Centrosomal protein of 162 kDa

Overview
NameCentrosomal protein of 162 kDa
Smed IDSMED30003857
Length (bp)5464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein of 162 kDa (SMED30003857) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein of 162 kDa (SMED30003857) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein of 162 kDa (SMED30003857) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein of 162 kDa (SMED30003857) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003857

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003857h1SMcG0017221 SmedASXL_017884SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003857h1SMcG0017221 dd_Smed_v4_9279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003857h1SMcG0017221 dd_Smed_v4_9279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003857h1SMcG0017221 dd_Smed_v4_9279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003857h1SMcG0017221 dd_Smed_v4_9279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003857h1SMcG0017221 dd_Smed_v4_9279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30003857h1SMcG0017221 dd_Smed_v4_9279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003857h1SMcG0017221 dd_Smed_v6_9279_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003857h1SMcG0017221 dd_Smed_v4_9279_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Human
Match: CEP162 (centrosomal protein 162 [Source:HGNC Symbol;Acc:HGNC:21107])

HSP 1 Score: 123.635 bits (309), Expect = 2.363e-27
Identity = 225/935 (24.06%), Postives = 427/935 (45.67%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSV------TPPNKTS---VQN------SSKSQPVSVRKKSGQQHNKPSS--RSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLL---NTTGIL-------ENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDL---YS------LVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPE--------------KQTRITDLRANVEVL---NKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQ-----------------RSSETN------------YSPSLL------ELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNE-EFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            KPQS  Y+ V+SSGYG  S       T   KTS   +++      S+ +QP      SG +  KP++  + + K+E  + +R KS            PT   +   F   +      EN   K     +    +E ++KW   + ++++++A  S +E+++  ++E + ++ E+++  L       Q++L+  ++  + +   +       VT + + +I++E+++Q  +L  Y+++NE+L+ ++K L+ Q+KK E+ +   EN+ L S++ SLK ++       R + Q+ ++++     N T +L       + KD   E I  +K + Q L   +   + ER +A  K  I  +  EK      +E++I       L+E+HK E+  L+++++WY ENQ +LD++  +L+  + EI +LK     L   S +  I   IR K+K  + +K++ LE ++  ++  L   Y       ++     G+  +K T++F+E +IK LE+D +   +    S R+++QQF+ MK QYE+++   E  L  K++    P                Q  + +L A ++VL   N EL+ K           K      + + Q E      + V +N      +  +++    V RL+    ++ +N+                   SS+ N            Y P         E+  EN   K+++  L  E N  +   E + M+  +N    ++E+  + I   +  H+  +  +    A  +S S++A L  +I  Q+  I H Q Q+ E   K  ++           KEI  L  EL + +   +  P ++    L  KI Q+E +   R ++L + +++  +    +   EVE+W+ +   KN+ L   + ELD +L+ L EL RQG+V+P
Sbjct:  501 KPQSGLYASVRSSGYGKPSSPLKMFSTLEKKTSEDIIKSKNLRSISTSNQPRKKEILSGTKLIKPAALDKPAHKTESCLSTRKKS----------ENPTETDSCIQF-QTDSLGYCGENKEKKLL---MFKRVQEAEDKWRGAQALIEQIKATFSEKEKELENKLEELKKQQEKELFKLNQDNYILQAKLSSFEETNKKQRWLHFGEAADPVTGEKLKQIQKEIQEQETLLQGYQQENERLYNQVKDLQEQNKKNEERM-FKENQSLFSEVASLKEQMHKS----RFLSQVVEDSEPTRNQNFTDLLAELRMAQKEKDSLLEDIKRLKQDKQALEVDFEKMKKERDQA--KDQIAYVTGEKL-----YEIKI-------LEETHKQEISRLQKRLQWYAENQELLDKDALRLREANEEIEKLKLEIEKLKAESGNPSIRQKIRLKDKAADAKKIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDTVDKNTVEFMEKRIKKLEADLEGKDEDAKKSLRTMEQQFQKMKIQYEQRLEQQEQLLACKLNQHDSPRIKALEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVK--------KNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKGREEMSAKRAKKDVLHSSKGNANSFPGTLDSKLYQPHTFTDSHVSEVLQENYRLKNELEGLISEKNELKMKSEAV-MNQFENSMRRVKEDTAAHIASLKASHQREIEKLLCQNAVENSSSKVAELNRKIATQEVLIRHFQSQVNELQSKQESLVVSEVREEILQKEITKLLEELREAK--ENHTPEMKHFVGLEKKIKQMEMRHAQREQELQQIIQQTHQVVETEQNKEVEKWKRLAQLKNRELEKFRTELDSILDVLRELHRQGVVVP 1391          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Human
Match: CEP162 (centrosomal protein 162 [Source:HGNC Symbol;Acc:HGNC:21107])

HSP 1 Score: 122.865 bits (307), Expect = 3.719e-27
Identity = 228/938 (24.31%), Postives = 430/938 (45.84%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSV------TPPNKTS---VQN------SSKSQPVSVRKK---SGQQHNKPSS--RSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLL---NTTGIL-------ENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDL---YS------LVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPE--------------KQTRITDLRANVEVL---NKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQ-----------------RSSETN------------YSPSLL------ELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNE-EFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            KPQS  Y+ V+SSGYG  S       T   KTS   +++      S+ +QP   RKK   SG +  KP++  + + K+E  + +R KS            PT   +   F   +      EN   K     +    +E ++KW   + ++++++A  S +E+++  ++E + ++ E+++  L       Q++L+  ++  + +   +       VT + + +I++E+++Q  +L  Y+++NE+L+ ++K L+ Q+KK E+ +   EN+ L S++ SLK ++       R + Q+ ++++     N T +L       + KD   E I  +K + Q L   +   + ER +A  K  I  +  EK      +E++I       L+E+HK E+  L+++++WY ENQ +LD++  +L+  + EI +LK     L   S +  I   IR K+K  + +K++ LE ++  ++  L   Y       ++     G+  +K T++F+E +IK LE+D +   +    S R+++QQF+ MK QYE+++   E  L  K++    P                Q  + +L A ++VL   N EL+ K           K      + + Q E      + V +N      +  +++    V RL+    ++ +N+                   SS+ N            Y P         E+  EN   K+++  L  E N  +   E + M+  +N    ++E+  + I   +  H+  +  +    A  +S S++A L  +I  Q+  I H Q Q+ E   K  ++           KEI  L  EL + +   +  P ++    L  KI Q+E +   R ++L + +++  +    +   EVE+W+ +   KN+ L   + ELD +L+ L EL RQG+V+P
Sbjct:  425 KPQSGLYASVRSSGYGKPSSPLKMFSTLEKKTSEDIIKSKNLRSISTSNQP---RKKEILSGTKLIKPAALDKPAHKTESCLSTRKKS----------ENPTETDSCIQF-QTDSLGYCGENKEKKLL---MFKRVQEAEDKWRGAQALIEQIKATFSEKEKELENKLEELKKQQEKELFKLNQDNYILQAKLSSFEETNKKQRWLHFGEAADPVTGEKLKQIQKEIQEQETLLQGYQQENERLYNQVKDLQEQNKKNEERM-FKENQSLFSEVASLKEQMHKS----RFLSQVVEDSEPTRNQNFTDLLAELRMAQKEKDSLLEDIKRLKQDKQALEVDFEKMKKERDQA--KDQIAYVTGEKL-----YEIKI-------LEETHKQEISRLQKRLQWYAENQELLDKDALRLREANEEIEKLKLEIEKLKAESGNPSIRQKIRLKDKAADAKKIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDTVDKNTVEFMEKRIKKLEADLEGKDEDAKKSLRTMEQQFQKMKIQYEQRLEQQEQLLACKLNQHDSPRIKALEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVK--------KNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKGREEMSAKRAKKDVLHSSKGNANSFPGTLDSKLYQPHTFTDSHVSEVLQENYRLKNELEGLISEKNELKMKSEAV-MNQFENSMRRVKEDTAAHIASLKASHQREIEKLLCQNAVENSSSKVAELNRKIATQEVLIRHFQSQVNELQSKQESLVVSEVREEILQKEITKLLEELREAK--ENHTPEMKHFVGLEKKIKQMEMRHAQREQELQQIIQQTHQVVETEQNKEVEKWKRLAQLKNRELEKFRTELDSILDVLRELHRQGVVVP 1315          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Human
Match: CEP162 (centrosomal protein 162 [Source:HGNC Symbol;Acc:HGNC:21107])

HSP 1 Score: 122.865 bits (307), Expect = 3.719e-27
Identity = 228/938 (24.31%), Postives = 430/938 (45.84%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSV------TPPNKTS---VQN------SSKSQPVSVRKK---SGQQHNKPSS--RSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLL---NTTGIL-------ENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDL---YS------LVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPE--------------KQTRITDLRANVEVL---NKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQ-----------------RSSETN------------YSPSLL------ELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNE-EFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            KPQS  Y+ V+SSGYG  S       T   KTS   +++      S+ +QP   RKK   SG +  KP++  + + K+E  + +R KS            PT   +   F   +      EN   K     +    +E ++KW   + ++++++A  S +E+++  ++E + ++ E+++  L       Q++L+  ++  + +   +       VT + + +I++E+++Q  +L  Y+++NE+L+ ++K L+ Q+KK E+ +   EN+ L S++ SLK ++       R + Q+ ++++     N T +L       + KD   E I  +K + Q L   +   + ER +A  K  I  +  EK      +E++I       L+E+HK E+  L+++++WY ENQ +LD++  +L+  + EI +LK     L   S +  I   IR K+K  + +K++ LE ++  ++  L   Y       ++     G+  +K T++F+E +IK LE+D +   +    S R+++QQF+ MK QYE+++   E  L  K++    P                Q  + +L A ++VL   N EL+ K           K      + + Q E      + V +N      +  +++    V RL+    ++ +N+                   SS+ N            Y P         E+  EN   K+++  L  E N  +   E + M+  +N    ++E+  + I   +  H+  +  +    A  +S S++A L  +I  Q+  I H Q Q+ E   K  ++           KEI  L  EL + +   +  P ++    L  KI Q+E +   R ++L + +++  +    +   EVE+W+ +   KN+ L   + ELD +L+ L EL RQG+V+P
Sbjct:  425 KPQSGLYASVRSSGYGKPSSPLKMFSTLEKKTSEDIIKSKNLRSISTSNQP---RKKEILSGTKLIKPAALDKPAHKTESCLSTRKKS----------ENPTETDSCIQF-QTDSLGYCGENKEKKLL---MFKRVQEAEDKWRGAQALIEQIKATFSEKEKELENKLEELKKQQEKELFKLNQDNYILQAKLSSFEETNKKQRWLHFGEAADPVTGEKLKQIQKEIQEQETLLQGYQQENERLYNQVKDLQEQNKKNEERM-FKENQSLFSEVASLKEQMHKS----RFLSQVVEDSEPTRNQNFTDLLAELRMAQKEKDSLLEDIKRLKQDKQALEVDFEKMKKERDQA--KDQIAYVTGEKL-----YEIKI-------LEETHKQEISRLQKRLQWYAENQELLDKDALRLREANEEIEKLKLEIEKLKAESGNPSIRQKIRLKDKAADAKKIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDTVDKNTVEFMEKRIKKLEADLEGKDEDAKKSLRTMEQQFQKMKIQYEQRLEQQEQLLACKLNQHDSPRIKALEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVK--------KNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKGREEMSAKRAKKDVLHSSKGNANSFPGTLDSKLYQPHTFTDSHVSEVLQENYRLKNELEGLISEKNELKMKSEAV-MNQFENSMRRVKEDTAAHIASLKASHQREIEKLLCQNAVENSSSKVAELNRKIATQEVLIRHFQSQVNELQSKQESLVVSEVREEILQKEITKLLEELREAK--ENHTPEMKHFVGLEKKIKQMEMRHAQREQELQQIIQQTHQVVETEQNKEVEKWKRLAQLKNRELEKFRTELDSILDVLRELHRQGVVVP 1315          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Zebrafish
Match: AL954130.1 (pep chromosome:GRCz11:CHR_ALT_CTG16_1_19:37885620:37937135:1 gene:ENSDARG00000110161.1 transcript:ENSDART00000191439.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL954130.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.082e-18
Identity = 105/400 (26.25%), Postives = 204/400 (51.00%), Query Frame = 1
Query: 1792 LQSQLNRAKQQL-QMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQK--YIHSESERQKADKK---LDIMLLDAEKRLSQ----CKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHL---LGASNSIKISSNIR-AKEKLIETEKVKQLENEIMS----LK----TDLYSLVKGKNIGNVAEKR-----------TIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELE 2892
            LQS+L+RA++   + K  F +      VT++ +  IE+EMK+Q  ++  Y ++NEKL+ ++K L+   K  +    MEN+RL++++   +  +++      N+++  +E  ++       ++ F+   I E+ +++Q   +K   +  E  R K +K+   +D+ ++  E+ L++    CK     +  E++ L + H+ EV +LK++++WY ENQ +LD++  +L     EI +L      L A  S + +   R AKEK  E ++++ LE ++      LK      L +L+         E R           T   LE ++  LE++ +   +    S R+++QQ+  +K QYE++I DLE  L  K  + S P   + +  ++++ + L  ELE
Sbjct:  614 LQSKLHRAEEASNKRKWSFGEA--SDPVTEEKLKLIEKEMKEQETLIQGYHQENEKLYLQMKALQAQSKQNEEALFMENQRLLTELSFARDRMNTN-----NIQRTIRERSIV-------DQSFN---IAELTSQVQAAQKKEERLQEEVRRLKQEKQALHVDLEMMRKERDLAKVQAVCKS--GDKGFELKLLHDKHREEVTELKKRLQWYAENQELLDKDAARLHAATAEIQKLTEQVEKLKAEVSRRANEQQRKAKEKAGEAKRIQDLERQLKQKEELLKRRHPNSLPALILAAASTGAEEDRLDVRSPAQSSQTAALLERRVHRLEAELEGRDEAAKRSLRAMEQQYHRIKLQYEQQISDLEQRLSEK--SHSYPAISSEL--IKSHTQTLKAELE 990          

HSP 2 Score: 57.7658 bits (138), Expect = 1.799e-7
Identity = 57/169 (33.73%), Postives = 90/169 (53.25%), Query Frame = 1
Query: 3307 HKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEF-NVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            H++ + ++   +A  HS S +A L SQ+  Q+  + HLQGQ+ E    K A   TK  E T  N ++  L  EL + +   S  P L+    L  KI  +E + + R +QL + +    +   ++ Q EVERWR +   + + L   + ELD +L+ L EL+RQG+VIP
Sbjct: 1183 HRKEIEHLLARHALEHSSSRVAELTSQLNTQEIIVQHLQGQVKELQGTKEALAVTKLREETLQN-QLSKLLEELKEAKEAHS--PELKHFTSLEQKIQSMEFRYSQREKQLQQVIADTRRVVEQEQQSEVERWRKLAQGRAKELEAFRMELDSILDILRELQRQGVVIP 1348          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Zebrafish
Match: cep162 (Danio rerio centrosomal protein 162 (cep162), mRNA. [Source:RefSeq mRNA;Acc:NM_001353863])

HSP 1 Score: 91.2781 bits (225), Expect = 8.828e-18
Identity = 104/400 (26.00%), Postives = 204/400 (51.00%), Query Frame = 1
Query: 1792 LQSQLNRAKQQL-QMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQK--YIHSESERQKADKK---LDIMLLDAEKRLSQ----CKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHL---LGASNSIKISSNIR-AKEKLIETEKVKQLENEIMS----LK----TDLYSLVKGKNIGNVAEKR-----------TIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELE 2892
            LQS+L+RA++   + K  F +      VT++ +  IE+EMK+Q  ++  Y ++NEKL+ ++K L+   K  +    MEN+RL++++   +  +++      N+++  +E  ++       ++ F+   I E+ +++Q   +K   +  E  R K +K+   +D+ ++  E+ L++    CK     +  E++ L + H+ EV +LK++++WY +NQ +LD++  +L     EI +L      L A  S + +   R AKEK  E ++++ LE ++      LK      L +L+         E R           T   LE ++  LE++ +   +    S R+++QQ+  +K QYE++I DLE  L  K  + S P   + +  ++++ + L  ELE
Sbjct:  616 LQSKLHRAEEASNKRKWSFGEA--SDPVTEEKLKLIEKEMKEQETLIQGYHQENEKLYLQMKALQAQSKQNEEALFMENQRLLTELSFARDRMNTN-----NIQRTIRERSIV-------DQSFN---IAELTSQVQAAQKKEERLQEEVRRLKQEKQALHVDLEMMRKERDLAKVQAVCKS--GDKGFELKLLHDKHREEVTELKKRLQWYAKNQELLDKDAARLHAATAEIQKLTEQVEKLKAEVSRRANEQQRKAKEKAGEAKRIQDLERQLKQKEELLKRRHPNSLPALILAAASTGAEEDRLDVRSLAQSSQTAALLERRVHRLEAELEGRDEAAKRSLRAMEQQYHRIKLQYEQQISDLEQRLSEK--SHSYPAISSEL--IKSHTQTLKAELE 992          

HSP 2 Score: 57.7658 bits (138), Expect = 1.586e-7
Identity = 57/169 (33.73%), Postives = 90/169 (53.25%), Query Frame = 1
Query: 3307 HKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEF-NVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            H++ + ++   +A  HS S +A L SQ+  Q+  + HLQGQ+ E    K A   TK  E T  N ++  L  EL + +   S  P L+    L  KI  +E + + R +QL + +    +   ++ Q EVERWR +   + + L   + ELD +L+ L EL+RQG+VIP
Sbjct: 1185 HRKEIEHLLARHALEHSSSRVAELTSQLNTQEIIVQHLQGQVKELQGTKEALAVTKLREETLQN-QLSKLLEELKEAKEAHS--PELKHFTSLEQKIQSMEFRYSQREKQLQQVIADTRRVVEQEQQSEVERWRKLAQGRAKELEAFRMELDSILDVLRELQRQGVVIP 1350          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Zebrafish
Match: cep162 (Danio rerio centrosomal protein 162 (cep162), mRNA. [Source:RefSeq mRNA;Acc:NM_001353863])

HSP 1 Score: 91.2781 bits (225), Expect = 8.828e-18
Identity = 104/400 (26.00%), Postives = 204/400 (51.00%), Query Frame = 1
Query: 1792 LQSQLNRAKQQL-QMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQK--YIHSESERQKADKK---LDIMLLDAEKRLSQ----CKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHL---LGASNSIKISSNIR-AKEKLIETEKVKQLENEIMS----LK----TDLYSLVKGKNIGNVAEKR-----------TIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELE 2892
            LQS+L+RA++   + K  F +      VT++ +  IE+EMK+Q  ++  Y ++NEKL+ ++K L+   K  +    MEN+RL++++   +  +++      N+++  +E  ++       ++ F+   I E+ +++Q   +K   +  E  R K +K+   +D+ ++  E+ L++    CK     +  E++ L + H+ EV +LK++++WY +NQ +LD++  +L     EI +L      L A  S + +   R AKEK  E ++++ LE ++      LK      L +L+         E R           T   LE ++  LE++ +   +    S R+++QQ+  +K QYE++I DLE  L  K  + S P   + +  ++++ + L  ELE
Sbjct:  616 LQSKLHRAEEASNKRKWSFGEA--SDPVTEEKLKLIEKEMKEQETLIQGYHQENEKLYLQMKALQAQSKQNEEALFMENQRLLTELSFARDRMNTN-----NIQRTIRERSIV-------DQSFN---IAELTSQVQAAQKKEERLQEEVRRLKQEKQALHVDLEMMRKERDLAKVQAVCKS--GDKGFELKLLHDKHREEVTELKKRLQWYAKNQELLDKDAARLHAATAEIQKLTEQVEKLKAEVSRRANEQQRKAKEKAGEAKRIQDLERQLKQKEELLKRRHPNSLPALILAAASTGAEEDRLDVRSLAQSSQTAALLERRVHRLEAELEGRDEAAKRSLRAMEQQYHRIKLQYEQQISDLEQRLSEK--SHSYPAISSEL--IKSHTQTLKAELE 992          

HSP 2 Score: 57.7658 bits (138), Expect = 1.586e-7
Identity = 57/169 (33.73%), Postives = 90/169 (53.25%), Query Frame = 1
Query: 3307 HKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEF-NVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            H++ + ++   +A  HS S +A L SQ+  Q+  + HLQGQ+ E    K A   TK  E T  N ++  L  EL + +   S  P L+    L  KI  +E + + R +QL + +    +   ++ Q EVERWR +   + + L   + ELD +L+ L EL+RQG+VIP
Sbjct: 1185 HRKEIEHLLARHALEHSSSRVAELTSQLNTQEIIVQHLQGQVKELQGTKEALAVTKLREETLQN-QLSKLLEELKEAKEAHS--PELKHFTSLEQKIQSMEFRYSQREKQLQQVIADTRRVVEQEQQSEVERWRKLAQGRAKELEAFRMELDSILDVLRELQRQGVVIP 1350          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Xenopus
Match: ENSXETT00000008848.1 (centrosomal protein 162kDa [Source:NCBI gene;Acc:100379880])

HSP 1 Score: 84.3445 bits (207), Expect = 1.229e-15
Identity = 92/347 (26.51%), Postives = 169/347 (48.70%), Query Frame = 1
Query: 1870 VTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQI-VSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKK-LDIMLLDAEKRLSQCK----HELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKH----LLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDLYSLVKGKNIGNV------------------AEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQ 2826
            VT + I +I +E+++Q  +L  Y+++NE+L+Q++K L+        I + +NE L+ Q   SLKA L    + L  +  + +E  LL+                                E  RQK DK+ L++ L+   K     K    H    +  EM+ ++E++K E+  L +K+KW+ ENQ +LD++  +L+    +I  LK     L   + +  +    RAKE+  + ++++ LE ++     ++  ++K ++  ++                  A+K TI FLE ++K LE+D +    +   S R+++QQF+ +K QYE +I++LE  L  K+ N  Q
Sbjct:   89 VTDEKIQQIRKEIEEQEKLLHGYQQENERLYQQVKELQ--------IRNKQNEELMFQENQSLKANL----LSLSELFVLKREANLLD--------------------------------EISRQKQDKQALEVDLMQMRKERDNVKTLLSHTSGDKSYEMKMMEETYKQEINVLNKKLKWFAENQELLDKDANRLRDAYEQIEILKMQVEKLKNETGNQSVQQQKRAKERAADAKRIQDLERQV----KEMEGIIKRRHPNSIPALIFAAAAAPECDDKDSAKKNTIAFLERRVKKLETDLESKDDESKKSLRTMEQQFQKVKIQYESRIKELEELLTHKLMNPPQ 387          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Xenopus
Match: ENSXETT00000003393.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460699.1:49736:54853:1 gene:ENSXETG00000006559.1 transcript:ENSXETT00000003393.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 3.367e-8
Identity = 77/313 (24.60%), Postives = 144/313 (46.01%), Query Frame = 1
Query: 2632 AEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKI--------DNKSQPEK------------QTRITDL--------RANVEVLNKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRTEMLQ----LALKEKENEVHRLETQNNVLRNNEQRSS---ETNYSPSLL------ELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKN--EEFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEF 3441
            A+K TI FLE ++K LE+D +    +   S R+++QQF+ +K QYE +I++LE  L  K+        DN ++ +K            QT I +L        + N+ + N E +K++   +      +  NK+   +L  E   K +   ++    E LQ    + L +   ++  L  ++  +R+N        E  Y P         + QAEN   K ++  L+ +IN  ++  + + +S  +N  + F+++    ++      H++ +  +   +A  HS S++A L S+   Q+  I HLQ Q+ E 
Sbjct:   32 AKKNTIAFLERRVKKLETDLESKDDESKKSLRTMEQQFQKVKIQYESRIKELEELLTHKLINPPQKPFDNSTKAQKFEDELLICKETHQTTIQNLQRQIDLHRKKNLVLENNERKKEANLSDIGTKVEEHSNKDLIAKLSQELIAKRIEIQDLTKTVERLQKERMIMLSQARTDISALGKRS--IRDNMNFPGTLDEKQYHPGTFADIHISDAQAENTALKCEVERLSLKINEQKETFQTL-LSQAENTIKRFVKQASALKL-----LHQKEVEKLICQHAIDHSSSKVAELSSKTSTQEILIKHLQTQVKEL 336          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:Xenbase;Acc:XB-GENE-1015605])

HSP 1 Score: 52.373 bits (124), Expect = 4.223e-6
Identity = 27/65 (41.54%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 2632 AEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQ 2826
            A+K TI FLE ++K LE+D +    +   S R+++QQF+ +K QYE +I++LE  L  K+ N  Q
Sbjct:   32 AKKNTIAFLERRVKKLETDLESKDDESKKSLRTMEQQFQKVKIQYESRIKELEELLTHKLINPPQ 96          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Mouse
Match: Cep162 (centrosomal protein 162 [Source:MGI Symbol;Acc:MGI:1925343])

HSP 1 Score: 121.324 bits (303), Expect = 6.775e-27
Identity = 147/586 (25.09%), Postives = 281/586 (47.95%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSVTP-------PNKTSVQN----SSKSQPVS--VRKK---SGQQHNKP--SSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESF---ENSPIKQFSGHVDH------NSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLN------RAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEI-------ERT---------------EMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDL---YS------LVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQ 2838
            KPQS  Y+  +SSGYG  S +P         KTS  N    S +S P S   RK+   SG +  KP  S++ S   EG     S + P+                    P++  D+SF   +  P+  + G+ +        +++ +EKW   + ++++++     +E+++   +ES+ ++ E ++  L       Q++L+      R ++ LQ   + +D L G     + + +I++E+++Q  +L  Y+++NE+L+ ++K L+ Q+KK E+ +   EN+ L S++ SLK ++                           +K+    Q VE  N     NQ +    +E + A K+ + ++ D  KRL Q K  LE+       ER                E++ L+E+HK EV  L+++++WY ENQ +LD++  +L+  + E  +L+     L   S S      +R+KE+ ++ ++++ LE ++  ++  L   Y       ++     G+  ++ T++F+E +IK LE+D +   ++   S R+++QQF+ MK QYE+++ + E  L  +   K  P+ Q
Sbjct:  499 KPQSGLYASARSSGYGKPS-SPLQLFSALEKKTSKDNTKTKSVRSIPTSNQFRKREILSGTKLIKPAASNKPSPHREG-----SPATPKR-------------------PEDPSDDSFVQLQTEPLGSYGGNREKELLMLKRAQDAEEKWTGAQALMEQMKMTFCEKEKELENTVESLKRQQERELFRLNQENYILQAKLSSFEETSRKQRWLQFG-ETSDPLTG-----EKLKQIQKEIQEQETLLQGYQQENERLYNQVKDLQEQNKKNEERM-FKENQNLFSELASLKEQM---------------------------HKNHFLSQAVE--NTEPTKNQSFTDLLAELRAAQKEKNHLMEDI-KRLKQDKQALEVDLEKVKRERDQAKDQIAYATGEKLYEIKILEETHKQEVSRLQKRLQWYAENQELLDRDAARLREANEETEKLRLEIEKLKTESGSPATQQRLRSKERALDAKRIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDSVDRNTVEFMERRIKKLEADLEGKDEEAKKSLRTMEQQFQKMKIQYEQRLEEQEQLLAHR--QKEAPQSQ 1020          
BLAST of Centrosomal protein of 162 kDa vs. UniProt/SwissProt
Match: sp|Q5TB80|CE162_HUMAN (Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.135e-26
Identity = 225/935 (24.06%), Postives = 427/935 (45.67%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSV------TPPNKTS---VQN------SSKSQPVSVRKKSGQQHNKPSS--RSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLL---NTTGIL-------ENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDL---YS------LVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPE--------------KQTRITDLRANVEVL---NKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQ-----------------RSSETN------------YSPSLL------ELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNE-EFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            KPQS  Y+ V+SSGYG  S       T   KTS   +++      S+ +QP      SG +  KP++  + + K+E  + +R KS            PT   +   F   +      EN   K     +    +E ++KW   + ++++++A  S +E+++  ++E + ++ E+++  L       Q++L+  ++  + +   +       VT + + +I++E+++Q  +L  Y+++NE+L+ ++K L+ Q+KK E+ +   EN+ L S++ SLK ++       R + Q+ ++++     N T +L       + KD   E I  +K + Q L   +   + ER +A  K  I  +  EK      +E++I       L+E+HK E+  L+++++WY ENQ +LD++  +L+  + EI +LK     L   S +  I   IR K+K  + +K++ LE ++  ++  L   Y       ++     G+  +K T++F+E +IK LE+D +   +    S R+++QQF+ MK QYE+++   E  L  K++    P                Q  + +L A ++VL   N EL+ K           K      + + Q E      + V +N      +  +++    V RL+    ++ +N+                   SS+ N            Y P         E+  EN   K+++  L  E N  +   E + M+  +N    ++E+  + I   +  H+  +  +    A  +S S++A L  +I  Q+  I H Q Q+ E   K  ++           KEI  L  EL + +   +  P ++    L  KI Q+E +   R ++L + +++  +    +   EVE+W+ +   KN+ L   + ELD +L+ L EL RQG+V+P
Sbjct:  501 KPQSGLYASVRSSGYGKPSSPLKMFSTLEKKTSEDIIKSKNLRSISTSNQPRKKEILSGTKLIKPAALDKPAHKTESCLSTRKKS----------ENPTETDSCIQF-QTDSLGYCGENKEKKLL---MFKRVQEAEDKWRGAQALIEQIKATFSEKEKELENKLEELKKQQEKELFKLNQDNYILQAKLSSFEETNKKQRWLHFGEAADPVTGEKLKQIQKEIQEQETLLQGYQQENERLYNQVKDLQEQNKKNEERM-FKENQSLFSEVASLKEQMHKS----RFLSQVVEDSEPTRNQNFTDLLAELRMAQKEKDSLLEDIKRLKQDKQALEVDFEKMKKERDQA--KDQIAYVTGEKL-----YEIKI-------LEETHKQEISRLQKRLQWYAENQELLDKDALRLREANEEIEKLKLEIEKLKAESGNPSIRQKIRLKDKAADAKKIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDTVDKNTVEFMEKRIKKLEADLEGKDEDAKKSLRTMEQQFQKMKIQYEQRLEQQEQLLACKLNQHDSPRIKALEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVK--------KNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKGREEMSAKRAKKDVLHSSKGNANSFPGTLDSKLYQPHTFTDSHVSEVLQENYRLKNELEGLISEKNELKMKSEAV-MNQFENSMRRVKEDTAAHIASLKASHQREIEKLLCQNAVENSSSKVAELNRKIATQEVLIRHFQSQVNELQSKQESLVVSEVREEILQKEITKLLEELREAK--ENHTPEMKHFVGLEKKIKQMEMRHAQREQELQQIIQQTHQVVETEQNKEVEKWKRLAQLKNRELEKFRTELDSILDVLRELHRQGVVVP 1391          
BLAST of Centrosomal protein of 162 kDa vs. UniProt/SwissProt
Match: sp|Q6ZQ06|CE162_MOUSE (Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 4.739e-26
Identity = 147/586 (25.09%), Postives = 281/586 (47.95%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSVTP-------PNKTSVQN----SSKSQPVS--VRKK---SGQQHNKP--SSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESF---ENSPIKQFSGHVDH------NSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLN------RAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEI-------ERT---------------EMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDL---YS------LVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQ 2838
            KPQS  Y+  +SSGYG  S +P         KTS  N    S +S P S   RK+   SG +  KP  S++ S   EG     S + P+                    P++  D+SF   +  P+  + G+ +        +++ +EKW   + ++++++     +E+++   +ES+ ++ E ++  L       Q++L+      R ++ LQ   + +D L G     + + +I++E+++Q  +L  Y+++NE+L+ ++K L+ Q+KK E+ +   EN+ L S++ SLK ++                           +K+    Q VE  N     NQ +    +E + A K+ + ++ D  KRL Q K  LE+       ER                E++ L+E+HK EV  L+++++WY ENQ +LD++  +L+  + E  +L+     L   S S      +R+KE+ ++ ++++ LE ++  ++  L   Y       ++     G+  ++ T++F+E +IK LE+D +   ++   S R+++QQF+ MK QYE+++ + E  L  +   K  P+ Q
Sbjct:  499 KPQSGLYASARSSGYGKPS-SPLQLFSALEKKTSKDNTKTKSVRSIPTSNQFRKREILSGTKLIKPAASNKPSPHREG-----SPATPKR-------------------PEDPSDDSFVQLQTEPLGSYGGNREKELLMLKRAQDAEEKWTGAQALMEQMKMTFCEKEKELENTVESLKRQQERELFRLNQENYILQAKLSSFEETSRKQRWLQFG-ETSDPLTG-----EKLKQIQKEIQEQETLLQGYQQENERLYNQVKDLQEQNKKNEERM-FKENQNLFSELASLKEQM---------------------------HKNHFLSQAVE--NTEPTKNQSFTDLLAELRAAQKEKNHLMEDI-KRLKQDKQALEVDLEKVKRERDQAKDQIAYATGEKLYEIKILEETHKQEVSRLQKRLQWYAENQELLDRDAARLREANEETEKLRLEIEKLKTESGSPATQQRLRSKERALDAKRIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDSVDRNTVEFMERRIKKLEADLEGKDEEAKKSLRTMEQQFQKMKIQYEQRLEEQEQLLAHR--QKEAPQSQ 1020          
BLAST of Centrosomal protein of 162 kDa vs. UniProt/SwissProt
Match: sp|Q91365|CE162_COTCO (Centrosomal protein of 162 kDa (Fragment) OS=Coturnix coturnix OX=9091 GN=CEP162 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.965e-24
Identity = 218/950 (22.95%), Postives = 429/950 (45.16%), Query Frame = 1
Query:  682 LLSKVSLLDSYD------------GHKLSKPD--------ELESTGFLENDNQKLDESNEYMYKNSFNPASGDN-----FNTTQAITNVTDTVIG----------DTTAADFAALHK-----QFEKYNNKESFEFNPETNV-----PLSETIKDL-YEEKSNQ----------FDDFSKLNLESTINSKSFGLRIIHPDHEESKSSPVPTPRPRTKNKVSKSDSKEKYENIAIITLIRCIQNTEMEIIKDDSVISNGERNSETNEKPQSKRYSH--VKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTK----SEGNVRSRSKSVPRNDDII----DQNYPTHIKNQTY--FIPKNQFDESFENSPIKQFSGHVD--HNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLN----TTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLG-----ASNSIKISSNIRAKEKLIETEKVKQLENEIM------------SLKTDLYSLVKGKNIGNVAEKR-TIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQRSSETNYSPSLLELQAENANCKSQIIHLTQEINNYRQAIEDI 3231
            +L+KV LLDS D            G  LS+ D        E+   G L        E+  + Y +  + + GD       +++ AI+     V             TT +D   + +     + + YN +  F+  PE+ V      ++E +  L Y+E  N+          F+    + L++  N  SF LR+   + + S+  P    +   ++ +    SK K      +    C++N + E      ++    R++    K +S    H  V+SSGYG    T  +K S+  + +  P    KKS  +   P+ ++ +K    +   +RS +      +DI     DQ+   ++ +Q    F    Q       SP+K     +     ++  +E     R ++++L +  S +E+++  +I  +  +YE+++S L       QS+L R+ ++L  +  +  +    +V ++ +++I++EM+DQ +I+  Y+++NE+L++++K L+ Q+KK E+ +   EN+ L+S++++L+ +++   I+     QI +E++       T  I E +    E+  +++ E++ L Q     E +  +A K+ D+  +      S+  +E +I       ++E++K E+  LKR++ WY ENQ +LD++  +LK    EI +LK  +      A +   +    R +++  + ++++ LE +I             SL   +Y+    +   +++ K  T  FLE +IK LE++ +    +   S R+++QQF+ +K QYE+++ +LE  L  K  ++S      ++   +AN      ELE                      QLQN   LK   ++ + N    LQ        E+  L++QN+ L+    RS + N    L + Q +  N K +++ L QE+    + I+D+
Sbjct:  186 MLAKVVLLDSQDSTTEFQKAAETSGVALSEHDLPQEVGGTEMNEAGTLCGQTTSDTEALHHAYHHHIDQSLGDTDEQKIHSSSMAISQCLVQVTSQNHNLYSKNTSTTESDLPTVEEFMRPIKGDCYNAR-GFDLEPESPVKVIGSTVNEHVNHLPYKEHKNESVWETNLLEKFNREDSIFLQTAANEDSF-LRMPGKEIQTSEVQPDVLSKEIIQDCLLSQGSKTKQ-----VLQSCCLKNEKSESTTTKQMLYKNIRSTTPLHKKKSSYGPHGVVRSSGYGKS--TSYSKQSIPATERKIPKETLKKSIMKCRSPADKARSKEALFTTRTIRSAANQQASKEDISRAMPDQSVVQNLGHQVVDSF---RQHHSDLPVSPVKSCERELRLLRRAQVAEEDLSRARDVIQQLTSTVSEKEKEMETKIVELKTRYEKELSQLGQENYVLQSKL-RSVEELSKEKRWIHQTGTVSVPEEKLAQIQKEMEDQEVIIQGYQQENERLYKQMKDLQIQNKKNEEQM-YKENQCLMSELIALREKVERINIQ----SQIVRESEPARNQSFTELISELRAARKEE-TKLREEIRRLKQDKQALELDLGQAKKERDLAKVQITSTSSEKSYEFKI-------MEETYKQEILHLKRRLHWYAENQDLLDKDAARLKEAREEIEKLKQEVKKLRAEAGDHQCVQQKKRLRDRAADAKRIQDLERQIKEMEGILKRRYPNSLPALIYAAAAAEKTNDLSAKTNTTDFLERRIKKLETELEGKDDEAKTSLRAMEQQFQKIKMQYEQRLAELEQLLAYKWKSES-----PKLNGDKANC----IELE---------------------LQLQN---LKKTHQITVEN----LQ-------TEIENLKSQNSQLK---LRSKKDNKDLQLADWQMKQGNTKEKLLKLNQELITKNREIQDL 1062          
BLAST of Centrosomal protein of 162 kDa vs. UniProt/SwissProt
Match: sp|Q4KLH6|CE162_RAT (Centrosomal protein of 162 kDa OS=Rattus norvegicus OX=10116 GN=Cep162 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 2.493e-23
Identity = 140/570 (24.56%), Postives = 273/570 (47.89%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSVTP-------PNKTSVQNSS----KSQPVS--VRKK---SGQQHNKPSS--RSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESF---ENSPIKQFSGHVDH------NSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLN------RAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILK-QHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEI--ERTEMEK--------------------LKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDL---YS------LVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLE 2790
            KPQS  Y+  +SSGY S+  +P         KTS  N+     +  P S   RK+   SG +  KP++  + S   EG     S + P+                    P++  D+SF   +   +  + G+ +        +++ +EKW   + ++++++   S +E+++   +ES+ ++ E ++  L       Q++L+      R ++ LQ   + +D L     T++ + +I++E+++Q  +L  Y+++NE+L+ ++K L+ Q+KK E+ +   EN+ L S++ SLK ++                           +K+    Q VE  N     NQ +    +E + A K+ + ++ D  KRL Q K  LE+  ER + E+                    L+E+HK EV  L+++++WY ENQ +LD++  +L+  + E   LK     L   S S      +R+KE+ ++ ++++ LE ++  ++  L   Y       ++     G+  ++ T+ F+E +IK LE+D +   ++   S R+++QQF+ MK QYE+++ + E
Sbjct:  495 KPQSGLYASARSSGY-SKPSSPLQFFSALEKKTSKDNTKTKNVRPIPTSNQFRKREILSGTKLIKPAALNKPSPHREG-----SPATPKR-------------------PEDPSDDSFVQLQTETLGSYGGNREKELLMLKRAQDAEEKWRGAQALIEQIKMTFSEKEKELENTVESLKRQQERELFKLNQENYILQAKLSSFEETSRKQRWLQFG-ETSDPL-----TEEKLKQIQKEIQEQETLLQGYQQENERLYSQVKDLQEQNKKNEERM-FKENQNLFSELASLKEQM---------------------------HKNHFLPQAVE--NIEPTKNQSFTDLLAELRAAQKEKNHLMEDI-KRLKQDKQALEVDLERVKRERDQAKDQIAYTTGEKLYEIKILEETHKQEVSRLQKRLQWYAENQELLDKDAARLREANEETERLKLEIEKLKTESGSPANQQRLRSKERALDAKRIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDSVDRNTVDFMERRIKKLEADLEGKDEEAKKSLRTMEQQFQKMKIQYEQRLEEQE 1002          
BLAST of Centrosomal protein of 162 kDa vs. UniProt/SwissProt
Match: sp|E7F5E1|CE162_DANRE (Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 6.664e-17
Identity = 104/400 (26.00%), Postives = 204/400 (51.00%), Query Frame = 1
Query: 1792 LQSQLNRAKQQL-QMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQK--YIHSESERQKADKK---LDIMLLDAEKRLSQ----CKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHL---LGASNSIKISSNIR-AKEKLIETEKVKQLENEIMS----LK----TDLYSLVKGKNIGNVAEKR-----------TIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELE 2892
            LQS+L+RA++   + K  F +      VT++ +  IE+EMK+Q  ++  Y ++NEKL+ ++K L+   K  +    MEN+RL++++   +  +++      N+++  +E  ++       ++ F+   I E+ +++Q   +K   +  E  R K +K+   +D+ ++  E+ L++    CK     +  E++ L + H+ EV +LK++++WY +NQ +LD++  +L     EI +L      L A  S + +   R AKEK  E ++++ LE ++      LK      L +L+         E R           T   LE ++  LE++ +   +    S R+++QQ+  +K QYE++I DLE  L  K  + S P   + +  ++++ + L  ELE
Sbjct:  616 LQSKLHRAEEASNKRKWSFGEA--SDPVTEEKLKLIEKEMKEQETLIQGYHQENEKLYLQMKALQAQSKQNEEALFMENQRLLTELSFARDRMNTN-----NIQRTIRERSIV-------DQSFN---IAELTSQVQAAQKKEERLQEEVRRLKQEKQALHVDLEMMRKERDLAKVQAVCKS--GDKGFELKLLHDKHREEVTELKKRLQWYAKNQELLDKDAARLHAATAEIQKLTEQVEKLKAEVSRRANEQQRKAKEKAGEAKRIQDLERQLKQKEELLKRRHPNSLPALILAAASTGAEEDRLDVRSLAQSSQTAALLERRVHRLEAELEGRDEAAKRSLRAMEQQYHRIKLQYEQQISDLEQRLSEK--SHSYPAISSEL--IKSHTQTLKAELE 992          

HSP 2 Score: 57.7658 bits (138), Expect = 1.197e-6
Identity = 57/169 (33.73%), Postives = 90/169 (53.25%), Query Frame = 1
Query: 3307 HKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEF-NVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            H++ + ++   +A  HS S +A L SQ+  Q+  + HLQGQ+ E    K A   TK  E T  N ++  L  EL + +   S  P L+    L  KI  +E + + R +QL + +    +   ++ Q EVERWR +   + + L   + ELD +L+ L EL+RQG+VIP
Sbjct: 1185 HRKEIEHLLARHALEHSSSRVAELTSQLNTQEIIVQHLQGQVKELQGTKEALAVTKLREETLQN-QLSKLLEELKEAKEAHS--PELKHFTSLEQKIQSMEFRYSQREKQLQQVIADTRRVVEQEQQSEVERWRKLAQGRAKELEAFRMELDSILDVLRELQRQGVVIP 1350          
BLAST of Centrosomal protein of 162 kDa vs. TrEMBL
Match: A0A2C9KG80 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078168 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 5.066e-39
Identity = 246/932 (26.39%), Postives = 457/932 (49.03%), Query Frame = 1
Query: 1306 EKPQSKR--YSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTKSEGNVRSRSKS---VPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSRE---------WQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNLQSQ----------LNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRN---------MKQIAKEN--KLLNTTGILENKDFHFE-QIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNS---IKISSN-IRAKEKLIETEKVKQLENEIMSLKTDL---------YSLVKGKNIGNVA------EKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLE---------------------LDLVRKIDN-KSQPEKQTRITDLRANVEVLNKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVR-KVEMNNRTEMLQL---------ALKEKENEVHRLETQNNVLRNNEQRSSETN-YSPSLL------ELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNEEFIR---EECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            EK +S R  +SHV+SSGYG  +  P ++ S   S+   P  ++K S  Q  + ++R   +S  +   R  +   +  + + + Q  P H+   T    K+Q+ +  E    K  SG    N RE          + +  EE+ +   LQ +   +E++ ++Q++ +  KYE++I  L+ +          ++R ++ L+ K   N   +   V +   SR+ RE+++Q  +LA Y+ +N+KL++EIK L++  K  +     EN+RL +++ ++K EL+ K  EL+N          +QIA  N   ++  + +      H E ++ E K    NL+++   ++  R + ++ L+ +L + +    Q    L  +  ++++L+  HK E+  L +KIKWY ENQ +LD++  KL+ KD+EI +LK  L    S    K+  N IRAKEK  + +K++ LE ++  ++  +           ++   N  +V+      + R++Q LE++I+ LE + +   +      R+++Q++  +K Q+EE+I DLE                     L L R++DN K +  +Q  ++++++ V+ L  EL K        K   + L KN   Q++ E K + +  + E+ NR   +QL         +   K++ + ++ T+   +++N + S+ T  Y P +        L  EN   K++I  L  E++  R    D+R S  + E   R   E   +EI      H+  +  +  + A R S S +A LQSQ + Q+  I HLQ Q+ + N +L  +       ++  K+I +L+ +L + R + +  P +   + L  K+  L  ++  R  +LD  V+       ++ ++EV++WR +V  KNQ L   + ELD +LE L+ L++QGI +P
Sbjct:  476 EKVRSARDKFSHVQSSGYGRSASPPTSRKSRSLSAGKSPPKIQKSSVDQGTRDNTRKMDRSLTSYNLRLGTDNQMSLSSEGLSQLLPDHM---TSLKTKDQYLQLTERGATK--SG----NEREATLLEVLQDMRAQLQEEKTLRSNLQVELMTKEKEFQKQMDGLKVKYEDEIQALKQENFVLTAKLKEVDRERE-LKSKKVENSSGITAEVEESTESRLAREIQEQENLLAGYQAENKKLYEEIKNLQKQAKATEASMFKENQRLTAELSNVKQELELKNTELQNKGIITSMAVQQQIAAGNAEAMMGASRV-----AHLEGELAEAKRVQDNLSKELKMAQHNRYELERHLESLLTEKDGLAKQLAVSLTPD--QVKELESKHKEELDRLNKKIKWYAENQDLLDKSNVKLRQKDDEIHKLKMRLEGFKSEAGRKLEENKIRAKEKAADAKKIQDLERQVKEMEQVIRRRFPNSLPAMMMVAANAPDVSLDVGQTKGRSVQVLENRIRKLEKELEEKDELAQQDLRAMEQKYNQVKLQFEERIADLEHQLSYCQHSGEGFRDHPHSHALALERELDNVKDRCRRQ--VSEMQSEVDRLTAELNK-------AKKNQENLMKNDMRQIEGEYKQQLLSLQTELKNRDHDIQLLQHTVDKLRSRSGKKSNLVKVNTETTDVQSNFKVSASTREYKPGVFADTDMSSLIEENHLLKNKIDELQLELDQQRV---DLRKSLAETESVARVNQERLENEINALRSSHQIEIQKILSEQALRSSTSRVAELQSQCDTQEVMIRHLQSQLKKLNFELEELPQLKVRESQMLKQIEDLQHKLKEARTVQA--PEMRHFESLEEKLTDLVIRQKKREAELDSVVKHNQMIGRQELEEEVDKWRRMVEVKNQQLQVFRAELDSILEVLKTLQKQGITLP 1376          
BLAST of Centrosomal protein of 162 kDa vs. TrEMBL
Match: A0A2C9KGB2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078168 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 8.734e-39
Identity = 248/934 (26.55%), Postives = 457/934 (48.93%), Query Frame = 1
Query: 1306 EKPQSKR--YSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTKSEGNVRSRSKS---VPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSRE---------WQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNLQSQ----------LNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRN---------MKQIAKEN--KLLNTTGILENKDFHFE-QIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNS---IKISSN-IRAKEKLIETEKVKQLENEIMSLKTDL---------YSLVKGKNIGNVA------EKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLE---------------------LDLVRKIDN-KSQPEKQTRITDLRANVEVLNKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVR-KVEMNNRTEMLQL-----------ALKEKENEVHRLETQNNVLRNNEQRSSETN-YSPSLL------ELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNEEFIR---EECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            EK +S R  +SHV+SSGYG  +  P ++ S   S+   P  ++K S  Q  + ++R   +S  +   R  +   +  + + + Q  P H+   T    K+Q+ +  E    K  SG    N RE          + +  EE+ +   LQ +   +E++ ++Q++ +  KYE++I  L+ +          ++R ++ L+ K   N   +   V +   SR+ RE+++Q  +LA Y+ +N+KL++EIK L++  K  +     EN+RL +++ ++K EL+ K  EL+N          +QIA  N   ++  + +      H E ++ E K    NL+++   ++  R + ++ L+ +L + +    Q    L  +  ++++L+  HK E+  L +KIKWY ENQ +LD++  KL+ KD+EI +LK  L    S    K+  N IRAKEK  + +K++ LE ++  ++  +           ++   N  +V+      + R++Q LE++I+ LE + +   +      R+++Q++  +K Q+EE+I DLE                     L L R++DN K +  +Q  ++++++ V+ L  EL K        K   + L KN   Q++ E K + +  + E+ NR   +QL           +  +K N V ++ T+   +++N + S+ T  Y P +        L  EN   K++I  L  E++  R    D+R S  + E   R   E   +EI      H+  +  +  + A R S S +A LQSQ + Q+  I HLQ Q+ + N +L  +       ++  K+I +L+ +L + R + +  P +   + L  K+  L  ++  R  +LD  V+       ++ ++EV++WR +V  KNQ L   + ELD +LE L+ L++QGI +P
Sbjct:  476 EKVRSARDKFSHVQSSGYGRSASPPTSRKSRSLSAGKSPPKIQKSSVDQGTRDNTRKMDRSLTSYNLRLGTDNQMSLSSEGLSQLLPDHM---TSLKTKDQYLQLTERGATK--SG----NEREATLLEVLQDMRAQLQEEKTLRSNLQVELMTKEKEFQKQMDGLKVKYEDEIQALKQENFVLTAKLKEVDRERE-LKSKKVENSSGITAEVEESTESRLAREIQEQENLLAGYQAENKKLYEEIKNLQKQAKATEASMFKENQRLTAELSNVKQELELKNTELQNKGIITSMAVQQQIAAGNAEAMMGASRV-----AHLEGELAEAKRVQDNLSKELKMAQHNRYELERHLESLLTEKDGLAKQLAVSLTPD--QVKELESKHKEELDRLNKKIKWYAENQDLLDKSNVKLRQKDDEIHKLKMRLEGFKSEAGRKLEENKIRAKEKAADAKKIQDLERQVKEMEQVIRRRFPNSLPAMMMVAANAPDVSLDVGQTKGRSVQVLENRIRKLEKELEEKDELAQQDLRAMEQKYNQVKLQFEERIADLEHQLSYCQHSGEGFRDHPHSHALALERELDNVKDRCRRQ--VSEMQSEVDRLTAELNK-------AKKNQENLMKNDMRQIEGEYKQQLLSLQTELKNRDHDIQLLQHTVDKLRSRSAGKKSNLV-KVNTETTDVQSNFKVSASTREYKPGVFADTDMSSLIEENHLLKNKIDELQLELDQQRV---DLRKSLAETESVARVNQERLENEINALRSSHQIEIQKILSEQALRSSTSRVAELQSQCDTQEVMIRHLQSQLKKLNFELEELPQLKVRESQMLKQIEDLQHKLKEARTVQA--PEMRHFESLEEKLTDLVIRQKKREAELDSVVKHNQMIGRQELEEEVDKWRRMVEVKNQQLQVFRAELDSILEVLKTLQKQGITLP 1377          
BLAST of Centrosomal protein of 162 kDa vs. TrEMBL
Match: A0A1S3JCB0 (centrosomal protein of 162 kDa-like OS=Lingula unguis OX=7574 GN=LOC106171972 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 2.090e-38
Identity = 149/544 (27.39%), Postives = 282/544 (51.84%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDES----FENSPI---KQFSGHVDHNSRE---------WQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-QSQLNRAKQQLQMKPDFNDK---LLG---PNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRN----MKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKK-------LDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKH----LLGASNSIKISSNIRAKEKLIETEKVKQLENEIM------------SLKTDLYSLVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLE 2790
            KP++K Y+ + SSGYG ++ T P  TS + ++ S      K + +Q  K +   + K  G    +SK    +     +++  +IK Q    P    +++     E  PI   +Q    +    RE         WQE+W EERK+  K++AD+   ERD  R++E     YE+++  L Q       +  +  P+  DK   L G    NV+K+ +  +ERE+++Q  ++  Y+++NE+L++E+K ++   K  +     EN+RL ++IVSL+ +L+ +E+EL+N       +A++  +  + G          +I ++  EL+    K +  E E + A++        +++++ D E+   + K+  E++  E+  +++ H  E+  L RK+KWY ENQ +LD++   LK K++EI +LK     L   S + ++    RAKE+  E ++++ LE ++             SL + +++  + ++  +  +  ++QFLE ++K LE++ D   ++     R ++Q++ A+KFQYEE+I DLE
Sbjct:  474 KPKTK-YADIPSSGYGLRTPTKPKGTSSRKTAWSP-----KDTMKQKIKGTETITVKETG----KSKVADTHLLASVESFAQYIKEQFGDKPGRHREKTDAPWLEEEPIMSPQQREERISQIGREKALQQEVKDWQEQWKEERKMNVKMRADAGALERDYERKLEEYKLNYEQELFKLKQDNFVLMAKVSEAGPEERDKKKILEGDSLENVSKEQVQWMEREIREQEKLMLGYQQENERLYKEMKAMQITNKATEEKMFKENQRLTAEIVSLRTQLERREVELKNKGIITSSLAQQQIVAGSPG---TAILGAGRIAQLNAELRQAQDKILKLEQELKTAEQARTELENHIEVIVRDRERYEDKIKYAKEMKSQEIMSVQQEHAKEIERLNRKLKWYAENQEMLDRDSDALKEKNDEIRKLKKKIEDLESESGTRQLEQKARAKERSTEAKRIQDLERQVKEMEAIMRKRHPNSLPSLIWAASQVQDPKSPTKGPSVQFLEKQVKKLEAELDKKDEEAKKGLRVMEQKYNAIKFQYEERIHDLE 1004          
BLAST of Centrosomal protein of 162 kDa vs. TrEMBL
Match: A0A1S3HUA1 (centrosomal protein of 162 kDa OS=Lingula unguis OX=7574 GN=LOC106157877 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 2.584e-38
Identity = 149/544 (27.39%), Postives = 282/544 (51.84%), Query Frame = 1
Query: 1309 KPQSKRYSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDES----FENSPI---KQFSGHVDHNSRE---------WQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-QSQLNRAKQQLQMKPDFNDK---LLGP---NVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRN----MKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQN-------LNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKH----LLGASNSIKISSNIRAKEKLIETEKVKQLENEIM------------SLKTDLYSLVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLE 2790
            KP++K Y+ + SSGYG ++ T P  TS + ++ S      K + +Q  K +   + K  G    +SK    +     +++  +IK Q    P    +++     E  PI   +Q    +    RE         WQE+W EERK+  K++AD+   ERD  R++E     YE+++  L Q       +  +  P+  DK   L G    NV+K+ +  +ERE+++Q  ++  Y+++NE+L++E+K ++   K  +     EN+RL ++IVSL+ +L+ +E+EL+N       +A++  +  + G          +I ++  EL+        L Q+   +E  R + +  +++++ D E+   + K+  E++  E+  +++ H  E+  L RK+KWY ENQ +LD++   LK K++EI +LK     L   S + ++    RAKE+  E ++++ LE ++             SL + +++  + ++  +  +  ++QFLE ++K LE++ D   ++     R ++Q++ A+KFQYEE+I DLE
Sbjct:  474 KPKTK-YADIPSSGYGLRTPTKPKGTSSRKTAWSP-----KDTMKQKIKGTETITVKETG----KSKVADTHLLASVESFAQYIKEQFGDKPGRHREKTDAPWLEEEPIMSPQQREERISQIGREKALQQEVKDWQEQWKEERKMNVKMRADAGALERDYERKLEEYKLNYEQELFKLKQDNFVLMAKVSEAGPEERDKKKILEGDSLENVSKEQVQWMEREIREQEKLMLGYQQENERLYKEMKAMQITNKATEEKMFKENQRLTAEIVSLRTQLERREVELKNKGIITSSLAQQQIVAGSPG---TAILGAGRIAQLNAELRQAQDKILKLEQQLKTAEQARTELENHIEVIVRDRERYEDKIKYAKEMKSQEIMSVQQEHAKEIERLNRKLKWYAENQEMLDRDSDALKEKNDEIRKLKKKIEDLESESGTRQLEQKARAKERSTEAKRIQDLERQVKEMEAIMRKRHPNSLPSLIWAASQVQDPKSPTKGPSVQFLEKQVKKLEAELDKKDEEAKKGLRVMEQKYNAIKFQYEERIHDLE 1004          
BLAST of Centrosomal protein of 162 kDa vs. TrEMBL
Match: A0A2B4SZ27 (Centrosomal protein of 162 kDa OS=Stylophora pistillata OX=50429 GN=Cep162 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.074e-37
Identity = 196/791 (24.78%), Postives = 362/791 (45.76%), Query Frame = 1
Query: 1663 WQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNL-------QSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESE-----RQKADKKLDIMLLDAEK--RLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHL---LGASNSIKISSNI-RAKEKLIETEKVKQLENEIM------------SLKTDLYSLVKGKNIGNVAEKR-------TIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRK-IDNKSQPEKQTR------------------ITDLRANVEVLNKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRT--------EMLQLALKEKENEVHRL-ETQNNVLRNNEQ----------RSSETNYSPSLLELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNEEFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIP 3810
            WQ  W +E+K   KL AD + +E++  R  E    +YE +I  L       QS+LN  +++  ++            +++D+ R+E+E+++Q+ +L  Y+++NE+L++E+K ++  +K  +     EN++L S++  LK     +++E R   +   +     +  +  +K      I ++  E+++L ++    + E     R K D +  I  ++ E+   + Q    L     E+ +L+  H  EV  L+ K+KWY E Q++LD++   LK KD EI+ELK     L A +   ++    R  E+  + ++++ LE ++             SL   +Y+                     T  FLE ++K LE++ +   ++ +   R ++Q++ A++ +YEE++ DLE DL+R   DN+     +TR                  +  L+  +EVL   L K S                         K    +++E   R         + LQ  L++KE E+  L +T N + R  EQ          R +     P + +L  EN   K Q+ HL+ +++  R   +     + ++    REE   ++   +  HK  +  +K  +A  H  S+IA L+SQ+  Q+  I  L+ ++T+  V    I           K++  L+T+L   + +++  P +   D L AKI  LE+K + R   L   +EK       + ++   +WR +V +KN+ +   + ELD +LE L EL+RQG+VIP
Sbjct:  783 WQLAWKDEKKRNDKLIADMASREKEWSRTEERCRLEYESQIHELKQELFVMQSKLNETEKEANVRKRVAAGGKLEVASEEDMKRLEKEVREQDQLLTGYQQENERLYKELKQIQAKEKASEARMFSENQKLASELAILK-----EKVERRESGEPGSDFPAPGSATLGADK------ISQLTVEVRSLRRRVSEVQDEADELRRAKQDLETRIRGIEIERDAAVKQSSQVLGSNTREVAELESRHAAEVERLRTKLKWYAETQALLDRDAITLKKKDEEISELKETVVRLQAQHGQTVAEKKQRGVERSNDAKRIQDLERQVREMEEIIKRRYPNSLPALIYAAASAPGQAQAVTTESPRKHSPTYAFLESRVKKLEAELEDKDEEASKRIRCVEQKYNALRLEYEERVNDLEKDLLRANEDNEKSFRSKTRTKILEEELQRAREANDEKVKLLQTEIEVLQDALSKASAAEGA--------------------KGSRKKRLEFEKRATDDASLVNQPLQEKLEKKEAELEDLRQTCNRLQREREQMLATEGHLVDRYTSPKPDPLVDDLTLENKRLKEQVSHLSLDMDQQRVRYQASLAESERSTRLAREETTDQLASVQAQHKREIDQLKASFAAEHGSSKIAELKSQLAGQEFVIQRLKAKMTDTTVNTETIAAARVREESLQKQVTQLQTDLKRAKQMFT--PEMNHFDSLEAKIAALEQKHSQREVDLQRVIEKTHLTAKIEKEETEAKWRQVVRQKNREIEKFRLELDGILEVLSELKRQGVVIP 1540          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Cavefish
Match: cep162 (centrosomal protein 162 [Source:NCBI gene;Acc:103043369])

HSP 1 Score: 102.834 bits (255), Expect = 2.817e-21
Identity = 91/344 (26.45%), Postives = 173/344 (50.29%), Query Frame = 1
Query: 1870 VTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQK--YIHSESERQKADK---KLDIMLLDAEKRL--SQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNSIKIS----SNI---RAKEKLIETEKVKQLENEIMSLK--------TDLYSLV-----KGKNIGNVAEK-------RTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDL 2799
             T++ + +IEREMK Q  ++  Y ++NE L+ ++K L+   K  +     EN+RL+S++   K EL                 K+  T G     +  ++ + E+  ++Q L ++   +  E+ R K +K   +LD+ ++  E+ L  +Q  +    +  EM+ L+E HK EV  LK++++WY ENQ +LD++  +L+      AE + L      +K+     +N+   +AKE+ +E ++V  LE ++  ++          L +L+      G   G  + +       +T   LE +I  LE++ +   ++   S R+++QQF+ +K QYE++I +LE  L
Sbjct:  788 ATEEKLKQIEREMKQQETLIQGYHQENENLYMQMKTLQAQSKQNEEAMFTENQRLLSELAFTKEEL--------------HRIKMQKTVGSGSAANQGYQGVTELMAQVQALERREEKLQVETHRLKQEKQALQLDLQMMKQERDLAKAQVVYTSGDKGFEMKLLQERHKEEVSALKKRLQWYAENQELLDKDAARLRAAS---AETQRLTEQVEKLKMEVAKRANLQEKKAKERAVEAKRVLDLERQVKEMEEILRRRHPNSLPALIYAAAAAGDQEGGSSHQHAAPQPSQTAALLERRIHRLEAELEGRDEEAKRSLRAMEQQFQRIKLQYEQQISELEQQL 1114          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Cavefish
Match: cep162 (centrosomal protein 162 [Source:NCBI gene;Acc:103043369])

HSP 1 Score: 102.834 bits (255), Expect = 2.822e-21
Identity = 91/344 (26.45%), Postives = 173/344 (50.29%), Query Frame = 1
Query: 1870 VTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQK--YIHSESERQKADK---KLDIMLLDAEKRL--SQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNSIKIS----SNI---RAKEKLIETEKVKQLENEIMSLK--------TDLYSLV-----KGKNIGNVAEK-------RTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDL 2799
             T++ + +IEREMK Q  ++  Y ++NE L+ ++K L+   K  +     EN+RL+S++   K EL                 K+  T G     +  ++ + E+  ++Q L ++   +  E+ R K +K   +LD+ ++  E+ L  +Q  +    +  EM+ L+E HK EV  LK++++WY ENQ +LD++  +L+      AE + L      +K+     +N+   +AKE+ +E ++V  LE ++  ++          L +L+      G   G  + +       +T   LE +I  LE++ +   ++   S R+++QQF+ +K QYE++I +LE  L
Sbjct:  683 ATEEKLKQIEREMKQQETLIQGYHQENENLYMQMKTLQAQSKQNEEAMFTENQRLLSELAFTKEEL--------------HRIKMQKTVGSGSAANQGYQGVTELMAQVQALERREEKLQVETHRLKQEKQALQLDLQMMKQERDLAKAQVVYTSGDKGFEMKLLQERHKEEVSALKKRLQWYAENQELLDKDAARLRAAS---AETQRLTEQVEKLKMEVAKRANLQEKKAKERAVEAKRVLDLERQVKEMEEILRRRHPNSLPALIYAAAAAGDQEGGSSHQHAAPQPSQTAALLERRIHRLEAELEGRDEEAKRSLRAMEQQFQRIKLQYEQQISELEQQL 1009          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Cavefish
Match: cep162 (centrosomal protein 162 [Source:NCBI gene;Acc:103043369])

HSP 1 Score: 101.293 bits (251), Expect = 7.239e-21
Identity = 92/344 (26.74%), Postives = 172/344 (50.00%), Query Frame = 1
Query: 1870 VTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQK--YIHSESERQKADK---KLDIMLLDAEKRL--SQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNSIKIS----SNI---RAKEKLIETEKVKQLENEIM------------SLKTDLY-SLVKGKNIGNVAEK-------RTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDL 2799
             T++ + +IEREMK Q  ++  Y ++NE L+ ++K L+   K  +     EN+RL+S++   K EL                 K+  T G     +  ++ + E+  ++Q L ++   +  E+ R K +K   +LD+ ++  E+ L  +Q  +    +  EM+ L+E HK EV  LK++++WY ENQ +LD++  +L+      AE + L      +K+     +N+   +AKE+ +E ++V  LE ++             SL   +Y +   G   G  + +       +T   LE +I  LE++ +   ++   S R+++QQF+ +K QYE++I +LE  L
Sbjct:  724 ATEEKLKQIEREMKQQETLIQGYHQENENLYMQMKTLQAQSKQNEEAMFTENQRLLSELAFTKEEL--------------HRIKMQKTVGSGSAANQGYQGVTELMAQVQALERREEKLQVETHRLKQEKQALQLDLQMMKQERDLAKAQVVYTSGDKGFEMKLLQERHKEEVSALKKRLQWYAENQELLDKDAARLRAAS---AETQRLTEQVEKLKMEVAKRANLQEKKAKERAVEAKRVLDLERQVKEMEEILRRRHPNSLPALIYAAAAAGDQEGGSSHQHAAPQPSQTAALLERRIHRLEAELEGRDEEAKRSLRAMEQQFQRIKLQYEQQISELEQQL 1050          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006009.1 (pep scaffold:Pmarinus_7.0:GL477439:37274:46535:1 gene:ENSPMAG00000005441.1 transcript:ENSPMAT00000006009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 2.314e-17
Identity = 81/338 (23.96%), Postives = 161/338 (47.63%), Query Frame = 1
Query: 1867 NVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCK-----------HELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKH----LLGASNSIKISSNIRAKEKLIETEKVKQLENEIM------------SLKTDLYSL--VKGKNIG-NVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLE 2790
            N   + +  +E+E++ Q +I+  Y ++NE+L+++ K LK      +     EN+RL +++++LK EL  K+ ++ ++++     +  + TG LE       ++   + EL  L Q+        + A++ L++ L  A+K     K           HEL++       +++ H+ EV  L RK+ WY ENQ +LD++  +LK    +I  LK     L  A             E+  +  +++ LE ++             SL   +Y+   V  + +G + A   + + LE +++ LE++ +   ++     R ++Q +  MK QYE++I+ LE
Sbjct:   64 NSVDEKLHHLEKELRQQEVIIQGYHQENERLYKQAKDLKTRNWESEQQMVHENQRLSAELLNLKEELAQKKEQISHLREAVAPTRNRSVTGDLEG------ELSSAQRELDKLRQEV----RSMKLANQSLEVELNKAKKECENAKTQATYLSGDKEHELKV-------VEQQHRQEVERLARKVAWYAENQDMLDRDAARLKAATAQIEALKQQVEELQAAIRDRGEQRRRSTGERAADARRIQDLERQVREMEDILRRRHPNSLPALMYAAASVGDRALGSDAAPGGSAELLERRLRKLEAELEAKDEEAKRGLRVMEQHYNKMKLQYEQRIKGLE 384          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Nematostella
Match: EDO46717 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD5])

HSP 1 Score: 107.457 bits (267), Expect = 3.318e-23
Identity = 103/430 (23.95%), Postives = 207/430 (48.14%), Query Frame = 1
Query: 1663 WQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNLQSQL----NRAKQQLQMKPDFNDKLLGP---NVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERL----------------ISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGI--LENKDFHF-EQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELK----HLLGASNSIKISSNIRAKEKLIETEKVKQLENEIM------------SLKTDLYSLVKGKN--------IGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLV 2802
            WQ+ W +ER+   KL +D +++ERD  R  E + Q YE+++S+L+ ++     R +++ Q   +      G    +V++++  R+ERE+++Q  +L  Y+++NE+L++++K  +   K  +     EN++L                 +++ +LK  LD +     +   +   + LL +  I  L+++     E+  +++ E+  L       E+  + AD++ D  +  AE+ L     E        E LK  ++ E+  L RK+KWY ENQ +LD +   LK KD E+ EL+     L     S       R+ E+  + ++++ L+ ++             SL   +++                 V +  +  FLE+++K LE + +    + N   R+++Q++ AM+F Y+E+++ LE +L 
Sbjct:  732 WQQAWKDERRRNDKLISDIAVRERDWSRAEERMRQDYEQQLSDLKQEVFSLTARLREEEQNADNRKRVAAGGKLKSVSEEEQKRLEREIREQEELLKGYQQENERLYRDLKQQQASSKATEGRMFSENQKLGTSMTQVRIPPHNCPTATEVANLKERLDQRTTAPPSRVPVPG-SALLGSDRITQLQSQLSSIKERETKLRAEVDELRLVNTRLETRVRAADRERDTAVQRAEQALGATSQE-------REDLKLRYEDEIDRLNRKLKWYAENQQLLDHDAAALKEKDKELKELRETVSRLRAQQGSAATERRQRSAERSSDAKRIQDLQRQVKEMEEIIKRRYPNSLPALIFAAASAPGSAQPSMPETSPVKQSPSYVFLENRVKKLEKELEENDDEANKRIRAIEQKYNAMRFDYDERVKSLEQELA 1153          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Nematostella
Match: EDO46716 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD4])

HSP 1 Score: 51.9878 bits (123), Expect = 4.126e-7
Identity = 58/195 (29.74%), Postives = 104/195 (53.33%), Query Frame = 1
Query: 3268 EECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTEL----ADLRLIWSK-KPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVE------RWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIPKLS 3819
            ++   ++ K +  H++ +  ++ ++A RHS+S +A LQS+       ++ L+  I +   KLA     S+ L  A     NLK ++     DLR    +  P +   D L++KI  +E     R  Q +E + +++  N+ Q +  +E      RWR IV +KNQ +   + ELD +LEAL+EL+RQG+++P ++
Sbjct:    7 DDAADQLEKVKSKHQQELAQIRAEFAVRHSNSRVAELQSK-------MASLEIVIQKLRDKLAAKSGSSDALAAAKAREENLKQQIERLNEDLRKAKEEFTPEMRHFDALQSKIAAME----LRFTQREEDLNRII--NTAQIKSGMEKEESDSRWRQIVNRKNQEIERFREELDMILEALKELKRQGVILPNMT 188          
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Medaka
Match: cep162 (centrosomal protein 162 [Source:NCBI gene;Acc:101171773])

HSP 1 Score: 85.8853 bits (211), Expect = 2.705e-16
Identity = 175/745 (23.49%), Postives = 328/745 (44.03%), Query Frame = 1
Query: 1696 VKKLQADSSIQERDV---RRQIESITQKYEEKISNLQSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKG--EDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMS-----LKTDLYSLVKGKNIGNVAEKRTI------QFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVE--MNNRTEMLQLALKEKENEVHRL--------ETQNNVLRNNEQRSSET----------NYSP---------SLLELQAEN-----ANCKSQIIHLTQEINNYRQAIEDIRM------SALK------NEEFIR--EECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFN-VKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNL 3735
            VK+L+A  +++E ++   R++ E +T    +K   LQS+L  AK   Q K  + D+   P    D I + E++ K+Q +++  ++++NEKL+ ++K L+   K   E M ++  N+RL +Q+   + +L      + ++        LL   G L+  +       ++  +L  L Q+ +  E         +D+ L+  E+ +++     +I  T+ ++  E    EV  L+++++ + ENQ   ++   +LK    EI +LK                        E+VKQLE  + S     +   +++ V   +       R          LE +++ LE++ +  +++   S  +LQQQF  +K + E++I +LE  L +K   KS      R+ D RA  E LN+  E        L  EI+ L +    + Q     +H R+ E     R E L   L  K   +  L          + N+L   E RS+ET          + +P         + L  Q+E      A   S I  + QE  + +Q IE +++      +ALK       EE +R  E  R ++   +  H   + +++  +A  HS S++  L +++   +  + HLQ ++ E    K A   ++S E      ++  L  EL   +   ++ PG +++  L  KI Q+E +   R  +L ++  +     S   + E +RW+++V+ KN+ L
Sbjct:  172 VKELRAQLALKEEELQRMRKEAEELT-SVRQKNYVLQSKLQSAKNASQ-KKSWKDEGANP---ADKIQQAEKDFKEQEMLIKGFQQENEKLYFQLKTLQATSKANEEAMFEA--NQRLQNQLALTRDQLKKTSWPVGSVLPGTSSGDLLAQIGALQKSE------AKLSEDLHRLKQEKLALE---------VDLQLMKKERDVAKA----QIVSTKEDEPNE----EVVALRKRLQSFAENQRTWERTADRLKTASTEIDQLK------------------------ERVKQLEQTLRSKNPKFVPAAIHARVSSAHHQPADSTRKSMSSCVNALLERRVQHLEAELEGQNEEAKQSLCALQQQFHLIKGRLEQQISELEQQLEQKPQEKS---GDPRMADCRALEEELNRVKESHQEKEKSLLQEIETLQQQLKTKAQP-GPGRHQRQAEAAFGFRIERLNQELAAKTRSIQELNRTVKKLQRERRNMLSVPESRSTETKQQCSCHQTHHSAPAEDHSAEVEAFLPAQSEKTYQPAAFTGSHINEVLQENKDLKQCIELLQLHSEHEKAALKADAVQAKEELVRLEEHFREQLASMKTEHLRELDHMRASHALEHSSSKVTELTNKLSTHQTDMKHLQARLKELQETKEALALSRSRE-DALQMQVARLLQELKKAK--EAEGPGAKLLSNLEKKILQVELRHQLREEELQQFT-RGAGQTSADLRTEDKRWKSLVLNKNKEL 854          
BLAST of Centrosomal protein of 162 kDa vs. Planmine SMEST
Match: SMESG000027479.1 (SMESG000027479.1)

HSP 1 Score: 2422.89 bits (6278), Expect = 0.000e+0
Identity = 1241/1259 (98.57%), Postives = 1241/1259 (98.57%), Query Frame = 1
Query:   79 MFTKKYLKEDYDKNFEEFISSDFSKKSFNDYLYSDIAHKKKKASSQNFWNDDDENTSSSIQLGTGNKFLKSSKPSQAPKNTKHSNVNIPNTVVKETEDEPGSFELRLNLNESTDKSLDKSSFLINEDPIKNGPHAHPMTFEGITDTIFDRSYSPTLEGDSNNNINKPYVGSETIKSNILTIPIDKSRENFIQSLDRTDKEHLLSKVSLLDSYDGHKLSKPDELESTGFLENDNQKLDESNEYMYKNSFNPASGDNFNTTQAITNVTDTVIGDTTAADFAALHKQFEKYNNKESFEFNPETNVPLSETIKDLYEEKSNQFDDFSKLNLESTINSKSFGLRIIHPDHEESKSSPVPTPRPRTKNKVSKSDSKEKYENIAIITLIRCIQNTEMEIIKDDSVISNGERNSETNEKPQSKRYSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNLQSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDLYSLVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELEKKSXXXXXXXXXXXXXXXXXXXQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQRSSETNYSPSLLELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNEEFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQXXXXXXXXXXXXXXXQGIVIPKLSLRSNPINNQKFL 3855
            MFTKKYLKEDYDKNFEEFISSDFSKKSFNDYLYSDIAHKKKKASSQNFWNDDDENTSSSIQLGTGNKFLKSSKPSQAPKNTKHSNVNIPNTVVKETEDEPGSFELRLNLNESTDKSLDKSSFLINEDPIKNGPHAHPMTFEGITDTIFDRSYSPTLEGDSNNNINKPYVGSETIKSNILTIPIDKSRENFIQSLDRTDKEHLLSKVSLLDSYDGHKLSKPDELESTGFLENDNQKLDESNEYMYKNSFNPASGDNFNTTQAITNVTDTVIGDTTAADFAALHKQFEKYNNKESFEFNPETNVPLSETIKDLYEEKSNQFDDFSKLNLESTINSKSFGLRIIHPDHEESKSSPVPTPRPRTKNKVSKSD                  NTEMEIIKDDSVISNGERNSETNEKPQSKRYSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNLQSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDLYSLVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELEKKSTTINKLKLEIKKLNKNTNEQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQRSSETNYSPSLLELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNEEFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQRELDHLLEALEELRRQGIVIPKLSLRSNPINNQKFL
Sbjct:    1 MFTKKYLKEDYDKNFEEFISSDFSKKSFNDYLYSDIAHKKKKASSQNFWNDDDENTSSSIQLGTGNKFLKSSKPSQAPKNTKHSNVNIPNTVVKETEDEPGSFELRLNLNESTDKSLDKSSFLINEDPIKNGPHAHPMTFEGITDTIFDRSYSPTLEGDSNNNINKPYVGSETIKSNILTIPIDKSRENFIQSLDRTDKEHLLSKVSLLDSYDGHKLSKPDELESTGFLENDNQKLDESNEYMYKNSFNPASGDNFNTTQAITNVTDTVIGDTTAADFAALHKQFEKYNNKESFEFNPETNVPLSETIKDLYEEKSNQFDDFSKLNLESTINSKSFGLRIIHPDHEESKSSPVPTPRPRTKNKVSKSD------------------NTEMEIIKDDSVISNGERNSETNEKPQSKRYSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVRKKSGQQHNKPSSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYFIPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQERDVRRQIESITQKYEEKISNLQSQLNRAKQQLQMKPDFNDKLLGPNVTKDDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENERLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIVEMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERTEMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHLLGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDLYSLVKGKNIGNVAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKIRDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELEKKSTTINKLKLEIKKLNKNTNEQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQNNVLRNNEQRSSETNYSPSLLELQAENANCKSQIIHLTQEINNYRQAIEDIRMSALKNEEFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANLQSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELADLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQYQDEVERWRAIVVKKNQNLIHVQRELDHLLEALEELRRQGIVIPKLSLRSNPINNQKFL 1241          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CEP1622.363e-2724.06centrosomal protein 162 [Source:HGNC Symbol;Acc:HG... [more]
CEP1623.719e-2724.31centrosomal protein 162 [Source:HGNC Symbol;Acc:HG... [more]
CEP1623.719e-2724.31centrosomal protein 162 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AL954130.12.082e-1826.25pep chromosome:GRCz11:CHR_ALT_CTG16_1_19:37885620:... [more]
cep1628.828e-1826.00Danio rerio centrosomal protein 162 (cep162), mRNA... [more]
cep1628.828e-1826.00Danio rerio centrosomal protein 162 (cep162), mRNA... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000008848.11.229e-1526.51centrosomal protein 162kDa [Source:NCBI gene;Acc:1... [more]
ENSXETT00000003393.13.367e-824.60pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
rnf384.223e-641.54ring finger protein 38 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cep1626.775e-2725.09centrosomal protein 162 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5TB80|CE162_HUMAN1.135e-2624.06Centrosomal protein of 162 kDa OS=Homo sapiens OX=... [more]
sp|Q6ZQ06|CE162_MOUSE4.739e-2625.09Centrosomal protein of 162 kDa OS=Mus musculus OX=... [more]
sp|Q91365|CE162_COTCO3.965e-2422.95Centrosomal protein of 162 kDa (Fragment) OS=Cotur... [more]
sp|Q4KLH6|CE162_RAT2.493e-2324.56Centrosomal protein of 162 kDa OS=Rattus norvegicu... [more]
sp|E7F5E1|CE162_DANRE6.664e-1726.00Centrosomal protein of 162 kDa OS=Danio rerio OX=7... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KG805.066e-3926.39Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KGB28.734e-3926.55Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3JCB02.090e-3827.39centrosomal protein of 162 kDa-like OS=Lingula ung... [more]
A0A1S3HUA12.584e-3827.39centrosomal protein of 162 kDa OS=Lingula unguis O... [more]
A0A2B4SZ273.074e-3724.78Centrosomal protein of 162 kDa OS=Stylophora pisti... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep1622.817e-2126.45centrosomal protein 162 [Source:NCBI gene;Acc:1030... [more]
cep1622.822e-2126.45centrosomal protein 162 [Source:NCBI gene;Acc:1030... [more]
cep1627.239e-2126.74centrosomal protein 162 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006009.12.314e-1723.96pep scaffold:Pmarinus_7.0:GL477439:37274:46535:1 g... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO467173.318e-2323.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467164.126e-729.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep1622.705e-1623.49centrosomal protein 162 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Centrosomal protein of 162 kDa vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000027479.10.000e+098.57SMESG000027479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003857 ID=SMED30003857|Name=Centrosomal protein of 162 kDa|organism=Schmidtea mediterranea sexual|type=transcript|length=5464bp
GTATTTTCATAAAATAGTTACAAAATGCAAATTAATTTAATTTAATTTTT
CAAAGCAGAATTTACATTTTTAGAAATTATGTTTACAAAGAAATATCTAA
AAGAAGACTATGATAAAAATTTTGAAGAATTTATTTCTTCAGATTTTAGT
AAAAAATCATTTAATGATTACCTATACTCAGACATTGCTCACAAAAAGAA
AAAAGCCAGCTCACAAAACTTTTGGAATGATGATGATGAAAATACTTCAA
GCAGTATTCAACTTGGAACTGGTAACAAATTTTTAAAAAGTTCAAAACCT
TCTCAAGCTCCAAAAAATACCAAACATTCAAATGTGAATATTCCAAACAC
TGTCGTCAAAGAAACCGAAGATGAACCGGGAAGTTTTGAATTGCGCCTCA
ATTTAAACGAGTCAACAGACAAGTCTCTAGATAAGAGCTCATTTTTGATC
AATGAAGATCCAATAAAAAATGGTCCGCATGCTCATCCAATGACCTTTGA
AGGAATAACGGACACAATATTTGATCGTTCATATAGTCCTACTTTAGAAG
GTGATTCAAATAATAATATAAACAAACCATATGTCGGATCTGAAACGATT
AAATCAAATATTTTGACTATTCCAATTGATAAATCTCGTGAGAATTTCAT
CCAATCCTTAGATCGTACAGATAAGGAGCATCTTTTATCAAAAGTCAGTT
TATTAGACAGTTACGATGGGCACAAATTATCCAAACCGGATGAGCTGGAG
TCAACAGGTTTCTTGGAAAATGACAATCAAAAGCTCGATGAGTCCAATGA
ATATATGTATAAAAATTCGTTTAATCCAGCATCAGGAGACAATTTCAATA
CTACCCAGGCAATAACAAATGTTACTGATACGGTCATTGGTGATACGACA
GCTGCTGATTTTGCTGCTCTTCATAAACAGTTTGAGAAATATAACAATAA
AGAATCATTCGAGTTCAATCCAGAAACTAATGTTCCACTATCAGAAACTA
TTAAAGATCTTTACGAAGAAAAGTCAAATCAATTTGATGACTTTTCCAAA
TTGAATTTGGAATCGACAATTAATTCGAAAAGTTTTGGATTAAGGATCAT
TCATCCTGATCATGAAGAATCAAAATCTAGTCCTGTACCAACTCCTCGTC
CAAGAACGAAGAATAAAGTTTCTAAATCCGATAGCAAAGAAAAATATGAG
AATATCGCAATAATTACATTAATTCGTTGTATTCAGAACACTGAAATGGA
AATAATAAAAGATGATTCCGTGATTTCTAATGGTGAGCGAAATAGTGAAA
CAAATGAAAAACCGCAATCTAAACGGTATTCACATGTGAAAAGCAGTGGT
TATGGTAGCCAGTCAGTAACACCTCCTAATAAAACCTCAGTTCAAAATTC
TTCAAAGTCCCAACCGGTCTCAGTAAGAAAGAAATCTGGTCAACAACATA
ATAAACCAAGTTCTCGAAGCTCTACGAAATCTGAAGGAAATGTAAGATCC
AGATCTAAATCAGTTCCAAGAAATGATGATATAATCGATCAAAACTATCC
AACTCATATAAAAAATCAAACTTATTTTATTCCTAAAAATCAGTTTGACG
AGAGTTTTGAGAATTCCCCTATCAAACAATTCTCTGGACATGTGGATCAC
AATAGTAGAGAATGGCAAGAAAAGTGGCTTGAAGAAAGAAAAATTGTGAA
AAAATTGCAAGCTGATTCATCTATTCAAGAAAGAGATGTCAGGCGTCAAA
TTGAAAGTATTACTCAGAAATATGAAGAAAAAATTTCAAATTTACAATCC
CAATTAAATCGAGCCAAACAACAGCTGCAAATGAAACCGGATTTCAATGA
CAAACTTCTGGGGCCAAATGTGACAAAGGATGACATTAGTCGAATTGAAC
GGGAAATGAAAGATCAAAATTTAATTCTTGCAGCCTATGAAAAAGATAAT
GAAAAATTACACCAGGAGATAAAAATCTTGAAACAGCATAAAAAAGGAGA
AGACATGATTGATTCCATGGAAAATGAAAGACTTATTTCTCAAATCGTAT
CATTGAAAGCAGAATTAGATTCAAAAGAAATTGAACTGAGAAATATGAAA
CAAATCGCAAAGGAAAACAAATTGCTAAATACCACTGGTATTTTGGAAAA
TAAAGATTTTCATTTCGAACAAATCGTTGAAATGAAGAACGAATTACAAA
ATCTAAACCAAAAATATATCCATTCGGAATCCGAAAGACAAAAAGCTGAT
AAAAAGTTGGATATAATGTTATTGGACGCGGAAAAGCGTCTTTCTCAGTG
TAAACATGAGTTGGAGATCGAAAGAACAGAGATGGAAAAGTTAAAGGAAT
CACATAAGATAGAAGTCGGTGATTTGAAGAGAAAAATCAAATGGTATCTC
GAAAACCAGTCGATTCTTGATCAAAATGAGAAAAAACTGAAAATAAAAGA
CAATGAAATAGCAGAATTGAAGCACTTACTCGGAGCGTCTAATTCGATAA
AAATTAGTTCCAATATTCGAGCGAAAGAGAAGCTTATTGAAACAGAGAAA
GTTAAGCAATTGGAAAACGAAATAATGTCCCTGAAAACAGATTTGTACAG
TTTGGTTAAAGGTAAAAATATTGGCAATGTAGCTGAAAAGAGAACTATTC
AATTCCTCGAAGACAAAATCAAATCTTTGGAGTCAGATTGCGATGTGGCT
AGTAAAAAGGAAAATAATTCTTTTCGATCTCTTCAGCAACAGTTTGAAGC
CATGAAATTTCAGTATGAAGAAAAGATTCGTGATTTGGAGTTGGATTTAG
TGAGAAAAATCGACAACAAGTCTCAACCAGAAAAACAAACGAGAATAACA
GATCTTCGAGCAAATGTTGAGGTTTTGAACAAGGAATTGGAAAAGAAATC
AACCACAATCAACAAATTGAAACTCGAAATAAAAAAATTAAATAAAAATA
CCAACGAGCAATTGCAGAATGAAAACAAACTGAAACATGTCCGGAAAGTC
GAAATGAATAATAGAACAGAAATGTTGCAACTAGCGTTGAAAGAAAAAGA
AAATGAAGTCCATCGATTAGAAACGCAAAATAATGTTCTAAGAAACAACG
AACAGCGATCCAGTGAAACAAATTATTCTCCTAGCCTTCTTGAATTGCAA
GCGGAAAATGCAAATTGTAAGAGTCAGATTATTCATTTAACACAGGAAAT
CAATAATTACAGACAAGCGATTGAAGACATCAGAATGTCGGCTTTGAAAA
ATGAAGAATTTATTCGAGAGGAATGCAGAAGTGAAATTCGAAAATGTGAA
GAATTTCACAAGGAAAATATGCACAATGTTAAAATGGATTACGCAAATCG
TCACTCAGATTCGGAAATTGCCAATTTACAATCACAAATTGAAGTTCAGA
AAAACTACATTAGCCATTTACAAGGTCAAATAACGGAATTTAATGTGAAA
TTAGCTAATATTGACACCAAGTCGAATGAGCTGACCGAAGCCAATAAAGA
AATTCATAATTTGAAAACAGAATTGGCAGATCTCCGGCTGATATGGTCGA
AAAAGCCGGGCTTGGAAATGATTGACCGATTACGTGCAAAAATCGGTCAA
TTGGAAGAGAAAGAAAACTTCCGCGGTAGGCAATTGGATGAATATGTAGA
AAAAGTTGTTAAAAATAATAGCAAACAATATCAAGATGAAGTTGAAAGAT
GGCGAGCAATCGTAGTAAAAAAAAATCAAAATTTAATTCATGTTCAACGT
GAACTTGATCATTTACTTGAGGCACTAGAAGAACTTCGGCGTCAAGGCAT
TGTCATTCCTAAACTGTCATTGAGGTCGAATCCGATAAATAACCAGAAGT
TTCTTTGATAATATATTTATATAAAATATAAAAGAAATTAATAAATTTTC
AATTTCTTTTATTTTCATTTATTTTTAGTCTAGAAATCAATATTTTGTTT
TGTAGGAATTTTCGGTAAAGTGTCAAAATAAATAAAATAGTTGTTTAAAA
ATGAAAGCGAAAAAAGGATTTTTTTATGTAATTAATATTTAGTCGACAAA
AAAATATTAAAAAATAAAAAGAATTTAATGATAAACCAGCTCATCGTATT
TGGTATTTTTGATAAATATTATTGCCTTGCGATAATCGCTAGAGTTTGGA
AGCCTACTCGATGCAATCGGGGGTCGCAAGGGGTGCACCGTAGCTGACTG
TCTAATTGTTAGCAATGTAGAGCAGTTAATAAATAATATATATATATATA
TATAGCATTCTTAGAAAATTAAATAAATTTCCGTATATTTTACTACCCAA
TTTCAATTTGAATAAATATCAACGATTGAATAAATAGTTAATGCGACTTA
TTTATGGAGTAAAACAGATAAAATCTATCTAATTGATATTATTCTAATAG
ACTATGAAAATGCAACGTAAACCAAACGATAATGTTAATATTTACAGTTG
TATGAGGGTTCCAGAGTGACATTTCAGTGTGAATAATAATTGTGAGTAGA
TTGCAGATCGATAAAAATATTCATTGAATTATATTGGCTATGAATTTTGC
AATTAAACAGCTGTAAACCAATGAGAATCTCGCATTATTTCAACCTTTAT
ATATATGATTTCTGGTTCAGAATGAACCTAAATCATTTAAGCGTGTCCGA
TATGGTTGGGTGATTTCTGTCTTTGCAATTTGTTTCAATTCGCTAATTGT
GCTCTCATGCCACTAATAAAGTGAAATTTCAGTGTATTATTAGTGTTAGT
TATGGCACAGAAAAATTAATTTTCACAATGCTATATATTTTATTTATAAC
TTGCCTGTATATGACGGGCTTATATTGGTTTTCTACATAGCATTTTAATT
CAATTCTATCCTATTACAAACATTTCAATTGATTGTATTCACTGACGTTA
TATTTATATTTATTAAAAAATATAACTCCTACTAGTTAAAATGTATAAAT
AGCGTGATATATAAAGAATATATGCTATTTAATTATATGATCACTTTCAA
TAAAAATATAAACAAAATGCTAAAAGTCAAGACAAAAAGTCAATAAGCAA
ATGTTTTTAAACTTGTATGAGTAAAATGCGGTTTCAAAAAAAAATTAATT
AATTATCCGTTTTTTCAAAATTATAAAATGCGAGTCCTTCCGCTAGATAA
TCGGTGAAATGTGCTTAAGCTTGCCTTAGCTTGAAGGTCCTGATTTGCGA
ATGATGCAGCAAATTAGTTGTAACCAATGATAGTATATTATATAGTTAGA
GGTTATTGCATTAATAATATTTTGTTTTCACACTTGTAATTTTTAATTAA
ATATGCGAAATTTCTTGAGTCAATTTTTTTTATCAAACCACCTTTGGAAT
AATTTTTTTCACAGAAAATATTTATGATACGATAAATCCTGAGATGCATA
TTGTGAATAAAATTTTAATTATCTTTATAAATTTCTGAGTTCCGTTTTCT
CTTGTTTTGCTTTG
back to top

protein sequence of SMED30003857-orf-1

>SMED30003857-orf-1 ID=SMED30003857-orf-1|Name=SMED30003857-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1260bp
MFTKKYLKEDYDKNFEEFISSDFSKKSFNDYLYSDIAHKKKKASSQNFWN
DDDENTSSSIQLGTGNKFLKSSKPSQAPKNTKHSNVNIPNTVVKETEDEP
GSFELRLNLNESTDKSLDKSSFLINEDPIKNGPHAHPMTFEGITDTIFDR
SYSPTLEGDSNNNINKPYVGSETIKSNILTIPIDKSRENFIQSLDRTDKE
HLLSKVSLLDSYDGHKLSKPDELESTGFLENDNQKLDESNEYMYKNSFNP
ASGDNFNTTQAITNVTDTVIGDTTAADFAALHKQFEKYNNKESFEFNPET
NVPLSETIKDLYEEKSNQFDDFSKLNLESTINSKSFGLRIIHPDHEESKS
SPVPTPRPRTKNKVSKSDSKEKYENIAIITLIRCIQNTEMEIIKDDSVIS
NGERNSETNEKPQSKRYSHVKSSGYGSQSVTPPNKTSVQNSSKSQPVSVR
KKSGQQHNKPSSRSSTKSEGNVRSRSKSVPRNDDIIDQNYPTHIKNQTYF
IPKNQFDESFENSPIKQFSGHVDHNSREWQEKWLEERKIVKKLQADSSIQ
ERDVRRQIESITQKYEEKISNLQSQLNRAKQQLQMKPDFNDKLLGPNVTK
DDISRIEREMKDQNLILAAYEKDNEKLHQEIKILKQHKKGEDMIDSMENE
RLISQIVSLKAELDSKEIELRNMKQIAKENKLLNTTGILENKDFHFEQIV
EMKNELQNLNQKYIHSESERQKADKKLDIMLLDAEKRLSQCKHELEIERT
EMEKLKESHKIEVGDLKRKIKWYLENQSILDQNEKKLKIKDNEIAELKHL
LGASNSIKISSNIRAKEKLIETEKVKQLENEIMSLKTDLYSLVKGKNIGN
VAEKRTIQFLEDKIKSLESDCDVASKKENNSFRSLQQQFEAMKFQYEEKI
RDLELDLVRKIDNKSQPEKQTRITDLRANVEVLNKELEKKSTTINKLKLE
IKKLNKNTNEQLQNENKLKHVRKVEMNNRTEMLQLALKEKENEVHRLETQ
NNVLRNNEQRSSETNYSPSLLELQAENANCKSQIIHLTQEINNYRQAIED
IRMSALKNEEFIREECRSEIRKCEEFHKENMHNVKMDYANRHSDSEIANL
QSQIEVQKNYISHLQGQITEFNVKLANIDTKSNELTEANKEIHNLKTELA
DLRLIWSKKPGLEMIDRLRAKIGQLEEKENFRGRQLDEYVEKVVKNNSKQ
YQDEVERWRAIVVKKNQNLIHVQRELDHLLEALEELRRQGIVIPKLSLRS
NPINNQKFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038774CEP162-like
IPR017899VPS28_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005819spindle
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005879axonemal microtubule
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
GO:0097711ciliary basal body docking
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 603..637
NoneNo IPR availableCOILSCoilCoilcoord: 973..1007
NoneNo IPR availableCOILSCoilCoilcoord: 731..762
NoneNo IPR availableCOILSCoilCoilcoord: 818..838
NoneNo IPR availableCOILSCoilCoilcoord: 692..726
NoneNo IPR availableCOILSCoilCoilcoord: 555..582
NoneNo IPR availableCOILSCoilCoilcoord: 850..877
NoneNo IPR availableCOILSCoilCoilcoord: 780..800
NoneNo IPR availableCOILSCoilCoilcoord: 1020..1047
NoneNo IPR availableCOILSCoilCoilcoord: 1128..1155
NoneNo IPR availableCOILSCoilCoilcoord: 923..964
NoneNo IPR availableCOILSCoilCoilcoord: 649..676
NoneNo IPR availableCOILSCoilCoilcoord: 1219..1239
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 418..473
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 43..65
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 49..65
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 401..491
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 338..370
IPR038774Centrosomal protein CEP162-likePANTHERPTHR34031FAMILY NOT NAMEDcoord: 37..1245