 74/170 (43.53%), Postives = 107/170 (62.94%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA+DRY ++T + Y  +R++     MI   W AA +VS+  +F  +  + ++RI       C++++  SY + A   +F  PL+++  +Y
Sbjct:  240 TIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQFGWKDPDYLQRIEQQ---KCMVSQDVSYQVFATCCTFYVPLLVILALY 406          

HSP 2 Score: 98.2117 bits (243), Expect = 5.643e-20
Identity = 45/90 (50.00%), Postives = 60/90 (66.67%), Query Frame = 2
Query: 1505 RVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSN 1774
            R + +  KRE K  +TL IITG F++CWLPF +  L      +   +I+  + S+FLW GY NS LNP+IYTIFS EF+ AFK+ILFG +
Sbjct:  737 RKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCAA--CQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGH 824          
BLAST of GCR020 vs. UniProt/SwissProt
Match: sp|P28286|5HT2B_DROME (5-hydroxytryptamine receptor 2B OS=Drosophila melanogaster OX=7227 GN=5-HT1B PE=2 SV=3)

HSP 1 Score: 142.51 bits (358), Expect = 1.153e-34
Identity = 75/170 (44.12%), Postives = 105/170 (61.76%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA DRY ++T + YN  R+      MI   W AA +VS+  +F  +  + ++RI   +   C++++   Y I A   +F  PL+++  +Y
Sbjct:  104 TIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQH---CMVSQDVGYQIFATCCTFYVPLLVILFLY 270          

HSP 2 Score: 98.9821 bits (245), Expect = 2.107e-20
Identity = 49/96 (51.04%), Postives = 63/96 (65.62%), Query Frame = 2
Query: 1481 NSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
            N    LA R + +  KRE K  +TL IITG F+ICWLPF +  L  +  +    EI+  + S+FLW GY NS LNP+IYTIF+ EF+ AFK+ILFG
Sbjct:  512 NPHQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMS--LCKECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of GCR020 vs. UniProt/SwissProt
Match: sp|Q25190|5HTR_HELVI (5-hydroxytryptamine receptor OS=Heliothis virescens OX=7102 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 5.372e-32
Identity = 73/170 (42.94%), Postives = 102/170 (60.00%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNV V+  I+ E N++N +N+L+ SLAV DL VA  VMPL A+ EVS  W LG ELCD+W  +DVL  +ASI HLV IA DRY ++T + Y   R+      MI   W AA +VS+  +   +  + + RIT      CL+++  +Y I A   +F  PL ++ I+Y
Sbjct:   76 TIVGNVFVIAAIIIERNLQNVANYLVASLAVADLMVACLVMPLGAVYEVSQGWILGPELCDMWTSSDVLCSSASILHLVAIATDRYWAVTDVDYIHIRNEKRIFTMIVLVWGAALVVSLAPQLGWKDPDYLARITQQQK--CLVSQDLAYQIFATMSTFYVPLAVILILY 243          

HSP 2 Score: 90.8929 bits (224), Expect = 5.288e-18
Identity = 44/86 (51.16%), Postives = 56/86 (65.12%), Query Frame = 2
Query: 1517 INQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSN 1774
            +  KRE K  +TL IITG F+ CWLPF I  L+    I     I+  + S FLW GY NS LNP+IYTIFS +F+ AF +ILFG++
Sbjct:  375 LEAKRERKAAKTLAIITGAFVFCWLPFFIMALVMP--ICQTCVISDYLASFFLWLGYFNSTLNPVIYTIFSPDFRQAFARILFGTH 458          
BLAST of GCR020 vs. UniProt/SwissProt
Match: sp|Q17239|5HTR_BOMMO (5-hydroxytryptamine receptor OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 6.469e-30
Identity = 66/170 (38.82%), Postives = 100/170 (58.82%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            T+ GNV V+  I+ E ++++++N+LI SLAV DL VA  VMPL A+ EV  +W LG ELCD+W   DVL CTASI HLV IA+DRY ++T + Y    +      MI   W  +  V I      +  +  +R++ +    C++++   Y I A   SF  P++++ I+Y
Sbjct:   75 TVVGNVFVIAAILLERHLRSAANNLILSLAVADLLVACLVMPLGAVYEVVQRWTLGPELCDMWTSGDVLCCTASILHLVAIALDRYWAVTNIDYIHASTAKRVGMMIACVWTVSFFVCIAQLLGWKDPDWNQRVSEDLR--CVVSQDVGYQIFATASSFYVPVLIILILY 242          

HSP 2 Score: 85.5001 bits (210), Expect = 2.131e-16
Identity = 40/83 (48.19%), Postives = 57/83 (68.67%), Query Frame = 2
Query: 1520 NQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
            + KRE K  +TL IITG F+ CWLPF +  +L   V +   E++ ++ S+ LW GY NS LNP+IYT+FS EF+ AF+++L G
Sbjct:  357 DSKRERKAAKTLAIITGAFVACWLPFFVLAIL---VPTCDCEVSPVLTSLSLWLGYFNSTLNPVIYTVFSPEFRHAFQRLLCG 436          
BLAST of GCR020 vs. TrEMBL
Match: A0A193KUG6 (GCR020 OS=Schmidtea mediterranea OX=79327 GN=gcr020 PE=2 SV=1)

HSP 1 Score: 1037.33 bits (2681), Expect = 0.000e+0
Identity = 562/564 (99.65%), Postives = 562/564 (99.65%), Query Frame = 2
Query:   92 MNKLVNFTQPVQYEPRFQIWPMTXXXXXXXXXXXWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEXXXXXXXXXXXXXXENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG 1783
            MNKLVNFTQPVQYEPRFQIWPMTLISLLLIIIIIWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNT ERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYFKIFIFIKKQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEIWSSIYDDSKIIIDENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLW GYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG
Sbjct:    1 MNKLVNFTQPVQYEPRFQIWPMTLISLLLIIIIIWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTAERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYFKIFIFIKKQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEIWSSIYDDSKIIIDENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWLGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG 564          
BLAST of GCR020 vs. TrEMBL
Match: A0A193KU56 (GCR006 OS=Schmidtea mediterranea OX=79327 GN=gcr006 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 6.683e-91
Identity = 208/573 (36.30%), Postives = 312/573 (54.45%), Query Frame = 2
Query:   77 FFFPFMNKLVNFTQPVQYEPRFQIWPMTXXXXXXXXXXXWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTK-NRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEXXXXXXXXXXXXXXENS-FESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPN----SNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASL---AVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
             F+ + N  V  +Q  ++ PR       + +L L  II+WTI GNV V+  IV E  +KN SN+LI SLAV DL VA+ VMP+SAIKEVS  WWLG+ELCD+W   DVL+CTASI HLVVIAIDRY ++T + Y   R++     MI   W+ + ++S+PSRF+  RNN  E + V  NG+C+INE  SYT+ +N  +F  P+  M ++Y +I+IF + + +  RK +K +   S+   T   S    +K T +          I + S I+  E+   ES V ++  + +W ++  S  ++AD E EN S                                     +   S+ Y T+                 +K++N D + + N    ++++  +  +++S+K  + T +WSPKL F+ Y+    + KN  +F  +N       SS L+ ++       ++Q S S  DN F ++   ++R  ++ QKRE K  RTL IITG FIICWLPF INN+  A+  ++P   + + DS+ LW GYVNSGLNP+IYT+FS +F+ AF+KIL G
Sbjct:    3 LFYEYEN--VTESQIARFSPRLSWIQFYITALFLGAIILWTIIGNVFVVAAIVLERTLKNVSNYLILSLAVADLMVAILVMPISAIKEVSSTWWLGIELCDLWTCFDVLSCTASILHLVVIAIDRYWAVTDINYLHRRTSSRIILMIIGVWLISVIISVPSRFHTHRNNA-EWLRVIVNGSCIINESVSYTVFSNLGAFYLPMAFMSVIYLRIYIFARSRIRYKRKKMKQNHCLSN---TDHKSCTDQTKPTENTGQCPCNKRKIDEISYILNCEHCKLESLVIQNQNRKEWFDKHMSLLEFAD-EGENDS-------------------------------------LSIQSNFYATT--------------FANVKFENVDHVANVNCVGENDRNKAETMSNHSQKKINQTTNWSPKLIFYNYKAKLLNFKNDLSFKGSNK------SSELQFNDD------RSQSSLSFKDNKFNAMNSASIR-NKVEQKRERKAARTLAIITGCFIICWLPFGINNVAHAFCNTEPCG-SALFDSLCLWLGYVNSGLNPVIYTVFSPDFRTAFRKILLG 503          
BLAST of GCR020 vs. TrEMBL
Match: A0A182NK43 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Anopheles dirus OX=7168 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 4.986e-57
Identity = 163/543 (30.02%), Postives = 252/543 (46.41%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFP----LILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEXXXXXXXXXXXXXXENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIK--PSTSNSRKLKSPTLSWSPKLTFFP-------YRQSKP--SIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTS 1780
            T+ GNV V+  I+ E N++N +N+L+ SLAV DLFVA  VMPL A+ E+S  W LG ELCDIW   DVL CTASI HLV IA DRY ++T + Y  +R++     MI   W A+ +VS+  +F  +    ++RI       C++++  +Y + A   +F  P    L+L   +Y      I ++     A  NS                 S    +P P+S+I   +         +  F +    ++     V    +N     E+ E+ + ++    E       +  D+ +      S    N +   +Y ++     LA+    S  E      K        SP+ N S +   P T+      S  L+ SP L   P       + Q+ P  +   G       + L++  ++ L+     +  +  +        N  A ++ R + +  KRE K  +TL IITG F++CWLPF +  LL    + +   IN  + S+FLW GY NS LNP+IYTIFS EF+ AFK+ILFG++ S
Sbjct:  101 TVIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISRGWILGPELCDIWTSCDVLCCTASILHLVAIATDRYWAVTNIDYIHSRTSRRVFTMIFLVWFASVIVSLAPQFGWKDPEYLQRIEQQ---KCMVSQNIAYQVFATCCTFYVPLFVILVLYWKIYQTARRRIHRRGPKIPATPNS-----------------SNQEETPKPKSKIRFHL---------KKKFTNPTKPAVSSLGLVEGNSTNTVNTVEDTEDSTNADRKGLETT-----FSGDEGNGTPLGNS----NQIPTVSY-EVTHQQQLAQAAGGSAAESNNNNNKTH------SPSGNGSTLPALPPTACPTVAPSHQLASSPLLPHQPSPRDAHQHNQTGPNRAAPGGTTTTTTTHLLVTPGATSLQGAGGGSTLNIAS------TPNPHAQVSKRKETLEAKRERKAAKTLAIITGAFVVCWLPFFLTALL--LPLCESCSINDTVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGTHRS 590          
BLAST of GCR020 vs. TrEMBL
Match: A0A193KUL5 (GCR090 OS=Schmidtea mediterranea OX=79327 GN=gcr090 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.437e-44
Identity = 90/215 (41.86%), Postives = 136/215 (63.26%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPF 841
            TI GN+LV++ ++ E N++N SN+LI S+A+TDL VA+ VM LSA+ E+S +W+LG+  CD WIFTDV++C+ASIFHLV IA+DRY ++T++ Y  NR+       I S W+ + ++++PSRF+  R  T     V   G CLIN G  YT+L+  ++F  P+I M I+Y+KIF   K+Q + ++     V       +      C  ++T S F
Sbjct:   41 TIVGNILVVLAVLLEKNLRNLSNYLILSMAITDLVVAIFVMNLSAVYEISNRWFLGIAWCDFWIFTDVMSCSASIFHLVTIALDRYWTVTRIEYKHNRTMSQLIFTILSIWMISLMIAVPSRFHFHRLETQMFQEVVIKGRCLINSGYFYTLLSTVIAFYAPMIFMMIIYWKIFQIAKRQIRRKRRFNYEVTFDSKYKSICRYFHCCHRTTESEF 255          

HSP 2 Score: 79.7221 bits (195), Expect = 4.434e-12
Identity = 43/90 (47.78%), Postives = 54/90 (60.00%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLL----RAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
             ++  KRE K + T+ IIT  FI+CW+PF    L+     AY I  P     I+ S+ LW GY+N  LNP IYTIFS EF+ AFK IL G
Sbjct:  340 HKVEVKRERKAIITVGIITCCFILCWMPFFTLTLVLPFCGAYCIVHP-----IISSVLLWLGYLNCLLNPFIYTIFSQEFRCAFKNILTG 424          
BLAST of GCR020 vs. TrEMBL
Match: A0A193KUE3 (GCR012 OS=Schmidtea mediterranea OX=79327 GN=gcr012 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.034e-42
Identity = 94/216 (43.52%), Postives = 140/216 (64.81%), Query Frame = 2
Query:  107 NFTQPVQYEPRFQIWPMTXXXXXXXXXXXWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTT--AMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNR 748
            N T P+ + PRF    +     +L+++I+WTI GNV V+  I+ E N+++ SN+LI SLAV DL VAV VMP+S I E+S  WW+G+ LCDIWIF DVL CTAS+ HLV IAIDRY ++T++ + R +S        MI   W  + ++SIPSRF+  RN    +   + +G C +N  ++Y I+AN  +F  P+++M  +Y +I++F K+Q + R
Sbjct:    4 NITVPI-FSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIVISIPSRFHGHRN----QFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKR 214          

HSP 2 Score: 101.679 bits (252), Expect = 1.070e-18
Identity = 53/107 (49.53%), Postives = 72/107 (67.29%), Query Frame = 2
Query: 1472 LNDNSFASLAVRVK-RINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISD-PSEINR------IMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
            L++  +  L +R + +I Q+RE K  RTL IITG F+ICWLPFA  N++   +ISD P+  N       ++DS  LW GY NS LNPIIYT+FS +F+ +F+KILFG
Sbjct:  526 LSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMIN--LISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFG 630          
BLAST of GCR020 vs. Ensembl Cavefish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 120.168 bits (300), Expect = 5.667e-29
Identity = 63/171 (36.84%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            ++ GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++ + +V  +W LG   CDI+I  D+L CT+SI HL  IA+DRY +IT  + Y + R+      +I  +W+    +SIP    ++     +   +     C+I+    YTI + F +F  PLILM ++Y
Sbjct:   51 SVFGNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMACLYQVLDRWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAAVLIGVTWLVGFSISIPPMLIMKSQPKSKAEDIANPEACMISHDPWYTIYSTFCAFYIPLILMLVLY 221          

HSP 2 Score: 75.485 bits (184), Expect = 4.201e-14
Identity = 41/84 (48.81%), Postives = 53/84 (63.10%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +++   RE K V+TL II G FI+CWLPF I  L+  +  S    +  +MD I  W GY NS LNPIIY  F+ +FQ AFKKI+
Sbjct:  327 RKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPSCQMPV-WLMDVIN-WLGYSNSLLNPIIYAYFNKDFQSAFKKII 408          
BLAST of GCR020 vs. Ensembl Cavefish
Match: ENSAMXT00000026144.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:14357937:14360657:1 gene:ENSAMXG00000025418.2 transcript:ENSAMXT00000026144.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 4.571e-28
Identity = 71/172 (41.28%), Postives = 100/172 (58.14%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGN-SYTILANFLSFCFPLILMGIVY 706
            T+  N  V+ TI     +   +N LI SLA+TDL V++ VMP+S +  VS  W LG  +CDIW+ +D+  CTASI HL VIA+DRY +IT  L Y++ R+T     MI   W+ +  +SIP  F+ Q     E +T      CL+N    SYT+ + F +F  P IL+ I+Y
Sbjct:   39 TMLSNAFVIATIFLTRKLHTPANFLIGSLALTDLLVSILVMPISIVYTVSKTWTLGQIMCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYSKRRTTRRAALMIGVVWVISISISIPPLFWRQAKAH-EELT-----ECLVNTDQISYTLYSTFGAFYVPTILLVILY 204          

HSP 2 Score: 77.7962 bits (190), Expect = 4.589e-15
Identity = 37/84 (44.05%), Postives = 53/84 (63.10%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KR+   RE K  +TL II G FI+CWLPF +  L+ A  I      + ++   F W GY+NS +NP+IYT F+ EF+ AF+K++
Sbjct:  283 KRLCAAREKKATKTLGIILGAFIVCWLPFFVVTLVMA--ICKDCWFHPVLFDFFTWLGYLNSLINPVIYTAFNDEFKQAFQKLI 364          
BLAST of GCR020 vs. Ensembl Cavefish
Match: htr7a (5-hydroxytryptamine receptor 7-like [Source:NCBI gene;Acc:103024740])

HSP 1 Score: 117.087 bits (292), Expect = 1.694e-27
Identity = 68/172 (39.53%), Postives = 104/172 (60.47%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GNVLV+V++     ++  SN+LI SLA+ DL VA+AVMP  +I + +  +W  G   C+++I  DV+ CTASI  L VI+IDRYL IT+ LTY   ++      M+ S W+ +A +++P  F   +N       VN +  CLI++   YTI +  ++F  P+ +M I+Y
Sbjct:  128 TICGNVLVLVSVCFVKKLRQPSNYLIVSLALADLSVALAVMPFVSITDLIGGRWIFGQFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGWCMAKMVLSVWLLSASITLPPLFGWAQN-------VNDDKVCLISQDFGYTIYSTAVAFYIPMTVMLIMY 292          

HSP 2 Score: 60.077 bits (144), Expect = 3.786e-9
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 2
Query: 1526 KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVI-SDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRE K   TL ++ G F  CWLPF + +  R +V  ++ S +   ++   LW GY NS +NP IY  F+ + +  ++ +L
Sbjct:  379 KREQKAAATLGVVVGAFSFCWLPFFLLSTTRPFVCGTECSCVPLWVERTLLWLGYANSLINPFIYAFFNRDLRTTYRSLL 458          
BLAST of GCR020 vs. Ensembl Cavefish
Match: ENSAMXT00000047213.1 (5-hydroxytryptamine receptor 1E [Source:NCBI gene;Acc:103023646])

HSP 1 Score: 114.775 bits (286), Expect = 2.390e-27
Identity = 67/170 (39.41%), Postives = 95/170 (55.88%), Query Frame = 2
Query:  209 NVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGT--CLINEGN-SYTILANFLSFCFPLILMGIVY 706
            N  V+  I T   ++  +N+LI SLAVTD  VAV VMPLS +  ++ KW LG  +C++W+  D+  CT SI HL VIA+DRY +ITK + Y R R+      M+T  W  +  +S+P  F+  R       +   NGT  C I      YTI + F +F  P+ L+ I+Y
Sbjct:   54 NSAVIAAIFTTRKLQLPANYLICSLAVTDCLVAVLVMPLSILYIITDKWCLGKVVCEVWLSVDMTCCTCSILHLCVIALDRYWAITKAIEYARKRTPRRAIVMVTCVWAISIFISVPPLFWRNR-------SAGSNGTTDCFIEHDQVGYTIYSTFGAFYIPMTLILILY 216          

HSP 2 Score: 77.0258 bits (188), Expect = 9.825e-15
Identity = 43/99 (43.43%), Postives = 56/99 (56.57%), Query Frame = 2
Query: 1466 DSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            D LN +    LA    +I   RE K  R L +I G FI CWLPF I  LL    + +PS   R +     W GYVNS +NP++YT F+ +F+ AFKK+L
Sbjct:  272 DQLNIDP---LADERNQICSSRERKAARILGLILGAFIACWLPFFIKELLMGLKLLNPS---RKVSDFLTWLGYVNSLINPLLYTSFNEDFKQAFKKLL 364          
BLAST of GCR020 vs. Ensembl Cavefish
Match: ENSAMXT00000006138.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27993956:27999385:-1 gene:ENSAMXG00000005992.2 transcript:ENSAMXT00000006138.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 3.835e-27
Identity = 67/175 (38.29%), Postives = 100/175 (57.14%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPS----RFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            +I GN  V+  I  E +++  +N+LI SLAVTDL V+V V+P++A+ +V  +W LG   CD++I  DVL CT+SI HL  IA+DRY +IT  + Y   R+      +I+ +W+    +SIP     R    R N +E         C I++   YTI + F +F  PL LM ++Y
Sbjct:   47 SIVGNACVIAAIALERSLQTINNYLIGSLAVTDLLVSVLVLPMAALYQVLQRWTLGQVACDLFIALDVLCCTSSILHLCAIALDRYWAITDPVAYMTRRTLCRAATLISLTWLVGFSISIPPMLGWRTPEDRANPLE---------CTISQDPGYTIFSTFGAFYIPLALMLVLY 212          

HSP 2 Score: 71.2478 bits (173), Expect = 9.578e-13
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 1514 RINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            R    RE + V+TL II G FI+CWLPF I  L+  +  S    +   + ++  W GY NS LNP+IY  F+ +FQ AF+K+L
Sbjct:  319 RGALARERRTVKTLGIIMGTFILCWLPFFIVALVLPFCGSS-CPMPPWLGAVINWLGYANSLLNPVIYAYFNRDFQNAFRKML 400          
BLAST of GCR020 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 1.491e-30
Identity = 70/171 (40.94%), Postives = 102/171 (59.65%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
             I GN  V+  I  E  ++N +N+LI SLAVTDL V++ V+P++A+ +V  +W LG  +CDI+I  DVL CT+SI HL VIA+DRY +IT  + Y   R+      MI+ +W+    +SIP    L      +R   N    C I++ + YTI + F +F  PLILM ++Y
Sbjct:   50 AIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPP--MLGWRTPEDRADPN---ACKISQDHGYTIYSTFGAFYIPLILMLVLY 215          
BLAST of GCR020 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 120.553 bits (301), Expect = 1.216e-29
Identity = 64/167 (38.32%), Postives = 93/167 (55.69%), Query Frame = 2
Query:  209 NVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLT-YNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            N LV+  I     ++  +N+LI SLAV DL VA  VMP++A   V+ +W LG  LCD+W+  DV  CTASI HL  IA+DR+ +IT    Y   R+      MI +SW+ AA +S+P  F+ +R+    R  + ++          YTI + F +F  PL L+  +Y
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLFWRRRDPAKPRCIIEHDHVL-------YTIYSTFGAFYVPLALLLALY 224          

HSP 2 Score: 73.1738 bits (178), Expect = 4.892e-14
Identity = 31/84 (36.90%), Postives = 54/84 (64.29%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +RI+  RE +  +TL +I G F++CWLPF I  L+    +     ++  +  +  W GY+NS +NP+IYT+F+ +F+ AF+K++
Sbjct:  340 ERISGSRERRAAKTLGLILGAFVVCWLPFFIKELV--VNLCKSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of GCR020 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006411.1 (pep scaffold:Pmarinus_7.0:GL477077:14345:22367:-1 gene:ENSPMAG00000005791.1 transcript:ENSPMAT00000006411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 1.640e-24
Identity = 75/198 (37.88%), Postives = 113/198 (57.07%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEV-SIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIG-SDAL 787
            A NVLV+VTI+         ++L+ S+AV+D+ VA  VMPLS + EV   +W LG  +CD+WI  DVL CTASI+++  IA+DR+ SIT+ L Y        +  MI  +W+ +A +S+   F        E      +  C +++G SYT+ +   +F  PL ++  VY+KI+   K    +RKA  NSV+  SDA+
Sbjct:   48 AWNVLVIVTILRVKTFHRVPHNLVASMAVSDVLVAALVMPLSLVSEVHERRWRLGPVMCDVWISCDVLCCTASIWNVTAIALDRFWSITRHLEYTTRARKCISNLMIALTWLLSATISLSPLF-----GWGEGYYSAESQRCHLSQGPSYTVFSTVGAFYLPLCVVLFVYWKIYKATKFCFGSRKA--NSVMPMSDAI 238          

HSP 2 Score: 62.7734 bits (151), Expect = 6.421e-11
Identity = 29/82 (35.37%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 1520 NQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILF 1765
             +++E +    + I+  +F++CW+PF I  L+      D   +  +  SIFLW GY NS  NP+IYT F+  +  AF+ I F
Sbjct:  269 REQKERRAALMVGILIAVFVLCWIPFFIKELISPLCSCD---VPPVWKSIFLWLGYSNSFFNPLIYTAFNKNYNNAFRNIFF 347          
BLAST of GCR020 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 8.201e-24
Identity = 72/191 (37.70%), Postives = 110/191 (57.59%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNS 766
            +IAGN  V+  I  E +++  +N+LI SLAVTDL V+V V+P++A+ +V  +W LG  +CD +I  DVL CT+SI HL  IA+DRY +IT  + Y   R+      MI  +W+    +SIP    L      +R   +    C I++   YTI + F +F  PL+LM ++Y KIF   + + +   A K++
Sbjct:   16 SIAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPP--MLGWRQAEDRADPD---ACNISQHLGYTIYSTFGAFYIPLVLMLVLYGKIFSAARFRIRKNVAFKSA 201          
BLAST of GCR020 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 8.355e-24
Identity = 61/171 (35.67%), Postives = 102/171 (59.65%), Query Frame = 2
Query:  203 AGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEV-SIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSW-IAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
             GN+LV++ +  E  ++ ++N+ + SLAV DL V + VMP+S I  + +++W L  E+C +W+F DVL  TASI HL  I++DRY++I + + ++R  S   T   IT+ W I+  + S      LQ     ++  V  NG C++N  N + I  + +SF  PL++M ++Y
Sbjct:   20 GGNLLVILAVWLEKKLQTATNYFLMSLAVADLLVGLTVMPISVINILYNMRWPLPCEMCPVWVFLDVLFSTASIMHLCAISLDRYIAIKRPIQHSRFNSRSKTLLKITAVWAISIGIASPIPVLGLQ-----DQQHVFVNGACILNIQN-FIIYGSVVSFFLPLLIMVVIY 184          

HSP 2 Score: 60.8474 bits (146), Expect = 3.309e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 2
Query: 1520 NQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYV---ISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKK 1756
            N++R  KV   L I+  LF++ W PF + N+  A     +     + ++MD IF+W GYV+SG+NP++YT+F+  ++ AF++
Sbjct:  277 NERRASKV---LGIVFTLFLVMWCPFFVTNVTSALCPESLCSVEAMAKLMD-IFVWVGYVSSGVNPLVYTLFNQTYRQAFRR 354          
BLAST of GCR020 vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 73.9442 bits (180), Expect = 3.204e-14
Identity = 44/117 (37.61%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  206 GNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWW-LGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVS 550
            GN+LV V I     +++ +N+LI SLAV+DL VA   MP      + +  W LGL +C  WIF D L   ASI +L +IAIDRYL ++   +Y            I + W+ A +++
Sbjct:   36 GNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIA 152          

HSP 2 Score: 49.6766 bits (117), Expect = 1.686e-6
Identity = 30/85 (35.29%), Postives = 45/85 (52.94%), Query Frame = 2
Query: 1529 REYKVVRTLFIITGLFIICWLPFAINNLLRAYVISD------PSEINRIMDSIFLW-FGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            RE K  +TL I+ G FI CW PF I   +  +            E    + ++F++    +NS  NPIIY+ F+ +F++AFK IL
Sbjct:  256 RELKATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDIL 340          
BLAST of GCR020 vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 73.559 bits (179), Expect = 3.761e-14
Identity = 44/117 (37.61%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  206 GNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWW-LGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVS 550
            GN+LV V I     +++ +N+LI SLAV+DL VA   MP      + +  W LGL +C  WIF D L   ASI +L +IAIDRYL ++   +Y            I + W+ A +++
Sbjct:   47 GNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIA 163          

HSP 2 Score: 49.2914 bits (116), Expect = 2.353e-6
Identity = 30/85 (35.29%), Postives = 45/85 (52.94%), Query Frame = 2
Query: 1529 REYKVVRTLFIITGLFIICWLPFAINNLLRAYVISD------PSEINRIMDSIFLW-FGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            RE K  +TL I+ G FI CW PF I   +  +            E    + ++F++    +NS  NPIIY+ F+ +F++AFK IL
Sbjct:  267 RELKATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDIL 351          
BLAST of GCR020 vs. Ensembl Nematostella
Match: EDO42463 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1I2])

HSP 1 Score: 70.4774 bits (171), Expect = 2.726e-13
Identity = 54/179 (30.17%), Postives = 86/179 (48.04%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVS-IKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSW----IAAALVSI---PSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
             + GN +V + + T  +++  +N+ I SLA  D   AV  +P      ++  KW LGL  C  W++ D+L C+ASI +L  I++DRYL I+  LTYN   +      ++   W    I A+L  +   P      R   VE      NG C + E   Y  + + + F  P  +M ++Y
Sbjct:   13 AVVGNGIVSLCVFTNKHLQVPTNYFIVSLAAADFLFAVLALPFRLYDVLAGYKWHLGLHTCRYWVWLDLLFCSASIANLAAISVDRYLKISSPLTYNSRMTPKRVVLVLVLLWGYSMILASLTLVQWSPDPKDQGRGTIVE------NGICRM-EAKIYLTIISVIGFFAPFAIMVLMY 184          
BLAST of GCR020 vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 68.9366 bits (167), Expect = 7.331e-13
Identity = 37/114 (32.46%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVS-IKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWI 532
            T  GN +V++ +V    ++  +N+ + SLAV+DL VA   +P    +      W LGLE C  WI  D++ C ASI++L +I++DR+++I     Y+   + ++   +I + WI
Sbjct:   12 TFYGNFMVVLAVVLFHRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWI 125          

HSP 2 Score: 53.9138 bits (128), Expect = 6.839e-8
Identity = 34/95 (35.79%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 1505 RVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINR------IMDSIFLWFGYV----NSGLNPIIYTIFSTEFQVAFKKI 1759
            R   IN  +E K  + L I+ G F++CW PF +  L+  +   +P  +++          I L F YV    NS LNPIIY +F+ +F+ AF KI
Sbjct:  205 RRSSINLVKEVKAAKILAIVVGCFVVCWFPFFVLTLVSLW---EPHALSKETISKDTARGITLTFVYVLPVLNSTLNPIIYALFNRDFRRAFGKI 296          
BLAST of GCR020 vs. Ensembl Nematostella
Match: EDO32939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN0])

HSP 1 Score: 68.5514 bits (166), Expect = 1.131e-12
Identity = 54/173 (31.21%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVS-IKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK--LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            T+ GN  V +T+    ++   +N+++ SLAV+DL VA+  +P    + V    W LG   C  WI+ D+  C ASI +L +I++DR+L+ TK  L Y    +     AM+ + W+ + +V+  S   L+   + E   V     C   +   YT  A  L F  PLI++ + Y
Sbjct:   34 TLLGNATVCLTVFLTSSLHAFTNYIVASLAVSDLMVALFSLPFRIHQTVHNTHWCLGASACAFWIWADMFCCCASIMNLALISLDRFLA-TKYPLNYQELINRAGKIAMVVTVWLYSFVVASLS---LRNWTSPEGPLVKTINGCFKPDPYFYTFAAA-LGFFLPLIVIILAY 201          
BLAST of GCR020 vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 8.149e-31
Identity = 80/213 (37.56%), Postives = 122/213 (57.28%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTA 832
            +I GN  V+  I  E +++N +N+LI SLAVTDL V+V V+P++A+ +V  KW LG E+CD++I  DVL CT+SI HL  IA+DRY +IT  + Y   R+ +    +I ++W+    +SIP    L   +  +R   +    C+I++   YTI + F +F  PLILM ++Y    IF   + + RK +K        + T   SD C + S A
Sbjct:   56 SIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPP--MLGWRSAEDRANPD---ACMISQDPGYTIYSTFGAFYIPLILMLVLY--GRIFRAARFRIRKTVKK-------IETAKVSDKCLAVSPA 254          

HSP 2 Score: 71.2478 bits (173), Expect = 8.466e-13
Identity = 46/117 (39.32%), Postives = 63/117 (53.85%), Query Frame = 2
Query: 1412 PLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            PL N   S++  ++       N N   S A R  ++   RE K V+TL II G FI CWLPF I  L+  +   +   +   + ++  W GY NS LNPIIY  F+ +FQ AFKKI+
Sbjct:  309 PLPNTPQSSSHGYE-------NMNERNSGAKR--KLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFC-PESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 415          
BLAST of GCR020 vs. Ensembl Medaka
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 115.931 bits (289), Expect = 6.671e-28
Identity = 72/190 (37.89%), Postives = 108/190 (56.84%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNS-YTILANFLSFCFPLILM----GIVYXXXXXXXXXQTKNR 748
            T   N  V+ TI     +   +N LI SLAVTDL V++ VMP+SA+  V   W LG  +CDIW+ +D+  CTASI HL VIA+DRY +IT  + Y++ R+      MI ++W+ A  +S+P  F+  R    E +T     +C +N  +  YTI + F +F  P +L+    G +Y +    I KQ++N+
Sbjct:   28 TTLSNAFVIATIYQSRKLHTPANFLIASLAVTDLLVSILVMPISALYTVCQTWTLGQVVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPARAAGMIATAWVIAISISLPPFFW--RQVKAEEVT-----SCNVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQSQNK 210          

HSP 2 Score: 76.2554 bits (186), Expect = 1.437e-14
Identity = 44/110 (40.00%), Postives = 62/110 (56.36%), Query Frame = 2
Query: 1433 SNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            +N    +  +SD+L +          KRI+  RE K  +TL II G +IICWLPF I  LL    + D      + D IF W GY+NS +NPIIYT+ + +F+ AF K++
Sbjct:  250 ANVSQVKVTVSDALLEK---------KRISAAREKKATKTLGIILGAYIICWLPFFIYTLLVP--LCDSCFHPELFD-IFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 347          
BLAST of GCR020 vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 116.316 bits (290), Expect = 9.638e-28
Identity = 65/171 (38.01%), Postives = 98/171 (57.31%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
             I GN  V+  IV E +++N +N+LI SLAVTDL V+V V+P++A+ +V   W LG   CDI+I  DVL CT+SI HL  IA+DRY +IT+ + Y + R+      +I+ +W+    +S+P    ++               C I +   YTI + F +F  PL LM ++Y
Sbjct:   32 AIFGNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLY 202          

HSP 2 Score: 77.7962 bits (190), Expect = 5.670e-15
Identity = 39/84 (46.43%), Postives = 53/84 (63.10%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            ++I   RE K V+TL II G FI+CWLPF I  L+  +   +   + R ++ +  W GY NS LNPIIY  F+ +FQ AFKKI+
Sbjct:  314 RKIALARERKTVKTLGIIMGTFILCWLPFFIVALVMPFC-QESCYMPRWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of GCR020 vs. Ensembl Medaka
Match: htr7a (5-hydroxytryptamine receptor 7 [Source:NCBI gene;Acc:101173573])

HSP 1 Score: 117.087 bits (292), Expect = 1.194e-27
Identity = 67/172 (38.95%), Postives = 103/172 (59.88%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKE-VSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITK-LTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVY 706
            TI GN+LV++++     ++  SN+LI SLAV DL VA+AVMP  +I + +  +W  G   C+++I  DV+ CTASI  L VI+IDRYL ITK LTY   ++      M+ S W+ +A +++P  F   +N       VN    CLI++   YT+ +  ++F  P+ +M I+Y
Sbjct:  109 TICGNMLVVISVCFVKKLRQPSNYLIVSLAVADLSVALAVMPFVSITDLIGGQWVFGQFFCNVFIAMDVMCCTASIMSLCVISIDRYLGITKPLTYPVRQNGCCMAKMVLSVWLLSASITLPPLFGWAQN-------VNDGRVCLISQDFGYTVYSTAVAFYIPMSVMLIMY 273          

HSP 2 Score: 63.5438 bits (153), Expect = 3.016e-10
Identity = 37/112 (33.04%), Postives = 54/112 (48.21%), Query Frame = 2
Query: 1439 NEHFQTQISDSLNDNSFASLAVRVKRINQ---KREYKVVRTLFIITGLFIICWLPFAINNLLRAYVIS-DPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
             E   T++S  L          R KR NQ   KRE K   TL I+ G F  CWLPF + +  R ++   + S +   ++   LW GY NS +NP IY  F+ + +  +  +L
Sbjct:  306 EEECSTRVSRLLKSGEHHQ---RRKRKNQSIFKREQKAAATLGIVVGAFTFCWLPFFLVSTARPFICGVECSCVPLWLERTLLWLGYANSLINPFIYAFFNRDLRTTYSNLL 414          
BLAST of GCR020 vs. Ensembl Medaka
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 112.464 bits (280), Expect = 3.300e-26
Identity = 68/196 (34.69%), Postives = 111/196 (56.63%), Query Frame = 2
Query:  125 QYEPRFQIWPMTXXXXXXXXXXXWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSIT-KLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNS-YTILANFLSFCFPLILMGIVY 706
            Q    F +W    ++++L +I + T   N  V+ TI     ++  +N LI SLA+TDL V++ VMP+  +  V   W LG  +CDIW+ +D+  CTASI HL VIA+DRY +IT  + Y++ R+      M+ ++W+ A  +S+P  F+  R    E +T     +C +N  +  YTI + F +F  P +L+ ++Y
Sbjct:   83 QCSENFSLWYQISLAVILSLITLATTLSNAFVIATISQSKKLQTPANFLIASLAITDLLVSILVMPICVLYTVIHTWTLGQIVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPARAAGMVATAWVIAISISLPPLFW--RQVKAEELT-----SCSVNTDHIFYTIYSTFGAFYIPTLLLIVLY 271          

HSP 2 Score: 76.6406 bits (187), Expect = 1.761e-14
Identity = 38/84 (45.24%), Postives = 55/84 (65.48%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKIL 1762
            KRI+  RE K  +TL II G +I+CWLPF I  LL A  ++     N+ +   F W GY+NS +NPIIYT+ + +F+ AF+K++
Sbjct:  346 KRISAARERKATKTLGIILGAYIVCWLPFFIYTLLVATCVAC---FNQELFDFFTWLGYLNSLINPIIYTMSNEDFKKAFQKLV 426          
BLAST of GCR020 vs. Planmine SMEST
Match: SMESG000016680.1 (SMESG000016680.1)

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 564/564 (100.00%), Postives = 564/564 (100.00%), Query Frame = 2
Query:   92 MNKLVNFTQPVQYEPRFQIWPMTXXXXXXXXXXXWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEXXXXXXXXXXXXXXENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG 1783
            MNKLVNFTQPVQYEPRFQIWPMTLISLLLIIIIIWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYFKIFIFIKKQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEIWSSIYDDSKIIIDENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG
Sbjct:    1 MNKLVNFTQPVQYEPRFQIWPMTLISLLLIIIIIWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYFKIFIFIKKQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEIWSSIYDDSKIIIDENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG 564          
BLAST of GCR020 vs. Planmine SMEST
Match: SMESG000016680.1 (SMESG000016680.1)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 530/530 (100.00%), Postives = 530/530 (100.00%), Query Frame = 2
Query:  194 WTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEXXXXXXXXXXXXXXENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG 1783
            WTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYFKIFIFIKKQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEIWSSIYDDSKIIIDENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG
Sbjct:   14 WTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYFKIFIFIKKQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEIWSSIYDDSKIIIDENSFESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFGSNTSG 543          
BLAST of GCR020 vs. Planmine SMEST
Match: SMESG000019254.1 (SMESG000019254.1)

HSP 1 Score: 300.056 bits (767), Expect = 1.068e-94
Identity = 208/573 (36.30%), Postives = 312/573 (54.45%), Query Frame = 2
Query:   77 FFFPFMNKLVNFTQPVQYEPRFQIWPMTXXXXXXXXXXXWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTK-NRKAIKNSVIGSDALSTTFASDICYSKSTASPFPQSEXXXXXXXXXXXXXXENS-FESTVTESLEKTKWVNEECSNFQYADEEDENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYTTSNLAKTETMSTIEGEIFPLKYQNKDILKSPN----SNKSIIKPSTSNSRKLKSPTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNNEHFQTQISDSLNDNSFASL---AVRVKRINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
             F+ + N  V  +Q  ++ PR       + +L L  II+WTI GNV V+  IV E  +KN SN+LI SLAV DL VA+ VMP+SAIKEVS  WWLG+ELCD+W   DVL+CTASI HLVVIAIDRY ++T + Y   R++     MI   W+ + ++S+PSRF+  RNN  E + V  NG+C+INE  SYT+ +N  +F  P+  M ++Y +I+IF + + +  RK +K +   S+   T   S    +K T +          I + S I+  E+   ES V ++  + +W ++  S  ++AD E EN S                                     +   S+ Y T+                 +K++N D + + N    ++++  +  +++S+K  + T +WSPKL F+ Y+    + KN  +F  +N       SS L+ ++       ++Q S S  DN F ++   ++R  ++ QKRE K  RTL IITG FIICWLPF INN+  A+  ++P   + + DS+ LW GYVNSGLNP+IYT+FS +F+ AF+KIL G
Sbjct:    3 LFYEYEN--VTESQIARFSPRLSWIQFYITALFLGAIILWTIIGNVFVVAAIVLERTLKNVSNYLILSLAVADLMVAILVMPISAIKEVSSTWWLGIELCDLWTCFDVLSCTASILHLVVIAIDRYWAVTDINYLHRRTSSRIILMIIGVWLISVIISVPSRFHTHRNNA-EWLRVIVNGSCIINESVSYTVFSNLGAFYLPMAFMSVIYLRIYIFARSRIRYKRKKMKQNHCLSN---TDHKSCTDQTKPTENTGQCPCNKRKIDEISYILNCEHCKLESLVIQNQNRKEWFDKHMSLLEFAD-EGENDS-------------------------------------LSIQSNFYATT--------------FANVKFENVDHVANVNCVGENDRNKAETMSNHSQKKTNQTTNWSPKLIFYNYKAKLLNFKNDLSFKGSNK------SSELQFNDD------RSQSSLSFKDNKFNAMNSASIR-NKVEQKRERKAARTLAIITGCFIICWLPFGINNVAHAFCNTEPCG-SALFDSLCLWLGYVNSGLNPVIYTVFSPDFRTAFRKILLG 503          
BLAST of GCR020 vs. Planmine SMEST
Match: SMESG000059571.1 (SMESG000059571.1)

HSP 1 Score: 173.711 bits (439), Expect = 6.641e-48
Identity = 90/215 (41.86%), Postives = 136/215 (63.26%), Query Frame = 2
Query:  197 TIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPF 841
            TI GN+LV++ ++ E N++N SN+LI S+A+TDL VA+ VM LSA+ E+S +W+LG+  CD WIFTDV++C+ASIFHLV IA+DRY ++T++ Y  NR+       I S W+ + ++++PSRF+  R  T     V   G CLIN G  YT+L+  ++F  P+I M I+Y+KIF   K+Q + ++     V       +      C  ++T S F
Sbjct:   41 TIVGNILVVLAVLLEKNLRNLSNYLILSMAITDLVVAIFVMNLSAVYEISNRWFLGIAWCDFWIFTDVMSCSASIFHLVTIALDRYWTVTRIEYKHNRTMSQLIFTILSIWMISLMIAVPSRFHFHRLETQMFQEVVIKGRCLINSGYFYTLLSTVIAFYAPMIFMMIIYWKIFQIAKRQIRRKRRFNYEVTFDSKYKSICRYFHCCHRTTESEF 255          

HSP 2 Score: 79.7221 bits (195), Expect = 1.211e-15
Identity = 43/90 (47.78%), Postives = 54/90 (60.00%), Query Frame = 2
Query: 1511 KRINQKREYKVVRTLFIITGLFIICWLPFAINNLL----RAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
             ++  KRE K + T+ IIT  FI+CW+PF    L+     AY I  P     I+ S+ LW GY+N  LNP IYTIFS EF+ AFK IL G
Sbjct:  340 HKVEVKRERKAIITVGIITCCFILCWMPFFTLTLVLPFCGAYCIVHP-----IISSVLLWLGYLNCLLNPFIYTIFSQEFRCAFKNILTG 424          
BLAST of GCR020 vs. Planmine SMEST
Match: SMESG000010648.1 (SMESG000010648.1)

HSP 1 Score: 173.326 bits (438), Expect = 3.020e-46
Identity = 94/216 (43.52%), Postives = 140/216 (64.81%), Query Frame = 2
Query:  107 NFTQPVQYEPRFQIWPMTXXXXXXXXXXXWTIAGNVLVMVTIVTELNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIFTDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTT--AMITSSWIAAALVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLILMGIVYXXXXXXXXXQTKNR 748
            N T P+ + PRF    +     +L+++I+WTI GNV V+  I+ E N+++ SN+LI SLAV DL VAV VMP+S I E+S  WW+G+ LCDIWIF DVL CTAS+ HLV IAIDRY ++T++ + R +S        MI   W  + ++SIPSRF+  RN    +   + +G C +N  ++Y I+AN  +F  P+++M  +Y +I++F K+Q + R
Sbjct:    4 NITVPI-FSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIVISIPSRFHGHRN----QFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKR 214          

HSP 2 Score: 101.293 bits (251), Expect = 3.083e-22
Identity = 53/107 (49.53%), Postives = 72/107 (67.29%), Query Frame = 2
Query: 1472 LNDNSFASLAVRVK-RINQKREYKVVRTLFIITGLFIICWLPFAINNLLRAYVISD-PSEINR------IMDSIFLWFGYVNSGLNPIIYTIFSTEFQVAFKKILFG 1768
            L++  +  L +R + +I Q+RE K  RTL IITG F+ICWLPFA  N++   +ISD P+  N       ++DS  LW GY NS LNPIIYT+FS +F+ +F+KILFG
Sbjct:  526 LSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMIN--LISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFG 630          
The following BLAST results are available for this feature:
BLAST of GCR020 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A6.815e-2936.205-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR72.141e-2638.825-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR72.487e-2638.825-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR73.442e-2638.825-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR1D7.241e-2638.375-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
back to top
BLAST of GCR020 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyra-32.994e-3728.20TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
ser-42.255e-2836.11SERotonin/octopamine receptor family; Serotonin re... [more]
ser-42.255e-2836.11SERotonin/octopamine receptor family; Serotonin re... [more]
octr-14.418e-2434.59OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-15.007e-2434.59OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of GCR020 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT1A1.205e-3643.53gene:FBgn0004168 transcript:FBtr0086577[more]
5-HT1A1.392e-3643.53gene:FBgn0004168 transcript:FBtr0474126[more]
5-HT1B7.834e-3644.12gene:FBgn0263116 transcript:FBtr0330055[more]
5-HT1B1.025e-3544.12gene:FBgn0263116 transcript:FBtr0330056[more]
5-HT1B1.150e-3544.12gene:FBgn0263116 transcript:FBtr0086599[more]
back to top
BLAST of GCR020 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1ab4.542e-3039.185-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1aa6.731e-3040.125-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
htr1ab9.675e-3039.775-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1ab9.675e-3039.775-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1b8.320e-2838.375-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
back to top
BLAST of GCR020 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046867.17.800e-2741.525-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
exd25.876e-2637.79exonuclease 3'-5' domain containing 2 [Source:Xenb... [more]
HTR1F2.508e-2537.215-hydroxytryptamine (serotonin) receptor 1F, G pro... [more]
HTR1E5.059e-2538.695-hydroxytryptamine (serotonin) receptor 1E, G pro... [more]
HTR1D4.256e-2440.705-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
back to top
BLAST of GCR020 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a4.158e-2940.005-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr1f1.700e-2637.505-hydroxytryptamine (serotonin) receptor 1F [Sourc... [more]
Htr71.882e-2638.825-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr71.888e-2638.825-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr73.200e-2638.825-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
back to top
BLAST of GCR020 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25414|5HTR_LYMST4.559e-3744.715-hydroxytryptamine receptor OS=Lymnaea stagnalis ... [more]
sp|P28285|5HT2A_DROME1.208e-3543.535-hydroxytryptamine receptor 2A OS=Drosophila mela... [more]
sp|P28286|5HT2B_DROME1.153e-3444.125-hydroxytryptamine receptor 2B OS=Drosophila mela... [more]
sp|Q25190|5HTR_HELVI5.372e-3242.945-hydroxytryptamine receptor OS=Heliothis virescen... [more]
sp|Q17239|5HTR_BOMMO6.469e-3038.825-hydroxytryptamine receptor OS=Bombyx mori OX=709... [more]
back to top
BLAST of GCR020 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUG60.000e+099.65GCR020 OS=Schmidtea mediterranea OX=79327 GN=gcr02... [more]
A0A193KU566.683e-9136.30GCR006 OS=Schmidtea mediterranea OX=79327 GN=gcr00... [more]
A0A182NK434.986e-5730.02G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A193KUL52.437e-4441.86GCR090 OS=Schmidtea mediterranea OX=79327 GN=gcr09... [more]
A0A193KUE31.034e-4243.52GCR012 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
back to top
BLAST of GCR020 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1ab5.667e-2936.845-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
ENSAMXT00000026144.24.571e-2841.28pep primary_assembly:Astyanax_mexicanus-2.0:9:1435... [more]
htr7a1.694e-2739.535-hydroxytryptamine receptor 7-like [Source:NCBI g... [more]
ENSAMXT00000047213.12.390e-2739.415-hydroxytryptamine receptor 1E [Source:NCBI gene;... [more]
ENSAMXT00000006138.23.835e-2738.29pep primary_assembly:Astyanax_mexicanus-2.0:6:2799... [more]
back to top
BLAST of GCR020 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.11.491e-3040.94pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
HTR1F1.216e-2938.325-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000006411.11.640e-2437.88pep scaffold:Pmarinus_7.0:GL477077:14345:22367:-1 ... [more]
ENSPMAT00000001357.18.201e-2437.70pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
ENSPMAT00000004593.18.355e-2435.67pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
back to top
BLAST of GCR020 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR020 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO286033.204e-1437.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409993.761e-1437.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424632.726e-1330.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366107.331e-1332.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329391.131e-1231.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR020 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005282.28.149e-3137.56pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
HTR1B6.671e-2837.895-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
htr1ab9.638e-2838.015-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr7a1.194e-2738.955-hydroxytryptamine receptor 7 [Source:NCBI gene;A... [more]
HTR1B3.300e-2634.695-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
back to top
BLAST of GCR020 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016680.10.000e+0100.00SMESG000016680.1[more]
SMESG000016680.10.000e+0100.00SMESG000016680.1[more]
SMESG000019254.11.068e-9436.30SMESG000019254.1[more]
SMESG000059571.16.641e-4841.86SMESG000059571.1[more]
SMESG000010648.13.020e-4643.52SMESG000010648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003867 ID=SMED30003867|Name=GCR020|organism=Schmidtea mediterranea sexual|type=transcript|length=1789bp
AAATCGTGTGTCAGAAAAGTGAATTATCAATTTTTATTAATTTCAATGTT
TGTCAATTTGGTTCTGTGCTGAGTGATTTTTTTTCCCATTCATGAACAAA
TTGGTGAATTTCACACAGCCAGTTCAATATGAGCCCCGCTTTCAAATCTG
GCCTATGACTCTCATTAGTCTGCTGTTGATAATTATCATCATTTGGACAA
TTGCCGGCAATGTTCTCGTCATGGTCACCATTGTTACTGAGCTCAATATT
AAGAATTCCTCCAATCATTTGATATTCAGTTTAGCAGTGACTGATTTGTT
CGTCGCCGTTGCTGTGATGCCTTTAAGTGCTATTAAGGAAGTCTCCATCA
AATGGTGGTTAGGACTCGAATTATGTGACATTTGGATTTTTACGGACGTA
CTGACGTGCACAGCGTCGATATTTCACCTTGTGGTGATAGCAATTGATAG
ATATTTATCAATTACCAAACTGACATACAATAGAAATCGGTCAACAGTTT
CGACAACAGCTATGATTACATCTTCATGGATCGCTGCGGCTCTTGTCTCC
ATTCCATCTAGATTCTATTTACAAAGGAATAATACAGTCGAAAGAATAAC
AGTCAATTATAATGGAACATGTCTTATTAATGAAGGAAACTCGTACACAA
TTCTTGCAAATTTCTTATCTTTTTGTTTTCCGCTTATATTAATGGGCATC
GTTTATTTTAAGATTTTTATTTTTATTAAAAAACAAACAAAAAATAGAAA
AGCAATCAAAAATTCAGTAATCGGATCTGATGCTCTTTCAACAACTTTTG
CGTCGGATATTTGCTATTCTAAATCCACAGCGTCTCCATTTCCACAGTCA
GAAATCTGGTCTTCTATTTATGACGACTCAAAAATAATTATAGATGAAAA
TTCCTTTGAAAGCACAGTGACAGAGTCTTTGGAGAAAACGAAATGGGTCA
ATGAAGAATGTTCTAATTTTCAGTATGCCGACGAGGAAGACGAAAATCAG
TCAAAGTCTAATAATAATCTGTCAGAAAATGTTACTAATAAATATTTATA
TTGTCTAGATAAATCATCCACTGAGAGCTTTCCAATGTCATCACTTTATT
TGAACCCTCTTACTATGAAAACTTATTCAGATATATACACAACTTCCAAT
CTTGCTAAAACTGAAACAATGAGCACAATAGAAGGTGAAATTTTCCCATT
AAAATACCAAAATAAGGACATTTTAAAATCTCCCAATTCCAACAAGTCTA
TAATCAAACCCTCGACTTCAAATTCCAGAAAGTTAAAATCTCCGACTTTG
TCGTGGTCACCAAAGTTAACGTTCTTTCCATATCGGCAATCAAAACCGAG
CATTAAAAATGGGTTTAATTTCGTAGAAGCAAACTACTCTTTATTGAGTT
CGATAAGTAGTCCGTTGAAAAACCACAACCATTCAAACAATGAACACTTT
CAAACTCAAATTTCCGACAGTCTCAACGATAACTCTTTCGCGTCTTTAGC
AGTCCGGGTAAAACGAATTAATCAAAAACGTGAATATAAAGTTGTAAGGA
CGTTATTCATCATTACGGGTCTATTTATAATATGTTGGCTACCATTCGCA
ATCAACAACCTTTTACGTGCGTATGTTATTAGTGATCCGTCGGAAATAAA
TAGAATTATGGACAGTATATTTCTTTGGTTCGGGTACGTAAATTCCGGGT
TAAATCCAATTATTTACACAATTTTCTCAACTGAATTTCAGGTAGCATTC
AAAAAGATTTTGTTTGGAAGTAATACATCGGGATAACAG
back to top

protein sequence of SMED30003867-orf-1

>SMED30003867-orf-1 ID=SMED30003867-orf-1|Name=SMED30003867-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=565bp
MNKLVNFTQPVQYEPRFQIWPMTLISLLLIIIIIWTIAGNVLVMVTIVTE
LNIKNSSNHLIFSLAVTDLFVAVAVMPLSAIKEVSIKWWLGLELCDIWIF
TDVLTCTASIFHLVVIAIDRYLSITKLTYNRNRSTVSTTAMITSSWIAAA
LVSIPSRFYLQRNNTVERITVNYNGTCLINEGNSYTILANFLSFCFPLIL
MGIVYFKIFIFIKKQTKNRKAIKNSVIGSDALSTTFASDICYSKSTASPF
PQSEIWSSIYDDSKIIIDENSFESTVTESLEKTKWVNEECSNFQYADEED
ENQSKSNNNLSENVTNKYLYCLDKSSTESFPMSSLYLNPLTMKTYSDIYT
TSNLAKTETMSTIEGEIFPLKYQNKDILKSPNSNKSIIKPSTSNSRKLKS
PTLSWSPKLTFFPYRQSKPSIKNGFNFVEANYSLLSSISSPLKNHNHSNN
EHFQTQISDSLNDNSFASLAVRVKRINQKREYKVVRTLFIITGLFIICWL
PFAINNLLRAYVISDPSEINRIMDSIFLWFGYVNSGLNPIIYTIFSTEFQ
VAFKKILFGSNTSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 186..209
score: 26.32
coord: 102..124
score: 39.73
coord: 484..508
score: 35.04
coord: 24..48
score: 26.24
coord: 524..550
score: 32.59
coord: 57..78
score: 32.89
coord: 137..158
score: 22.19
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 33..557
e-value: 0.0045
score: -64.2
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 39..542
e-value: 2.9E-63
score: 213.7
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 108..124
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 28..216
e-value: 9.4E-54
score: 185.0
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 476..554
e-value: 5.5E-27
score: 96.9
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 217..309
e-value: 9.4E-54
score: 185.0
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 429..475
e-value: 5.5E-27
score: 96.9
NoneNo IPR availablePANTHERPTHR24247:SF1985-HYDROXYTRYPTAMINE RECEPTOR 2A-RELATEDcoord: 21..559
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 21..559
NoneNo IPR availableCDDcd153317tmA_5-HT1A_invertebratescoord: 36..223
e-value: 1.2162E-60
score: 199.502
NoneNo IPR availableCDDcd153317tmA_5-HT1A_invertebratescoord: 479..553
e-value: 1.30353E-22
score: 95.4986
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 17..559
NoneNo IPR availableTMHMMTMhelixcoord: 25..47
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 482..504
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 526..545
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 39..542
score: 38.908