glutathione hydrolase 1 proenzyme isoform X2

Overview
Nameglutathione hydrolase 1 proenzyme isoform X2
Smed IDSMED30003824
Length (bp)2030
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of glutathione hydrolase 1 proenzyme isoform X2 (SMED30003824) t-SNE clustered cells

Violin plots show distribution of expression levels for glutathione hydrolase 1 proenzyme isoform X2 (SMED30003824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of glutathione hydrolase 1 proenzyme isoform X2 (SMED30003824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for glutathione hydrolase 1 proenzyme isoform X2 (SMED30003824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003824

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003824SMESG000047024.1 Contig1475newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003824SMESG000047024.1 Contig1475uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003824SMESG000068175.1 Contig1475newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003824SMESG000068175.1 Contig1475uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
reproductive organSMED30003824SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003824SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 375.941 bits (964), Expect = 7.947e-122
Identity = 207/541 (38.26%), Postives = 319/541 (58.96%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPK--RVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DAKQC+ +    +   GG+A+D AIA LLC   +N HS GI GG  L  Y    +K    + RE+AP+LA   MF + + S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A++      N     E + +L        K  R G+ +  P+LA T   L++E   A  NGSL   ++ ++ + G I+  +DL  Y+ +  E P+++ LG D  LY    P SG ++A  LN+L  Y F   S +S E   L YHR++E  +F++AKR+ LGD  F++ T  E++RN+TSE ++ ++ + I+ D TH +SYY+P     +D GT+H S+V+ DG AVS TSTIN  FGS +    +GI++N+EMDDF++ + +N +G+P SP NFI+  K+P+SSM P I+V ++G V +V+GA+GG++I ++T    +       ++K +++ PR+HNQL PN   VE+N   A+  +L  R H     + + AVVQ I+++      W   +D RK G
Sbjct:   37 VYTRAAVAADAKQCSKIGRDALR-DGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALE------NKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLG-DVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVT--EVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAG---GWAAASDSRKGG 564          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 375.941 bits (964), Expect = 7.947e-122
Identity = 207/541 (38.26%), Postives = 319/541 (58.96%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPK--RVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DAKQC+ +    +   GG+A+D AIA LLC   +N HS GI GG  L  Y    +K    + RE+AP+LA   MF + + S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A++      N     E + +L        K  R G+ +  P+LA T   L++E   A  NGSL   ++ ++ + G I+  +DL  Y+ +  E P+++ LG D  LY    P SG ++A  LN+L  Y F   S +S E   L YHR++E  +F++AKR+ LGD  F++ T  E++RN+TSE ++ ++ + I+ D TH +SYY+P     +D GT+H S+V+ DG AVS TSTIN  FGS +    +GI++N+EMDDF++ + +N +G+P SP NFI+  K+P+SSM P I+V ++G V +V+GA+GG++I ++T    +       ++K +++ PR+HNQL PN   VE+N   A+  +L  R H     + + AVVQ I+++      W   +D RK G
Sbjct:   37 VYTRAAVAADAKQCSKIGRDALR-DGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALE------NKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLG-DVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVT--EVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAG---GWAAASDSRKGG 564          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 375.941 bits (964), Expect = 7.947e-122
Identity = 207/541 (38.26%), Postives = 319/541 (58.96%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPK--RVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DAKQC+ +    +   GG+A+D AIA LLC   +N HS GI GG  L  Y    +K    + RE+AP+LA   MF + + S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A++      N     E + +L        K  R G+ +  P+LA T   L++E   A  NGSL   ++ ++ + G I+  +DL  Y+ +  E P+++ LG D  LY    P SG ++A  LN+L  Y F   S +S E   L YHR++E  +F++AKR+ LGD  F++ T  E++RN+TSE ++ ++ + I+ D TH +SYY+P     +D GT+H S+V+ DG AVS TSTIN  FGS +    +GI++N+EMDDF++ + +N +G+P SP NFI+  K+P+SSM P I+V ++G V +V+GA+GG++I ++T    +       ++K +++ PR+HNQL PN   VE+N   A+  +L  R H     + + AVVQ I+++      W   +D RK G
Sbjct:   37 VYTRAAVAADAKQCSKIGRDALR-DGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALE------NKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLG-DVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVT--EVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAG---GWAAASDSRKGG 564          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Human
Match: GGT2 (gamma-glutamyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:4251])

HSP 1 Score: 345.125 bits (884), Expect = 4.887e-110
Identity = 197/541 (36.41%), Postives = 308/541 (56.93%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPK--RVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R A+A+DAKQC  +    +   GG+A+D AIA LLC   +N HS GI  G  L  Y    +K    + RE+AP+LA   MF + + S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +   ++      N     E + +L        K  R G+ +  P+LA T  +L++E   A  NGSL+  ++ ++ + G I+  +DL  Y+ +  E P+++ LG D+ LY      SG ++A  LN+L  Y F   S ++ E   L YHR++E  +F++AKR+ LGD  F++ T  E++RN+TSE ++ ++ S I+D  TH +SYY+P     +D GT+H S+V+ DG AVS TSTIN  FGS +    +GI++N+E    A    +N +G P SP NFI+  K+P+ SM   I+V ++G V +V+GA+GG++I + T    +       ++K +++ PR+HN+L PN   VE+N   A+  +L  R H     + + AVVQ I+++      W   +D RK G
Sbjct:   37 VYTRAAMAADAKQCLEIGRDTLR-DGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTRKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLE------NKRTVIEQQPVLWYVFCRDRKVLREGERLTLPRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLG-DAVLYMPSARLSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVT--EVVRNMTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAG---GWAAASDSRKGG 564          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Human
Match: GGT2 (gamma-glutamyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:4251])

HSP 1 Score: 333.183 bits (853), Expect = 1.752e-105
Identity = 194/541 (35.86%), Postives = 303/541 (56.01%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPK--RVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R A+A+DAKQC  +    +   GG+A+D AIA LLC   +N HS GI  G  L  Y    +K    + RE+AP+LA   MF + + S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +   ++      N     E + +L        K  R G+ +  P+LA T  +L++E   A  NGSL+  ++ ++ + G I+  +DL  Y+ +  E P+++ LG D+ LY      SG ++A  LN+L  Y F   S ++ E   L YHR++E  +F++AKR+ LGD  F++ T  E++RN+TSE ++ ++ S I+D  TH +SYY+P     +D GT+H S+V+ DG AVS TSTIN            GI++N+E    A    +N +G P SP NFI+  K+P+ SM   I+V ++G V +V+GA+GG++I + T    +       ++K +++ PR+HN+L PN   VE+N   A+  +L  R H     + + AVVQ I+++      W   +D RK G
Sbjct:   37 VYTRAAMAADAKQCLEIGRDTLR-DGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTRKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLE------NKRTVIEQQPVLWYVFCRDRKVLREGERLTLPRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLG-DAVLYMPSARLSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVT--EVVRNMTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLY----------GILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAG---GWAAASDSRKGG 554          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Celegans
Match: C53D5.5 (pep chromosome:WBcel235:I:305811:310082:-1 gene:WBGene00016906.1 transcript:C53D5.5b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C53D5.5)

HSP 1 Score: 344.739 bits (883), Expect = 5.513e-110
Identity = 201/524 (38.36%), Postives = 294/524 (56.11%), Query Frame = 3
Query:  282 LPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFEN-GDSSVHGGKSIAVTGLVAGYYEIHRRFG--KINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPK-LAQTMRIL--SVEPYA-MKNGSLVNDMIAEMTSGGSIILKDDLLEYK---MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPS-HVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVV 1817
             P  + S +G Y + AVA+D + C+ +   I+ +KGGNA+D AIA L C   ++ HS GI GG  +  Y    K+    D RE+AP  AT  M+ +  + S  G K+IAV G + G      RFG  K+ W+ L +PTID+L  G+P S  + +A++    N +    +       NP T +  + G+ IKT + L +T R+L  S +P A    G L   +  E  + G II   D   YK      +  I  +L +   +   PPPS   +    LNV+  ++++  S +    L   YH  +E+ KFS+A RS LGD  F+ N   E+ +N+TS+ ++  + S ITD TH   YY  S   P +DHGT+H S++  DG+AVSVTSTIN   G+ +    TGI++N+EMDDF+T    N +G P SP NFI   KRPMSS SP++I + +G   + +G +GGS I+S     A+ A  LK ++K+++D PR+HNQL PN    E NFP A +KSL++RGHV+
Sbjct:   44 WPGPSLSPLGKYSKAAVAADNEICSEIGRNIL-LKGGNAVDSAIAALFCIGVMDTHSAGIGGGHFMTIYNATTKECTVIDAREIAPLAATEEMYRDKWNQSRIGWKAIAVPGELHGLRTEFERFGSGKVEWRQLLKPTIDLLAEGYPTSHALAKALN---QNEHQIRAEPTMKNFINPETQRVFQPGEQIKTRQNLLETFRLLANSTDPIADFYTGRLAEQLAKEFEANGGIIRLQDFKNYKSIVHDSKNVIYTKLKNGRGVCGPPPPSGSAVAQAILNVMDGFEYNMKSFNEIATL---YHHFLESSKFSYAARSWLGDPQFVANA-TEIAKNITSKEWADWVRSKITDTTHPDDYYGGSFEAPPQDHGTTHVSIIDADGNAVSVTSTINLYLGALVSSESTGILWNNEMDDFSTPGHPNFFGFPPSPANFIRPGKRPMSSQSPLVIFNTKGAELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQPNYTWYEPNFPKAYVKSLIDRGHVM 559          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Celegans
Match: C53D5.5 (pep chromosome:WBcel235:I:305811:311130:-1 gene:WBGene00016906.1 transcript:C53D5.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C53D5.5)

HSP 1 Score: 344.739 bits (883), Expect = 5.513e-110
Identity = 201/524 (38.36%), Postives = 294/524 (56.11%), Query Frame = 3
Query:  282 LPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFEN-GDSSVHGGKSIAVTGLVAGYYEIHRRFG--KINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPK-LAQTMRIL--SVEPYA-MKNGSLVNDMIAEMTSGGSIILKDDLLEYK---MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPS-HVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVV 1817
             P  + S +G Y + AVA+D + C+ +   I+ +KGGNA+D AIA L C   ++ HS GI GG  +  Y    K+    D RE+AP  AT  M+ +  + S  G K+IAV G + G      RFG  K+ W+ L +PTID+L  G+P S  + +A++    N +    +       NP T +  + G+ IKT + L +T R+L  S +P A    G L   +  E  + G II   D   YK      +  I  +L +   +   PPPS   +    LNV+  ++++  S +    L   YH  +E+ KFS+A RS LGD  F+ N   E+ +N+TS+ ++  + S ITD TH   YY  S   P +DHGT+H S++  DG+AVSVTSTIN   G+ +    TGI++N+EMDDF+T    N +G P SP NFI   KRPMSS SP++I + +G   + +G +GGS I+S     A+ A  LK ++K+++D PR+HNQL PN    E NFP A +KSL++RGHV+
Sbjct:   44 WPGPSLSPLGKYSKAAVAADNEICSEIGRNIL-LKGGNAVDSAIAALFCIGVMDTHSAGIGGGHFMTIYNATTKECTVIDAREIAPLAATEEMYRDKWNQSRIGWKAIAVPGELHGLRTEFERFGSGKVEWRQLLKPTIDLLAEGYPTSHALAKALN---QNEHQIRAEPTMKNFINPETQRVFQPGEQIKTRQNLLETFRLLANSTDPIADFYTGRLAEQLAKEFEANGGIIRLQDFKNYKSIVHDSKNVIYTKLKNGRGVCGPPPPSGSAVAQAILNVMDGFEYNMKSFNEIATL---YHHFLESSKFSYAARSWLGDPQFVANA-TEIAKNITSKEWADWVRSKITDTTHPDDYYGGSFEAPPQDHGTTHVSIIDADGNAVSVTSTINLYLGALVSSESTGILWNNEMDDFSTPGHPNFFGFPPSPANFIRPGKRPMSSQSPLVIFNTKGAELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQPNYTWYEPNFPKAYVKSLIDRGHVM 559          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Celegans
Match: C53D5.5 (pep chromosome:WBcel235:I:305811:310966:-1 gene:WBGene00016906.1 transcript:C53D5.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C53D5.5)

HSP 1 Score: 344.739 bits (883), Expect = 1.927e-109
Identity = 201/524 (38.36%), Postives = 294/524 (56.11%), Query Frame = 3
Query:  282 LPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFEN-GDSSVHGGKSIAVTGLVAGYYEIHRRFG--KINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPK-LAQTMRIL--SVEPYA-MKNGSLVNDMIAEMTSGGSIILKDDLLEYK---MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPS-HVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVV 1817
             P  + S +G Y + AVA+D + C+ +   I+ +KGGNA+D AIA L C   ++ HS GI GG  +  Y    K+    D RE+AP  AT  M+ +  + S  G K+IAV G + G      RFG  K+ W+ L +PTID+L  G+P S  + +A++    N +    +       NP T +  + G+ IKT + L +T R+L  S +P A    G L   +  E  + G II   D   YK      +  I  +L +   +   PPPS   +    LNV+  ++++  S +    L   YH  +E+ KFS+A RS LGD  F+ N   E+ +N+TS+ ++  + S ITD TH   YY  S   P +DHGT+H S++  DG+AVSVTSTIN   G+ +    TGI++N+EMDDF+T    N +G P SP NFI   KRPMSS SP++I + +G   + +G +GGS I+S     A+ A  LK ++K+++D PR+HNQL PN    E NFP A +KSL++RGHV+
Sbjct:   90 WPGPSLSPLGKYSKAAVAADNEICSEIGRNIL-LKGGNAVDSAIAALFCIGVMDTHSAGIGGGHFMTIYNATTKECTVIDAREIAPLAATEEMYRDKWNQSRIGWKAIAVPGELHGLRTEFERFGSGKVEWRQLLKPTIDLLAEGYPTSHALAKALN---QNEHQIRAEPTMKNFINPETQRVFQPGEQIKTRQNLLETFRLLANSTDPIADFYTGRLAEQLAKEFEANGGIIRLQDFKNYKSIVHDSKNVIYTKLKNGRGVCGPPPPSGSAVAQAILNVMDGFEYNMKSFNEIATL---YHHFLESSKFSYAARSWLGDPQFVANA-TEIAKNITSKEWADWVRSKITDTTHPDDYYGGSFEAPPQDHGTTHVSIIDADGNAVSVTSTINLYLGALVSSESTGILWNNEMDDFSTPGHPNFFGFPPSPANFIRPGKRPMSSQSPLVIFNTKGAELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQPNYTWYEPNFPKAYVKSLIDRGHVM 605          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Celegans
Match: C53D5.5 (pep chromosome:WBcel235:I:305811:310802:-1 gene:WBGene00016906.1 transcript:C53D5.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C53D5.5)

HSP 1 Score: 344.739 bits (883), Expect = 1.927e-109
Identity = 201/524 (38.36%), Postives = 294/524 (56.11%), Query Frame = 3
Query:  282 LPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFEN-GDSSVHGGKSIAVTGLVAGYYEIHRRFG--KINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPK-LAQTMRIL--SVEPYA-MKNGSLVNDMIAEMTSGGSIILKDDLLEYK---MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPS-HVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVV 1817
             P  + S +G Y + AVA+D + C+ +   I+ +KGGNA+D AIA L C   ++ HS GI GG  +  Y    K+    D RE+AP  AT  M+ +  + S  G K+IAV G + G      RFG  K+ W+ L +PTID+L  G+P S  + +A++    N +    +       NP T +  + G+ IKT + L +T R+L  S +P A    G L   +  E  + G II   D   YK      +  I  +L +   +   PPPS   +    LNV+  ++++  S +    L   YH  +E+ KFS+A RS LGD  F+ N   E+ +N+TS+ ++  + S ITD TH   YY  S   P +DHGT+H S++  DG+AVSVTSTIN   G+ +    TGI++N+EMDDF+T    N +G P SP NFI   KRPMSS SP++I + +G   + +G +GGS I+S     A+ A  LK ++K+++D PR+HNQL PN    E NFP A +KSL++RGHV+
Sbjct:   90 WPGPSLSPLGKYSKAAVAADNEICSEIGRNIL-LKGGNAVDSAIAALFCIGVMDTHSAGIGGGHFMTIYNATTKECTVIDAREIAPLAATEEMYRDKWNQSRIGWKAIAVPGELHGLRTEFERFGSGKVEWRQLLKPTIDLLAEGYPTSHALAKALN---QNEHQIRAEPTMKNFINPETQRVFQPGEQIKTRQNLLETFRLLANSTDPIADFYTGRLAEQLAKEFEANGGIIRLQDFKNYKSIVHDSKNVIYTKLKNGRGVCGPPPPSGSAVAQAILNVMDGFEYNMKSFNEIATL---YHHFLESSKFSYAARSWLGDPQFVANA-TEIAKNITSKEWADWVRSKITDTTHPDDYYGGSFEAPPQDHGTTHVSIIDADGNAVSVTSTINLYLGALVSSESTGILWNNEMDDFSTPGHPNFFGFPPSPANFIRPGKRPMSSQSPLVIFNTKGAELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQPNYTWYEPNFPKAYVKSLIDRGHVM 605          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Celegans
Match: H14N18.4 (pep chromosome:WBcel235:V:8924264:8927853:-1 gene:WBGene00019204.1 transcript:H14N18.4d.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14N18.4)

HSP 1 Score: 316.235 bits (809), Expect = 1.003e-98
Identity = 206/558 (36.92%), Postives = 304/558 (54.48%), Query Frame = 3
Query:  285 PTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFG--KINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILS--VEPYAM-KNGSLVNDMIAEMTSGGSIILKDDLLEYK--MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYY---QPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDK-EGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP---AVVQGIMKSLNPQYSWQCNADHRKK 1910
            PT + S    YK+ AV SD   C+ +   ++ ++GGNA+D  IA LLC  +VN  S GI GG ++  Y  +       + RE AP  AT  MF +N   SV G KSIA    + G++ +   +G  K++W  LF+P+I +   GFPVS  +  A+          E   ++DI  NP T +    GDI+K  +LA T  +L+   +P  +   G +   +  E+T  G  + + DL  Y+  + +   +S  L  D  +   PPPSS V+    + V+  Y  D    D  + LV  YHRLIE  KF++A+R+ LGD+ F+ +  K L+  + +E Y+K+I SLI D    + YY   +    P  DHGTSH S++   G+AVS TST+N + GS       GIV+ND+MDDF+T    N++G   S  NFI+  KRPMSSMSP+II +K E  V +V GASGGS I+S+T QT +   L  + +K ++D PR HNQ  P     E+  P AL + LVE+ +  N  + P   +VVQ +   ++ +   + N+D R+K
Sbjct:   62 PTPSGSLFAHYKKAAVTSDHGLCSEIGRDVL-IEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVDNPKESVMGYKSIATPSELHGFWTVFNMYGSGKVSWARLFQPSITLAHDGFPVSSNL--AMVLADKEKYIREEPTMKDIFVNPKTNRVYEEGDILKRQRLASTYALLANATDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETTIDDAPLLSTHLPGDYEMCGPPPPSSFVITQNIIQVMAQYYKD-GQVDLDDPLV--YHRLIEAEKFAYAQRTKLGDVKFVESA-KTLVDEMMTEEYTKKIASLIKDTAQTLDYYGGEKKDMAP--DHGTSHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFSTPGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYNKNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAPRFHNQYLPETTETEEAMPLALREVLVEQ-YKQNFTVVPRQKSVVQAL---ISLEGFVEGNSDFRRK 606          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Fly
Match: CG4829 (gene:FBgn0030796 transcript:FBtr0112994)

HSP 1 Score: 352.829 bits (904), Expect = 6.423e-112
Identity = 214/555 (38.56%), Postives = 327/555 (58.92%), Query Frame = 3
Query:  297 DSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRD--ILTNPITGKPKRVGDIIKTPK-LAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTH---EVSYYQPSHVPKED-HGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQN-FPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +S +G+Y+  AV+SD  +C+ + + I+  K G+A+D AIA LLC   +   S GI GG L+  Y + E+   A D RE+AP  AT  MF +  ++S  G  SIAV G V GY+  H++FG++ W  L  P++++ E G+ VS+ +E A+D        P  KE     I  N  TGKP   G ++K PK L +T ++L+   P  M NG++   +  ++   GSIIL DDL  Y+      I++ LGDD TLY +PP SSG +VA  L +L  Y F      + E      HR  E MKF+FA+R  LGD+ F++   +EL+  L S  +  +  + I D +H   +   Y  +    ED  GTS+  +++P+GDAVSVTS+IN  FGS ++G +TGIV N+ M+DFA  K+N + LP S +N IE +KR MSS SPI++ DK+GN+ +VIGA+GGSKI+ + ++ A       K++++++D PR ++QL P+ +  E++ F ++L++ L +RGH +        +VV  I ++    Y+   NAD+RK+G   G
Sbjct:  146 NSILGVYQHGAVSSDNLECSKIGSGILQ-KNGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHATAIDAREVAPYEATEDMFAQQPENSDKGPLSIAVPGEVMGYHVAHQKFGQLPWAELVAPSLELCEKGYHVSQHMERALDIAL-----PYIKEHEQYQIYLNAETGKPHVAGTVVKPPKNLCKTYKLLAENGPMDMYNGTIAKLLAEDLQDMGSIILADDLESYEADVINSITMDLGDD-TLYVVPPVSSGSVVAHVLAILQGYNFTAQDLSTEELKARTIHRFAEAMKFAFAQRPELGDMHFIDA--RELVSRLNSPDFGDQNRAKIND-SHVLPDAQAYGANFAAIEDLDGTSNLVVLAPNGDAVSVTSSINSYFGSGLIGPRTGIVLNNGMNDFAV-KNNIFALPQSQSNKIEAHKRAMSSQSPILLADKDGNMKMVIGAAGGSKIIPAVVEVAANVLWFGKDLRQAVDAPRFYHQLMPDVLEYEEDGFTESLLQLLTKRGHKLKSISVKTGSVVTAISRNATAIYA---NADYRKRGGVAG 686          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Fly
Match: CG4829 (gene:FBgn0030796 transcript:FBtr0112995)

HSP 1 Score: 353.214 bits (905), Expect = 1.685e-111
Identity = 214/555 (38.56%), Postives = 327/555 (58.92%), Query Frame = 3
Query:  297 DSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRD--ILTNPITGKPKRVGDIIKTPK-LAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTH---EVSYYQPSHVPKED-HGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQN-FPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +S +G+Y+  AV+SD  +C+ + + I+  K G+A+D AIA LLC   +   S GI GG L+  Y + E+   A D RE+AP  AT  MF +  ++S  G  SIAV G V GY+  H++FG++ W  L  P++++ E G+ VS+ +E A+D        P  KE     I  N  TGKP   G ++K PK L +T ++L+   P  M NG++   +  ++   GSIIL DDL  Y+      I++ LGDD TLY +PP SSG +VA  L +L  Y F      + E      HR  E MKF+FA+R  LGD+ F++   +EL+  L S  +  +  + I D +H   +   Y  +    ED  GTS+  +++P+GDAVSVTS+IN  FGS ++G +TGIV N+ M+DFA  K+N + LP S +N IE +KR MSS SPI++ DK+GN+ +VIGA+GGSKI+ + ++ A       K++++++D PR ++QL P+ +  E++ F ++L++ L +RGH +        +VV  I ++    Y+   NAD+RK+G   G
Sbjct:  191 NSILGVYQHGAVSSDNLECSKIGSGILQ-KNGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHATAIDAREVAPYEATEDMFAQQPENSDKGPLSIAVPGEVMGYHVAHQKFGQLPWAELVAPSLELCEKGYHVSQHMERALDIAL-----PYIKEHEQYQIYLNAETGKPHVAGTVVKPPKNLCKTYKLLAENGPMDMYNGTIAKLLAEDLQDMGSIILADDLESYEADVINSITMDLGDD-TLYVVPPVSSGSVVAHVLAILQGYNFTAQDLSTEELKARTIHRFAEAMKFAFAQRPELGDMHFIDA--RELVSRLNSPDFGDQNRAKIND-SHVLPDAQAYGANFAAIEDLDGTSNLVVLAPNGDAVSVTSSINSYFGSGLIGPRTGIVLNNGMNDFAV-KNNIFALPQSQSNKIEAHKRAMSSQSPILLADKDGNMKMVIGAAGGSKIIPAVVEVAANVLWFGKDLRQAVDAPRFYHQLMPDVLEYEEDGFTESLLQLLTKRGHKLKSISVKTGSVVTAISRNATAIYA---NADYRKRGGVAG 731          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Fly
Match: CG4829 (gene:FBgn0030796 transcript:FBtr0074337)

HSP 1 Score: 353.599 bits (906), Expect = 3.601e-111
Identity = 214/555 (38.56%), Postives = 327/555 (58.92%), Query Frame = 3
Query:  297 DSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRD--ILTNPITGKPKRVGDIIKTPK-LAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTH---EVSYYQPSHVPKED-HGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQN-FPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +S +G+Y+  AV+SD  +C+ + + I+  K G+A+D AIA LLC   +   S GI GG L+  Y + E+   A D RE+AP  AT  MF +  ++S  G  SIAV G V GY+  H++FG++ W  L  P++++ E G+ VS+ +E A+D        P  KE     I  N  TGKP   G ++K PK L +T ++L+   P  M NG++   +  ++   GSIIL DDL  Y+      I++ LGDD TLY +PP SSG +VA  L +L  Y F      + E      HR  E MKF+FA+R  LGD+ F++   +EL+  L S  +  +  + I D +H   +   Y  +    ED  GTS+  +++P+GDAVSVTS+IN  FGS ++G +TGIV N+ M+DFA  K+N + LP S +N IE +KR MSS SPI++ DK+GN+ +VIGA+GGSKI+ + ++ A       K++++++D PR ++QL P+ +  E++ F ++L++ L +RGH +        +VV  I ++    Y+   NAD+RK+G   G
Sbjct:  236 NSILGVYQHGAVSSDNLECSKIGSGILQ-KNGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHATAIDAREVAPYEATEDMFAQQPENSDKGPLSIAVPGEVMGYHVAHQKFGQLPWAELVAPSLELCEKGYHVSQHMERALDIAL-----PYIKEHEQYQIYLNAETGKPHVAGTVVKPPKNLCKTYKLLAENGPMDMYNGTIAKLLAEDLQDMGSIILADDLESYEADVINSITMDLGDD-TLYVVPPVSSGSVVAHVLAILQGYNFTAQDLSTEELKARTIHRFAEAMKFAFAQRPELGDMHFIDA--RELVSRLNSPDFGDQNRAKIND-SHVLPDAQAYGANFAAIEDLDGTSNLVVLAPNGDAVSVTSSINSYFGSGLIGPRTGIVLNNGMNDFAV-KNNIFALPQSQSNKIEAHKRAMSSQSPILLADKDGNMKMVIGAAGGSKIIPAVVEVAANVLWFGKDLRQAVDAPRFYHQLMPDVLEYEEDGFTESLLQLLTKRGHKLKSISVKTGSVVTAISRNATAIYA---NADYRKRGGVAG 776          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Fly
Match: CG4829 (gene:FBgn0030796 transcript:FBtr0074338)

HSP 1 Score: 353.599 bits (906), Expect = 3.601e-111
Identity = 214/555 (38.56%), Postives = 327/555 (58.92%), Query Frame = 3
Query:  297 DSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRD--ILTNPITGKPKRVGDIIKTPK-LAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTH---EVSYYQPSHVPKED-HGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQN-FPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +S +G+Y+  AV+SD  +C+ + + I+  K G+A+D AIA LLC   +   S GI GG L+  Y + E+   A D RE+AP  AT  MF +  ++S  G  SIAV G V GY+  H++FG++ W  L  P++++ E G+ VS+ +E A+D        P  KE     I  N  TGKP   G ++K PK L +T ++L+   P  M NG++   +  ++   GSIIL DDL  Y+      I++ LGDD TLY +PP SSG +VA  L +L  Y F      + E      HR  E MKF+FA+R  LGD+ F++   +EL+  L S  +  +  + I D +H   +   Y  +    ED  GTS+  +++P+GDAVSVTS+IN  FGS ++G +TGIV N+ M+DFA  K+N + LP S +N IE +KR MSS SPI++ DK+GN+ +VIGA+GGSKI+ + ++ A       K++++++D PR ++QL P+ +  E++ F ++L++ L +RGH +        +VV  I ++    Y+   NAD+RK+G   G
Sbjct:  236 NSILGVYQHGAVSSDNLECSKIGSGILQ-KNGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHATAIDAREVAPYEATEDMFAQQPENSDKGPLSIAVPGEVMGYHVAHQKFGQLPWAELVAPSLELCEKGYHVSQHMERALDIAL-----PYIKEHEQYQIYLNAETGKPHVAGTVVKPPKNLCKTYKLLAENGPMDMYNGTIAKLLAEDLQDMGSIILADDLESYEADVINSITMDLGDD-TLYVVPPVSSGSVVAHVLAILQGYNFTAQDLSTEELKARTIHRFAEAMKFAFAQRPELGDMHFIDA--RELVSRLNSPDFGDQNRAKIND-SHVLPDAQAYGANFAAIEDLDGTSNLVVLAPNGDAVSVTSSINSYFGSGLIGPRTGIVLNNGMNDFAV-KNNIFALPQSQSNKIEAHKRAMSSQSPILLADKDGNMKMVIGAAGGSKIIPAVVEVAANVLWFGKDLRQAVDAPRFYHQLMPDVLEYEEDGFTESLLQLLTKRGHKLKSISVKTGSVVTAISRNATAIYA---NADYRKRGGVAG 776          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Fly
Match: CG4829 (gene:FBgn0030796 transcript:FBtr0074336)

HSP 1 Score: 353.214 bits (905), Expect = 1.396e-110
Identity = 214/555 (38.56%), Postives = 327/555 (58.92%), Query Frame = 3
Query:  297 DSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRD--ILTNPITGKPKRVGDIIKTPK-LAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTH---EVSYYQPSHVPKED-HGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQN-FPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +S +G+Y+  AV+SD  +C+ + + I+  K G+A+D AIA LLC   +   S GI GG L+  Y + E+   A D RE+AP  AT  MF +  ++S  G  SIAV G V GY+  H++FG++ W  L  P++++ E G+ VS+ +E A+D        P  KE     I  N  TGKP   G ++K PK L +T ++L+   P  M NG++   +  ++   GSIIL DDL  Y+      I++ LGDD TLY +PP SSG +VA  L +L  Y F      + E      HR  E MKF+FA+R  LGD+ F++   +EL+  L S  +  +  + I D +H   +   Y  +    ED  GTS+  +++P+GDAVSVTS+IN  FGS ++G +TGIV N+ M+DFA  K+N + LP S +N IE +KR MSS SPI++ DK+GN+ +VIGA+GGSKI+ + ++ A       K++++++D PR ++QL P+ +  E++ F ++L++ L +RGH +        +VV  I ++    Y+   NAD+RK+G   G
Sbjct:  281 NSILGVYQHGAVSSDNLECSKIGSGILQ-KNGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHATAIDAREVAPYEATEDMFAQQPENSDKGPLSIAVPGEVMGYHVAHQKFGQLPWAELVAPSLELCEKGYHVSQHMERALDIAL-----PYIKEHEQYQIYLNAETGKPHVAGTVVKPPKNLCKTYKLLAENGPMDMYNGTIAKLLAEDLQDMGSIILADDLESYEADVINSITMDLGDD-TLYVVPPVSSGSVVAHVLAILQGYNFTAQDLSTEELKARTIHRFAEAMKFAFAQRPELGDMHFIDA--RELVSRLNSPDFGDQNRAKIND-SHVLPDAQAYGANFAAIEDLDGTSNLVVLAPNGDAVSVTSSINSYFGSGLIGPRTGIVLNNGMNDFAV-KNNIFALPQSQSNKIEAHKRAMSSQSPILLADKDGNMKMVIGAAGGSKIIPAVVEVAANVLWFGKDLRQAVDAPRFYHQLMPDVLEYEEDGFTESLLQLLTKRGHKLKSISVKTGSVVTAISRNATAIYA---NADYRKRGGVAG 821          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Zebrafish
Match: ggt1b (gamma-glutamyltransferase 1b [Source:ZFIN;Acc:ZDB-GENE-110408-13])

HSP 1 Score: 357.451 bits (916), Expect = 6.496e-115
Identity = 222/552 (40.22%), Postives = 311/552 (56.34%), Query Frame = 3
Query:  294 TDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENG-DSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNK-NLYPAVVQGIMKSLNPQYSWQCNA--DHRKKGICDG 1925
            +D   G +K  AVA+DA  C+ +   ++  KGG+A+D AIA LLC   +N HS GI GG     Y     K    + RE AP  AT  MF N  + S  GG SIAV G + GY   HRR G++ WK LF P+I +   GFPV   +  AI    N  N  E K L  +  N  TG   +  D I   KLA T   ++ + P A  +G+L   ++ ++     II   DL +Y+ + +  P +  +G+  T+ T   PSSG ++   LN+L+ Y   P S  S E  +L YHR++E  +F++AKRS LGD  FLN +D   ++N+TS+ Y+  I   ITD  T + SYY+P     E++GTSH S+V+ DG AV+ TSTIN  FGS +M   TGI+ N+EMDDF++   +N +G+P SPNNFI   KRPMSSM P I++DK   V +V+GASGG+KI ++  Q  +     + ++K++I   RVHNQL PN   VEQ+F  A+++ L E+ H         AVVQ + +     YS   +A  D RK G   G
Sbjct:   35 SDPESGFFK-AAVATDAGTCSEIGRDVLK-KGGSAVDSAIAALLCAGLMNAHSMGIGGGLFFTIYDAKTGKAETINARETAPANATRDMFGNSTELSQKGGLSIAVPGEIRGYEMAHRRHGRLPWKELFLPSIKLARDGFPVGRALASAIRS--NRNNILEDKMLCSVFCNS-TGNILQENDTITFTKLADTYEAIAEQGPEAFYSGALAESLVRDIQDADGIITLADLRDYRALLDEYPPTASVGE-FTMVTPDAPSSGPVLTLMLNILSGYSLSPDSVSSTEKKILTYHRVVEAFRFAYAKRSVLGDPQFLNISD--FIQNITSKGYADMIRLKITDNSTQQESYYEPEFYLPENYGTSHVSVVAEDGSAVAATSTINTYFGSKLMSKSTGILLNNEMDDFSSPLITNNFGVPPSPNNFIVPNKRPMSSMCPAILLDKNNQVKMVVGASGGTKITTAVAQVVLNTLFFQYDLKKAIAEARVHNQLSPNTTQVEQSFDKAVLEGLAEKNHFTEVFTSMGAVVQAVAR-----YSEGLSAESDPRKGGYAAG 573          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Zebrafish
Match: ggt1a (gamma-glutamyltransferase 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1388])

HSP 1 Score: 356.295 bits (913), Expect = 2.510e-114
Identity = 218/560 (38.93%), Postives = 319/560 (56.96%), Query Frame = 3
Query:  282 LPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDS-SVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKE--LRDI-LTNPITGKPKRV---GDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP-AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            L   +D F   Y + AVA+DA +C+ V   I+  + G+A+D +IA LLC    N HS GI GG     +  +  K+   D RE AP+ A+  MF N    S  GG SIA+ G + GY   H R G++ W+ LF P+I +   GFPV + +  AI          + KE  L D+ L        K +    DII+   LA T   ++ E P    +GSL  +++ ++ + G II  +DL EYK +    P+ + +G+  T+     PSSG ++A  LN++  + F   S  + E   L YHR++E  +F++AKRS LGD  +LN TD  L+ N+TS+ ++  I S ITD T H  SYY P +   ++HGT+H S+++ DG AV+ TSTIN  FGS +M   TGI++NDEMDDF++   +N +G+P SPNNFI+  KRP+SSM P II DK   V +V+GASGG+KI ++T    + +     ++K+++  PRVHNQL PN  VVEQ+F  +++  L ++ HV      P AVVQ I++    +   +C  D RK G   G
Sbjct:   38 LTVSSDHF---YSKAAVAADAGKCSEVGRDILK-RNGSAVDASIAALLCVGLFNAHSMGIGGGLFFTIFNASTGKVETIDARETAPKNASEDMFGNNTQLSRKGGLSIAIPGEIRGYEMAHNRHGRLPWRELFLPSIKLARNGFPVGKALANAI---------AKNKETILSDMTLCEVFCDSDKNILKENDIIRFTTLADTYEKIAEEGPDVFYSGSLAQNIVDDIQAAGGIITLEDLREYKPVLNETPLKLTVGE-YTINVPDAPSSGPVLALILNIVDGFNFSDHSVSTAEKKTLTYHRIVEAFRFAYAKRSKLGDPRYLNITD--LIHNMTSDYFADNIRSKITDDTTHPDSYYDPEYFVPDNHGTAHLSVIAEDGSAVAATSTINLYFGSKVMSRSTGIIFNDEMDDFSSPYITNGFGVPPSPNNFIQPGKRPLSSMCPTIIFDKHNRVKMVVGASGGTKITTATALVILNSLFFNYDLKKAVTEPRVHNQLNPNMTVVEQDFEQSVLDGLEQKNHVTELQRTPGAVVQAIVRQ-GDKLCAEC--DPRKGGYPAG 578          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Zebrafish
Match: ggt1a (gamma-glutamyltransferase 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1388])

HSP 1 Score: 317.775 bits (813), Expect = 1.066e-100
Identity = 195/502 (38.84%), Postives = 287/502 (57.17%), Query Frame = 3
Query:  456 GIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDS-SVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKE--LRDI-LTNPITGKPKRV---GDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP-AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            GI GG     +  +  K+   D RE AP+ A+  MF N    S  GG SIA+ G + GY   H R G++ W+ LF P+I +   GFPV + +  AI          + KE  L D+ L        K +    DII+   LA T   ++ E P    +GSL  +++ ++ + G II  +DL EYK +    P+ + +G+  T+     PSSG ++A  LN++  + F   S  + E   L YHR++E  +F++AKRS LGD  +LN TD  L+ N+TS+ ++  I S ITD T H  SYY P +   ++HGT+H S+++ DG AV+ TSTIN  FGS +M   TGI++NDEMDDF++   +N +G+P SPNNFI+  KRP+SSM P II DK   V +V+GASGG+KI ++T    + +     ++K+++  PRVHNQL PN  VVEQ+F  +++  L ++ HV      P AVVQ I++  + +   +C  D RK G   G
Sbjct:    2 GIGGGLFFTIFNASTGKVETIDARETAPKNASEDMFGNNTQLSRKGGLSIAIPGEIRGYEMAHNRHGRLPWRELFLPSIKLARNGFPVGKALANAI---------AKNKETILSDMTLCEVFCDSDKNILKENDIIRFTTLADTYEKIAEEGPDVFYSGSLAQNIVDDIQAAGGIITLEDLREYKPVLNETPLKLTVGE-YTINVPDAPSSGPVLALILNIVDGFNFSDHSVSTAEKKTLTYHRIVEAFRFAYAKRSKLGDPRYLNITD--LIHNMTSDYFADNIRSKITDDTTHPDSYYDPEYFVPDNHGTAHLSVIAEDGSAVAATSTINLYFGSKVMSRSTGIIFNDEMDDFSSPYITNGFGVPPSPNNFIQPGKRPLSSMCPTIIFDKHNRVKMVVGASGGTKITTATALVILNSLFFNYDLKKAVTEPRVHNQLNPNMTVVEQDFEQSVLDGLEQKNHVTELQRTPGAVVQAIVRQGD-KLCAEC--DPRKGGYPAG 488          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Zebrafish
Match: ggt1l2.2 (gamma-glutamyltransferase 1 like 2.2 [Source:ZFIN;Acc:ZDB-GENE-090312-37])

HSP 1 Score: 270.781 bits (691), Expect = 7.536e-82
Identity = 183/528 (34.66%), Postives = 280/528 (53.03%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAID-----YFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLP-PPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPSHVPK--EDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSP--NNFIERYKRPMSSMSPIIIV---DKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGI 1853
            Y   AVA+DA++C+ +   I+  + G+A+D AIA LLC   VN  S GI GG +   Y     K+   + RE AP  A+ +MF         G  IAV G + GY   H+R GK+ WK LF+P+I +   GF + + +  AI+        N T    F +  +I+         +  D I+ PKLA+T R +S E P A  NGSL   ++ ++ + G II ++DL  Y  +     ++  +G    ++  P  P  G ++A  L V+  Y     S  +  N  L YHRLIE  +F+  ++S LGD  F N T  E ++N+ S+ ++  I S I D   + SY +   +    EDHGTSH S+++ DG AV+VTS+IN  FGS +M   TGI++ND+M DF   +     L S P  NN I+  KRP+SSM P II    D++  V +V+G +GG+ I +S  Q  +       ++++S++  RV  Q+  N   VE++F  A+I+ L ++ H +  +   +VVQ I
Sbjct:   37 YDNAAVAADARKCSEIGRDILQ-RNGSAVDAAIAALLCVSLVNAQSMGIGGGLVFTIYNAPSGKVETINSRETAPMSASENMFGTNPEKAKPGLFIAVPGELRGYALAHKRHGKLPWKELFQPSIKLASEGFKIGKALANAINETRATIQRNATLCEVFCDSNNIVL--------KENDTIRFPKLAETYRKISEEGPDAFYNGSLTQSIVDDIKAAGGIITREDLKAYGPVLTEHALNFTVG--KYIFHAPGAPFGGPVLALILKVMKGYNISWKSMATTGNKTLTYHRLIEAFRFADVQKSKLGDPLFENIT--EHVKNMVSDSFADHIRSKIKDDLKQTSYDEQEDINTVPEDHGTSHVSVLAKDGSAVAVTSSINNYFGSGVMSRSTGIIFNDQMWDFIEPE-----LMSGPNKNNKIKPGKRPLSSMCPTIIFEKDDRKNKVRMVVGGAGGTNITTSVAQVILNHLFFGFDLQKSVNTSRV--QITLNVTNVEKDFDKAVIEGLKQKNHHILHDTALSVVQAI 544          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Zebrafish
Match: ggt1l2.1 (gamma-glutamyltransferase 1 like 2.1 [Source:ZFIN;Acc:ZDB-GENE-090312-32])

HSP 1 Score: 265.003 bits (676), Expect = 5.479e-79
Identity = 172/521 (33.01%), Postives = 281/521 (53.93%), Query Frame = 3
Query:  318 KRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKE---LRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMK-EREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSY-YQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGN-VTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMK 1859
            ++ AVA+DA+ C+ +   I+  + G+A+D AIA LLC   +N  S GI GGS+   Y      +   + RE AP  AT +MF+      + G  IAV G + GY   H R+GK+ WK LFEP+I +   GF +S+ +  AI     N    + ++   LR++  +    KP +  +  + PKLA+T R ++ E P A  +GSL   ++ E+T  G  I ++DL  YK   ++  ++  +G     +    P  G ++A  + +L  +     S  + EN+ L YHR+IE  +F+ A+++ L D     N   E ++ +TS+ ++  I S I D   + SY  Q   +  +DHGTSH S+++ DG AV+VTS+IN  FGS +M    GI++ND+M D+ + +     + + PN  I+  KRP+SSM P II+DK+   V +V G +GG+ I +S  Q  +       N+++++  PRV  Q+ PN   VE+ F   ++  L  + H +++     +VQ + K
Sbjct:   88 EKAAVAADAEICSKIGRDILG-RNGSAVDAAIAALLCVSVINPQSMGIGGGSVFTIYNAINGTVEIINARETAPMSATANMFDKEPQKENPGLLIAVPGELRGYKMAHDRYGKLPWKDLFEPSIKLASEGFNISKGLAYAI-----NMEERKIRKNIALREVFCDS-DNKPLKESNFTRFPKLAKTYRTIAEEGPDAFYDGSLTQSILDEITVAGGNITREDLKRYKPDLQKYALNFTVG-KYIFFAPTAPFGGPVLALIMKILLGFNLSNKSVSTPENMTLTYHRIIEAFRFANAQKAKLADPLHEKNV-TEFVKYMTSDSFADNIRSKIKDDIKQTSYNEQGIKIVPDDHGTSHLSVIAKDGSAVAVTSSINNFFGSGVMSCLRGIIFNDQMSDYTSPE-----MKNGPNA-IKPGKRPLSSMCPTIILDKDSRKVRMVAGGAGGTNITTSVAQVILDHLYFDYNLQKAVAEPRV--QVPPNVTNVEEGFDSTVMGWLSRKYHNISQYTSLTMVQVVEK 591          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Xenopus
Match: ggt1 (gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:448376])

HSP 1 Score: 371.318 bits (952), Expect = 8.890e-120
Identity = 216/547 (39.49%), Postives = 320/547 (58.50%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVH-GGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFN--NTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMK-EREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNT-YGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +Y R AVA+DA +C+ +   I+  + G+A+D AIA LLC   +N HS GI GG++L  Y     K    + RE AP  AT  M+ N       GGKSIAV G + GY   H+R GK+ WK LFEP+I +   GFPV   +E+ ++       +NP     L ++   P  G   ++GDI+K PKLA T++ L+ E P A   GSL   ++ ++     II ++DL  Y +  + +P+   LGD  TL +   P SG ++   +N+L  Y F   S ++ E L L YHR++E  +F++AKR+ LGD  + N T  E+++NLTS  Y++ +   ITD T H+  YY+P++  ++ HGT+H S+V+ DG AVS TSTIN  FGS ++ + TGI+YNDEMDDF++   N+ + +P SP NFI+  KRP+SSM P II+DK   V LV+GASGG KI +S     +       ++K++++ PR+HNQLFP    +E+      ++ L++R H V+   Y   +VVQ ++ S      W   +D RK G   G
Sbjct:   66 VYARAAVATDAGKCSEIGRDILK-EAGSAVDAAIACLLCVGLLNAHSMGIGGGAILTIYDSKTGKAEVINARERAPLAATEEMYGNNSQLAQIGGKSIAVPGEIRGYQLAHKRHGKLPWKRLFEPSIKLAREGFPVGLGLEQGLNRSREAIESNPL----LCEVFCGP-DGHVLQMGDIVKMPKLANTLQTLADEGPDAFYTGSLSKQIVKDIQDAEGIITEEDLRNYTVDFQDDPLQFSLGD-FTLVSPTAPLSGPVLGLIMNILKGYNFSRQSVETDEKLGLTYHRILEAFRFAYAKRTLLGDPMYENMT--EVIKNLTSVYYAEALRQKITDDTTHQPDYYEPTYFIQDSHGTAHLSIVAEDGSAVSATSTINRYFGSKVISNVTGIIYNDEMDDFSSPLINSGFDIPPSPANFIKPGKRPLSSMCPSIILDKNKKVHLVVGASGGPKITTSVALAIMSTLWFGYDVKKAVEAPRLHNQLFPGNSTLEKTINQIAVEELIKRNHNVSFETYAFGSVVQAVLHS---DGKWAAASDSRKGGYPAG 600          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Xenopus
Match: ggt1 (gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:448376])

HSP 1 Score: 354.369 bits (908), Expect = 9.888e-114
Identity = 207/521 (39.73%), Postives = 304/521 (58.35%), Query Frame = 3
Query:  390 GNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVH-GGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFN--NTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMK-EREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNT-YGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            G+A+D AIA LLC   +N HS GI GG++L  Y     K    + RE AP  AT  M+ N       GGKSIAV G + GY   H+R GK+ WK LFEP+I +   GFPV   +E+ ++       +NP     L ++   P  G   ++GDI+K PKLA T++ L+ E P A   GSL   ++ ++     II ++DL  Y +  + +P+   LGD  TL +   P SG ++   +N+L  Y F   S ++ E L L YHR++E  +F++AKR+ LGD  + N T  E+++NLTS  Y++ +   ITD T H+  YY+P++  ++ HGT+H S+V+ DG AVS TSTIN  FGS ++ + TGI+YNDEMDDF++   N+ + +P SP NFI+  KRP+SSM P II+DK   V LV+GASGG KI +S     +       ++K++++ PR+HNQLFP    +E+      ++ L++R H V+   Y   +VVQ ++ S      W   +D RK G   G
Sbjct:   43 GSAVDAAIACLLCVGLLNAHSMGIGGGAILTIYDSKTGKAEVINARERAPLAATEEMYGNNSQLAQIGGKSIAVPGEIRGYQLAHKRHGKLPWKRLFEPSIKLAREGFPVGLGLEQGLNRSREAIESNP----LLCEVFCGP-DGHVLQMGDIVKMPKLANTLQTLADEGPDAFYTGSLSKQIVKDIQDAEGIITEEDLRNYTVDFQDDPLQFSLGD-FTLVSPTAPLSGPVLGLIMNILKGYNFSRQSVETDEKLGLTYHRILEAFRFAYAKRTLLGDPMYENMT--EVIKNLTSVYYAEALRQKITDDTTHQPDYYEPTYFIQDSHGTAHLSIVAEDGSAVSATSTINRYFGSKVISNVTGIIYNDEMDDFSSPLINSGFDIPPSPANFIKPGKRPLSSMCPSIILDKNKKVHLVVGASGGPKITTSVALAIMSTLWFGYDVKKAVEAPRLHNQLFPGNSTLEKTINQVAVEELIKRNHNVSFETYAFGSVVQAVLHS---DGKWAAASDSRKGGYPAG 552          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Xenopus
Match: ggt1 (gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:448376])

HSP 1 Score: 344.354 bits (882), Expect = 6.131e-110
Identity = 210/538 (39.03%), Postives = 310/538 (57.62%), Query Frame = 3
Query:  348 QCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHM----FENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFN--NTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMK-EREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNT-YGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            Q  S+    I  + G+A+D AIA LLC   +N HS GI GG++L  Y     K    + RE AP LA  H+    F    +   GGKSIAV G + GY   H+R GK+ WK LFEP+I +   GFPV   +E+ ++       +NP     L ++   P  G   ++GDI+K PKLA T++ L+ E P A   GSL   ++ ++     II ++DL  Y +  + +P+   LGD  TL +   P SG ++   +N+L  Y F   S ++ E L L YHR++E  +F++AKR+ LGD  + N T  E+++NLTS  Y++ +   ITD T H+  YY+P++  ++ HGT+H S+V+ DG AVS TSTIN  FGS ++ + TGI+YNDEMDDF++   N+ + +P SP NFI+  KRP+SSM P II+DK   V LV+GASGG KI +S     +       ++K++++ PR+HNQLFP    +E+      ++ L++R H V+   Y   +VVQ ++ S      W   +D RK G   G
Sbjct:   22 QARSLERRDILKEAGSAVDAAIACLLCVGLLNAHSMGIGGGAILTIYDSKTGKAEVINARERAP-LAV-HLDNLTFFCSCTPFVGGKSIAVPGEIRGYQLAHKRHGKLPWKRLFEPSIKLAREGFPVGLGLEQGLNRSREAIESNP----LLCEVFCGP-DGHVLQMGDIVKMPKLANTLQTLADEGPDAFYTGSLSKQIVKDIQDAEGIITEEDLRNYTVDFQDDPLQFSLGD-FTLVSPTAPLSGPVLGLIMNILKGYNFSRQSVETDEKLGLTYHRILEAFRFAYAKRTLLGDPMYENMT--EVIKNLTSVYYAEALRQKITDDTTHQPDYYEPTYFIQDSHGTAHLSIVAEDGSAVSATSTINRYFGSKVISNVTGIIYNDEMDDFSSPLINSGFDIPPSPANFIKPGKRPLSSMCPSIILDKNKKVHLVVGASGGPKITTSVALAIMSTLWFGYDVKKAVEAPRLHNQLFPGNSTLEKTINQIAVEELIKRNHNVSFETYAFGSVVQAVLHS---DGKWAAASDSRKGGYPAG 546          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Xenopus
Match: ggt1 (gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:448376])

HSP 1 Score: 342.428 bits (877), Expect = 1.734e-109
Identity = 207/526 (39.35%), Postives = 306/526 (58.17%), Query Frame = 3
Query:  384 KGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHM----FENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFN--NTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMK-EREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNT-YGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP--AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            + G+A+D AIA LLC   +N HS GI GG++L  Y     K    + RE AP LA  H+    F    +   GGKSIAV G + GY   H+R GK+ WK LFEP+I +   GFPV   +E+ ++       +NP     L ++   P  G   ++GDI+K PKLA T++ L+ E P A   GSL   ++ ++     II ++DL  Y +  + +P+   LGD  TL +   P SG ++   +N+L  Y F   S ++ E L L YHR++E  +F++AKR+ LGD  + N T  E+++NLTS  Y++ +   ITD T H+  YY+P++  ++ HGT+H S+V+ DG AVS TSTIN  FGS ++ + TGI+YNDEMDDF++   N+ + +P SP NFI+  KRP+SSM P II+DK   V LV+GASGG KI +S     +       ++K++++ PR+HNQLFP    +E+      ++ L++R H V+   Y   +VVQ ++ S      W   +D RK G   G
Sbjct:   13 EAGSAVDAAIACLLCVGLLNAHSMGIGGGAILTIYDSKTGKAEVINARERAP-LAV-HLDNLTFFCSCTPFVGGKSIAVPGEIRGYQLAHKRHGKLPWKRLFEPSIKLAREGFPVGLGLEQGLNRSREAIESNP----LLCEVFCGP-DGHVLQMGDIVKMPKLANTLQTLADEGPDAFYTGSLSKQIVKDIQDAEGIITEEDLRNYTVDFQDDPLQFSLGD-FTLVSPTAPLSGPVLGLIMNILKGYNFSRQSVETDEKLGLTYHRILEAFRFAYAKRTLLGDPMYENMT--EVIKNLTSVYYAEALRQKITDDTTHQPDYYEPTYFIQDSHGTAHLSIVAEDGSAVSATSTINRYFGSKVISNVTGIIYNDEMDDFSSPLINSGFDIPPSPANFIKPGKRPLSSMCPSIILDKNKKVHLVVGASGGPKITTSVALAIMSTLWFGYDVKKAVEAPRLHNQLFPGNSTLEKTINQIAVEELIKRNHNVSFETYAFGSVVQAVLHS---DGKWAAASDSRKGGYPAG 525          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Xenopus
Match: ggt1 (gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:448376])

HSP 1 Score: 334.724 bits (857), Expect = 4.364e-106
Identity = 196/469 (41.79%), Postives = 284/469 (60.55%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVH-GGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFN--NTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMK-EREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNT-YGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKN 1697
            +Y R AVA+DA +C+ +   I+  + G+A+D AIA LLC   +N HS GI GG++L  Y     K    + RE AP  AT  M+ N       GGKSIAV G + GY   H+R GK+ WK LFEP+I +   GFPV   +E+ ++       +NP     L ++   P  G   ++GDI+K PKLA T++ L+ E P A   GSL   ++ ++     II ++DL  Y +  + +P+   LGD  TL +   P SG ++   +N+L  Y F   S ++ E L L YHR++E  +F++AKR+ LGD  + N T  E+++NLTS  Y++ +   ITD T H+  YY+P++  ++ HGT+H S+V+ DG AVS TSTIN  FGS ++ + TGI+YNDEMDDF++   N+ + +P SP NFI+  KRP+SSM P II+DK   V LV+GASGG KI +S    A V +L+K+N
Sbjct:   66 VYARAAVATDAGKCSEIGRDILK-EAGSAVDAAIACLLCVGLLNAHSMGIGGGAILTIYDSKTGKAEVINARERAPLAATEEMYGNNSQLAQIGGKSIAVPGEIRGYQLAHKRHGKLPWKRLFEPSIKLAREGFPVGLGLEQGLNRSREAIESNPL----LCEVFCGP-DGHVLQMGDIVKMPKLANTLQTLADEGPDAFYTGSLSKQIVKDIQDAEGIITEEDLRNYTVDFQDDPLQFSLGD-FTLVSPTAPLSGPVLGLIMNILKGYNFSRQSVETDEKLGLTYHRILEAFRFAYAKRTLLGDPMYENMT--EVIKNLTSVYYAEALRQKITDDTTHQPDYYEPTYFIQDSHGTAHLSIVAEDGSAVSATSTINRYFGSKVISNVTGIIYNDEMDDFSSPLINSGFDIPPSPANFIKPGKRPLSSMCPSIILDKNKKVHLVVGASGGPKITTSVALIA-VEELIKRN 524          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Mouse
Match: Ggt1 (gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc:MGI:95706])

HSP 1 Score: 370.548 bits (950), Expect = 6.225e-120
Identity = 207/547 (37.84%), Postives = 317/547 (57.95%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPIT--------GKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKN-LYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DAK+C+ +   I+  +GG+ +D AIA LLC   +N HS GI GG     Y     K+   + RE+AP+LA   MF N   S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A+D            + RD++             GK  + G+ +  PKLA T++IL+ E   A  NGSL   ++ ++   G I+  +DL  Y+ +  E P+S+ LG D+TLY    P SG ++   LN+L  Y F P S  + E   L YHR++E  +F++AKR+ LGD  F++ +  +++RN++SE Y+ ++ + ITD+ TH  +YY+P    ++D GT+H S VS DG AV+ TSTIN  FGS ++   +GI++NDEMDDF++ N  N + +  SP NFI+  K+P+SSM P II+DK+G V +V+GASGG++I +S     + +     ++K +++ PR+HNQL PN   VE++    +   L  R H       + AVVQ ++++      W   +D RK G
Sbjct:   36 VYSRAAVATDAKRCSEIGRDILQ-EGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVINAREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALD------------KKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLG-DATLYVPSAPLSGPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVS--QVIRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIILDKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKDIDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASG---GWAAASDSRKGG 563          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Mouse
Match: Ggt1 (gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc:MGI:95706])

HSP 1 Score: 370.548 bits (950), Expect = 6.225e-120
Identity = 207/547 (37.84%), Postives = 317/547 (57.95%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPIT--------GKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKN-LYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DAK+C+ +   I+  +GG+ +D AIA LLC   +N HS GI GG     Y     K+   + RE+AP+LA   MF N   S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A+D            + RD++             GK  + G+ +  PKLA T++IL+ E   A  NGSL   ++ ++   G I+  +DL  Y+ +  E P+S+ LG D+TLY    P SG ++   LN+L  Y F P S  + E   L YHR++E  +F++AKR+ LGD  F++ +  +++RN++SE Y+ ++ + ITD+ TH  +YY+P    ++D GT+H S VS DG AV+ TSTIN  FGS ++   +GI++NDEMDDF++ N  N + +  SP NFI+  K+P+SSM P II+DK+G V +V+GASGG++I +S     + +     ++K +++ PR+HNQL PN   VE++    +   L  R H       + AVVQ ++++      W   +D RK G
Sbjct:   36 VYSRAAVATDAKRCSEIGRDILQ-EGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVINAREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALD------------KKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLG-DATLYVPSAPLSGPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVS--QVIRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIILDKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKDIDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASG---GWAAASDSRKGG 563          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Mouse
Match: Ggt5 (gamma-glutamyltransferase 5 [Source:MGI Symbol;Acc:MGI:1346063])

HSP 1 Score: 236.113 bits (601), Expect = 8.979e-69
Identity = 169/550 (30.73%), Postives = 267/550 (48.55%), Query Frame = 3
Query:  309 GIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSV---HGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTN-PPEFKE--LRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDF---LNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSP-NNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            G + R AVA+D+K C+ +   I+  +G + +D AIA L+CT  VN  S G+ GG +   Y  +  K+   + RE  P      +     + +    G + I V G + GY E HRR G++ W  LF+PTI +L  GF V   + +    F NN+   P      LR +  N    +  R  D    P LA T+  ++ E    +  G L   ++ ++   GS++   DL  ++ +  EP+ + LG+  TLY+ PPP+ G +++F LNVL  + F   +       V  YH L+ET+KF+  +R  L D      + N  ++LLR   ++R  ++I        H++S+Y  + V     GTSH S++  DG AV+ TSTIN  FG+ +   +TGI+ N+E+ D          +P+SP        +RP SSM P I+V+K     LVIG +GG  I+S+  QT +    L  ++ E+I  P +H       V  E  F   + K L +RG + +++  P  +  +             +D RK G   G
Sbjct:   39 GAFTRAAVAADSKICSDIGRAILQQRG-SPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQ----FLNNSILRPHLSASTLRQLFFNGT--ETLRSQDPFPWPALANTLETVAKEGAEVLYTGRLGRMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGN-YTLYSPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDG--RGDHHQLSHYNLTGVRGNRMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWRH-----MPTSPITPPPVPGERPPSSMVPSILVNKGQGSKLVIGGAGGELIISAVAQTIMNKLWLGFDLTEAIASPILHVN-SKGHVEYEPKFNQEVQKGLQDRGQIQSQSQRPVFLNAVQAVFQEGPCVYAASDLRKAGKASG 572          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Mouse
Match: Ggt1 (gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc:MGI:95706])

HSP 1 Score: 153.295 bits (386), Expect = 1.068e-41
Identity = 98/284 (34.51%), Postives = 156/284 (54.93%), Query Frame = 3
Query:  504 KIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPIT--------GKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSY 1322
            K+   + RE+AP+LA   MF N   S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A+D            + RD++             GK  + G+ +  PKLA T++IL+ E   A  NGSL   ++ ++   G I+  +DL  Y+ +  E P+S+ LG D+TLY    P SG ++   LN+L   K  P      E   L YHR++E  +F++AKR+ LGD  F++ +  +++RN++SE Y+ ++ + ITD+ TH  +Y
Sbjct:    4 KVEVINAREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALD------------KKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLG-DATLYVPSAPLSGPVLILILNIL---KATP------EQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVS--QVIRNMSSEFYATQLRARITDETTHPAAY 263          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Mouse
Match: Ggt7 (gamma-glutamyltransferase 7 [Source:MGI Symbol;Acc:MGI:1913385])

HSP 1 Score: 157.532 bits (397), Expect = 4.307e-40
Identity = 139/510 (27.25%), Postives = 246/510 (48.24%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNG-SLVNDMIAEMTSGGSIILKDDLLEYKMKEREPI-SVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEG--NVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNK 1823
            I+++ AV +DA  C ++   ++S K G+++D A+A  LC   V  HS G+ GG ++L +     +    D RE AP        +        G  + V G+V G +E H+ +G++ W  +      + + GF V+  +  A+        PP   + R + T    G P   G +++ P LA+ + IL    P A  NG +L  +M+AE    G +I ++D   Y     +P+  V  G    + + PPP +G  +  +LN+L  +    +S  S E  +   H + ET+K + A  S LGD  + ++T  E + ++ S+  +      I+D     +   P +        +   ++ PD   V++ S++N  FGS ++ + +GI+ N +M DF+  N++  +  PS  N+ ++  KRP+S + P ++   EG     L +GA+G ++ LS   Q  +    L +N+ +S+   R+H  L  N + V+  F +  I+ L  RGH V K
Sbjct:  136 IFQQGAVVTDASSCTALGMEVLS-KQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREEALQR-SWDTKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAHALAEQL----PPNASD-RFLDTFLPLGHPPLPGSLLRRPDLAEVLDILGTSGPAAFYNGGNLTLEMVAEAQHAGGVITEEDFSNYSALTEKPVCGVYRG--HLVLSPPPPHTGPALISALNILEGFNL--TSLVSREQAL---HWVAETLKIALALASRLGDPVY-DSTITESMDDMLSKVEAANFRGHISDSQAAPAPLLPVYELDGAPTAAQVLVMGPDDFIVAMVSSLNRPFGSGLL-TPSGILLNSQMLDFSWPNRTANHSAPSLENS-VQPGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDLQSNLLQVDSEFTEEEIEFLEARGHHVEK 628          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. UniProt/SwissProt
Match: sp|P07314|GGT1_RAT (Glutathione hydrolase 1 proenzyme OS=Rattus norvegicus OX=10116 GN=Ggt1 PE=1 SV=4)

HSP 1 Score: 385.571 bits (989), Expect = 7.273e-125
Identity = 216/559 (38.64%), Postives = 325/559 (58.14%), Query Frame = 3
Query:  282 LPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPIT--------GKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP---AVVQGIMKSLNPQYSWQCNADHRKKG 1913
            LPT +     +Y R AVA+DAK+C+ +   ++  +GG+ +D AIA LLC   +N HS GI GG     Y    +K    + REMAP+LA   MF N   S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A+D            + RDI+             GK  + G+ +  PKLA T++IL+ E   A  NGSL   ++ ++   G I+  +DL  Y+ +  E P+S+ LG DSTLY    P SG ++   LN+L  Y F P S  + E   L YHR++E  +F++AKR+ LGD  F++ +  +++RN++SE Y+ ++ + ITD+ TH  +YY+P     +D GT+H S+VS DG AV+ TSTIN  FGS ++   +GI++NDEMDDF++ N +N +G+  SP NFI+  K+P+SSM P IIVDK+G V +V+GASGG++I +S     + +     ++K +++ PR+HNQL PN   VE+N    +   L  R H  +  + P   AVVQ ++++      W   +D RK G
Sbjct:   26 LPTTSGKPDHVYSRAAVATDAKRCSEIGRDMLQ-EGGSVVDAAIASLLCMGLINAHSMGIGGGLFFTIYNSTTRKAEVINAREMAPRLANTSMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLARALD------------KKRDIIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGARAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAEVIEHPMSIGLG-DSTLYVPSAPLSGPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVS--QVIRNMSSEFYATQLRARITDETTHPTAYYEPEFYLPDDGGTAHLSVVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFTNQFGVAPSPANFIKPGKQPLSSMCPSIIVDKDGKVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKNIDQVVTAGLKTRHH--HTEVTPDFIAVVQAVVRTSG---GWAAASDSRKGG 563          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. UniProt/SwissProt
Match: sp|P20735|GGT1_PIG (Glutathione hydrolase 1 proenzyme OS=Sus scrofa OX=9823 GN=GGT1 PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 1.046e-121
Identity = 205/539 (38.03%), Postives = 321/539 (59.55%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKE-REPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVV-NKNLYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DA +C+ +    +   GG+A+D AIA LLC   +N HS GI GG  L  Y    +K    + RE+AP+LA+  MF + + S  GG S+AV G + GY   H+R G++ W  LF+P+I++   GFPV + +  A++   +         L ++      G   R GD++  P+LA+T   L+VE   A  NGSL   ++ ++   G I+  +DL  Y+ +   +P+ + LG D+ LY    P SG ++A  LN+L  Y F  +S ++ E   L YHR++E  +F++AKR+ LGD  F+N T  E++RN++SE ++ ++ + I+D  TH  SYY+P     +D GT+H S+VS DG AVS TSTIN  FGS +    +GI++NDEMDDF++ N +N +G+  SP NFI   K+P+SSM P+IIV ++G V +V+GASGG++I +ST    + +     ++K +++ PR+HNQL PN   +E+    A+  +L  R H + + + +  VVQ I+++ +    W   +D RK G
Sbjct:   36 VYPRAAVAADALRCSEIGRDTLR-DGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEIINAREVAPRLASASMFNSSEQSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIELASQGFPVGKGLAAALERSQDAIK--RHPALCEVFCR--NGNVLREGDLVTMPRLAKTYETLAVEGAQAFYNGSLTAQIVKDIQEAGGIVTAEDLNNYRAELIEQPLRISLG-DAQLYAPNAPLSGPVLALILNILKGYNFSRASVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVNVT--EVVRNMSSEFFADQLRARISDTTTHPDSYYEPEFYTPDDAGTAHLSVVSDDGSAVSATSTINLYFGSKVRSRISGILFNDEMDDFSSPNITNQFGVRPSPANFITPGKQPLSSMCPVIIVGEDGQVRMVVGASGGTQITTSTALAIIHSLWFGYDVKRAVEEPRLHNQLLPNTTTLEKGIDQAVAAALKTRHHYIQDASTFIGVVQAIVRTPS---GWAAASDSRKGG 563          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. UniProt/SwissProt
Match: sp|P19440|GGT1_HUMAN (Glutathione hydrolase 1 proenzyme OS=Homo sapiens OX=9606 GN=GGT1 PE=1 SV=2)

HSP 1 Score: 375.941 bits (964), Expect = 3.816e-121
Identity = 207/541 (38.26%), Postives = 319/541 (58.96%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPK--RVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DAKQC+ +    +   GG+A+D AIA LLC   +N HS GI GG  L  Y    +K    + RE+AP+LA   MF + + S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A++      N     E + +L        K  R G+ +  P+LA T   L++E   A  NGSL   ++ ++ + G I+  +DL  Y+ +  E P+++ LG D  LY    P SG ++A  LN+L  Y F   S +S E   L YHR++E  +F++AKR+ LGD  F++ T  E++RN+TSE ++ ++ + I+ D TH +SYY+P     +D GT+H S+V+ DG AVS TSTIN  FGS +    +GI++N+EMDDF++ + +N +G+P SP NFI+  K+P+SSM P I+V ++G V +V+GA+GG++I ++T    +       ++K +++ PR+HNQL PN   VE+N   A+  +L  R H     + + AVVQ I+++      W   +D RK G
Sbjct:   37 VYTRAAVAADAKQCSKIGRDALR-DGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALE------NKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLG-DVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVT--EVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAG---GWAAASDSRKGG 564          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. UniProt/SwissProt
Match: sp|Q60928|GGT1_MOUSE (Glutathione hydrolase 1 proenzyme OS=Mus musculus OX=10090 GN=Ggt1 PE=1 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 4.354e-119
Identity = 207/547 (37.84%), Postives = 317/547 (57.95%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPIT--------GKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKN-LYPAVVQGIMKSLNPQYSWQCNADHRKKG 1913
            +Y R AVA+DAK+C+ +   I+  +GG+ +D AIA LLC   +N HS GI GG     Y     K+   + RE+AP+LA   MF N   S  GG S+AV G + GY   H+R G++ W  LF+P+I +   GFPV + +  A+D            + RD++             GK  + G+ +  PKLA T++IL+ E   A  NGSL   ++ ++   G I+  +DL  Y+ +  E P+S+ LG D+TLY    P SG ++   LN+L  Y F P S  + E   L YHR++E  +F++AKR+ LGD  F++ +  +++RN++SE Y+ ++ + ITD+ TH  +YY+P    ++D GT+H S VS DG AV+ TSTIN  FGS ++   +GI++NDEMDDF++ N  N + +  SP NFI+  K+P+SSM P II+DK+G V +V+GASGG++I +S     + +     ++K +++ PR+HNQL PN   VE++    +   L  R H       + AVVQ ++++      W   +D RK G
Sbjct:   36 VYSRAAVATDAKRCSEIGRDILQ-EGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVINAREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALD------------KKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLG-DATLYVPSAPLSGPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVS--QVIRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIILDKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKDIDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASG---GWAAASDSRKGG 563          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. UniProt/SwissProt
Match: sp|P0DPU3|TX14A_SCODE (Scoloptoxin SSD14 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 7.254e-115
Identity = 219/550 (39.82%), Postives = 315/550 (57.27%), Query Frame = 3
Query:  300 SFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDS--SVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAI-DYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTM-RILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDF-ATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDGT 1928
            SFMGIY  +AVASDA  CA    +++  KG +A+D AIA LLC    N  S GI GGS ++ Y ++ +     D RE AP  AT  MF+ GD   S  GG SIAV G + G    H R GK++W+TLF+P I + + GFPV   +  A+ +   +  N P    L+ + T+P++G   +  DI+   KL +T+ +I          G +  D+I ++ S G II  +DL  Y+   +      L    TLY++PPPSSG +++F L VL  + F  +S    EN  L YHR +ET+K+++A R+ LGD    N +   ++  LTSE   ++    I D KT+E  +Y  + +   DHGT+H S+VS +GDAV VT+TINY FGS +    TG++ NDEMDDF A +  N YG+P S  NFI   KRP SS  P I V+K G+V + IGASGG++I SS   T++    L +NIKE+ID PR+H+QL P+E+  E  FP+ +++ L   GH       + ++V GI +      +   N D+R+ G  DG+
Sbjct:   37 SFMGIYDESAVASDAVPCAEAGQSMLRQKG-SAVDAAIATLLCIGVYNPQSSGIGGGSFMVIYDRSTRTPEVIDAREEAPAAATQKMFK-GDKKLSSEGGLSIAVPGELRGMALAHERHGKLDWETLFQPAIRLAKEGFPVGSELAMALREQRSHILNSPT---LKAVFTDPVSGDILKENDIVIRTKLGETLEKIAKNGADEFYEGQVAKDLINDIKSFGGIITAEDLKNYQPVLKNATVAHLSGCLTLYSVPPPSSGYILSFILRVLDKFHFSKASVSDIENATLTYHRFLETLKYAYAYRTKLGDERIENVSS--VIAELTSEDVIEKTKQKIEDGKTYEPLHYG-AQLATNDHGTAHISVVSREGDAVVVTTTINYWFGSGLRSPSTGVILNDEMDDFSAPDIQNIYGVPPSKANFIVPGKRPQSSTCPSIFVNKGGDVVMAIGASGGTRITSSVSLTSMRVLWLGRNIKEAIDEPRLHHQLLPDEIEYESKFPNEILEKLKAIGHKTKPAGAFGSLVVGIKRMKGG--TLTANYDYRRGGSVDGS 576          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. TrEMBL
Match: A0A210PJB8 (Gamma-glutamyltranspeptidase 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06888 PE=4 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 1.374e-139
Identity = 234/582 (40.21%), Postives = 346/582 (59.45%), Query Frame = 3
Query:  246 CSPLNSTKKTCPLPTCTD--------------SFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDK----ELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPA-VVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            C+P  S  +  P PT                 S  G Y+  AVA+DA QC+++   I++  GG A+D AIA +LC C  +  SCGI GG  +  Y +++ K +A   REMAP  A   MF +G SS  GG S+ + G + G++E  +  G + W  LF+PTID+   GF +  ++   I         P+   L+ +++NP TG+  + G+++  PKLA T+  ++ E P A  NGSL  D++ ++   G II ++DL  Y    +EP+ + + D  T+++ PPPS G +  F L +L  Y FD  S  S E  VL +HR++E  KF++ KR+ +GD D  N T K    EL+RN+TS  YS+ I   ITD +TH+  +Y P+     D GTSH S+++P+GDAVS+TST+N  FGS  +GS+TGI++NDEMDDF+T N  N +G+P+SP NFI+ YKRP+SSM P II D  G+V LVIGA+GG+KI +ST  T++       ++KE+ID  R+H+QL P E+ VE  F + ++  L ++GH +  N     +VQG++K  N + S    +D+RKK   DG
Sbjct:   52 CAPTASPARATPQPTRVPTQAPPTTTTDTPTLSIDGTYRYGAVAADAAQCSTIGTDIMA-SGGTAVDTAIAAMLCACVHSLQSCGIGGGHFMTVYDRSQGKSYAVMGREMAPGAANATMFLSGVSSREGGLSVGIPGEIKGFWEAWKLAGNLPWAELFQPTIDLCRNGFIIGSSLGFHITA--QQKYYPDHPNLKAMVSNPQTGELLKEGEVMYLPKLAATLEAIAREGPDAFYNGSLTADIVKDIQEAGGIITEEDLRMYTAAVKEPLEITIHDRYTVHSPPPPSGGAVYEFILGILDGYNFDEDSLSSREKKVLAWHRIVEAFKFAYGKRTQIGDSDVENATFKMELEELIRNMTSAAYSESIRQQITDDRTHDTPFYGPTFYVNNDAGTSHLSVLTPNGDAVSITSTVNLHFGSKEVGSRTGILFNDEMDDFSTPNTVNYFGVPASPANFIKPYKRPLSSMCPSIITDSNGDVKLVIGAAGGTKITTSTALTSIETLWFGMSMKEAIDHRRLHHQLLPKEIAVEIGFDEDVLAGLRQKGHNMTMNASAGCIVQGVLK--NAEKSISGCSDYRKKASPDG 628          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. TrEMBL
Match: A0A267GH36 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028621g1 PE=4 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 1.627e-136
Identity = 232/566 (40.99%), Postives = 345/566 (60.95%), Query Frame = 3
Query:  267 KKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFEN-----GDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNT-NPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDS-TLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCEN-LVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEV---VVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            ++ C     +DS   IY+  AV+SD+  C+++ + +++V GGNA+D  +A +LC    NFHS GI GGS L+YY +  K   AFD RE AP  A   M+ +      ++S++GG +I V G VAG   +H   G++ W+++ EP   +L  G  VS  + +AI   +    +   FK L++ + NP T KP R G+++    +A TM  ++ +P +  NGSL +D++ E+ + G  I KDDL++Y+ +   P++  L     TLY+LPPPSSG +++  L ++  Y  D +   S ++  V F HRL+E+ KF++AKRS LGD  F+N T  EL+ N+TS  Y+ E+ S ITD  TH+V+YY P    KED GT+H SLV  DG+AV+VTSTIN  FGS + G KTGIVYN+EMDDF+  N++N YGLP SP NFI   KRPMSSM+P+I+V+ +G+V  V GASGGS+I ++   T      L + +K ++D  R+H+QL PN +     + + P+++ + L ++GH V      +VV+GI +    Q   Q NAD RK     G
Sbjct:   72 RRNC----VSDSGTDIYQYNAVSSDSAVCSTIGDHVLNVLGGNAMDAGVATVLCVGVSNFHSAGIGGGSFLVYYNRTSKTATAFDFRESAPAAAYRDMYNSTSGLPSNASLYGGLAIGVPGEVAGLAAVHAAHGRLPWRSVVEPVSRVLREGQRVSRPLADAIATVYPRVPDVAPFKVLKNWMVNPNTNKPYRAGELLVDHAMASTMDKIASDPQSFYNGSLADDILQEVRAAGGNITKDDLMKYQTRRLTPLTATLPSKGLTLYSLPPPSSGAVLSLILGIMDGYAGDSAQARSTQDGYVKFLHRLVESFKFAYAKRSGLGDAAFVNVT--ELVANMTSSSYASELRSRITDDATHDVNYYGPMFEWKEDSGTTHVSLVDSDGNAVAVTSTINTYFGSLVRGEKTGIVYNNEMDDFSQPNRTNYYGLPPSPTNFIAANKRPMSSMAPMIVVNADGHVQFVSGASGGSRITTAIAYTLARQLYLNETVKAAVDSYRLHHQLLPNVLNYNPAKCDPPESIKQRLRQKGHKVQPFSSTSVVEGIQRLSGGQL--QANADFRKPSKTGG 629          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. TrEMBL
Match: K1R1G5 (Gamma-glutamyltranspeptidase 1 OS=Crassostrea gigas OX=29159 GN=CGI_10002625 PE=4 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 4.159e-134
Identity = 229/553 (41.41%), Postives = 326/553 (58.95%), Query Frame = 3
Query:  300 SFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGD-SSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRD--ILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDID-----FLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP-AVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            S  G Y+  AV+SD   CA +   I+  + G+ +D  IA +LC C  N HSCGI GG  +  Y +     +    REMAP  A+  MF   D SS  GG SI V G + G YE  +  GK+ WK LF+PTI                             K LRD   LTNP TG+P   G+ IK P LA+T   ++ +P+A+ NGSLV+D++A++   G II K DL  Y    +EP+ V+L D+ST++T PPPSSG + A  LN+   Y  +P S  + E   L +HR++E MKF++AKRS LGD D     F +  D EL++N+TS  Y+  + S I+ D TH+  YY P+   +   GTSH ++++P+GDA S+TSTIN  FGS ++G +TGI +N+EMDDF+T N +N +G+P+S  NFI+  KRP+SSM P I+VD +G+V LV+GASGG+KI +ST   ++     K  IK++ID  R+H+QL P  + VE+ F   +I  L   GH +  +    ++VQGI++      +   NAD+RK+G+ DG
Sbjct:  101 SIEGHYRYAAVSSDTGSCAQIGIEILGRRQGSVVDATIATILCQCVENSHSCGIGGGHFMTIYNRENNTAYTILAREMAPGAASEDMFVPSDKSSTEGGLSIGVPGEIKGLYEAWKIGGKLPWKDLFQPTI-----------------------------KRLRDGLTLTNPQTGRPYNQGETIKMPLLAKTFEAIADDPHALYNGSLVDDVVADIQEAGGIITKQDLQNYVAVIKEPLVVKLNDNSTIFTPPPPSSGAVYAMILNIADKYGLNPDSVSTTEKSTLTWHRIVEAMKFAYAKRSSLGDPDKESQSFKDGID-ELVKNMTSSSYADYVRSRISDDSTHDTMYYGPTFYDQSKTGTSHLAVLAPNGDAASITSTINLYFGSKVVGKRTGIFFNNEMDDFSTPNTTNYFGVPASAANFIKPGKRPLSSMCPSIVVDSDGHVKLVVGASGGTKITTSTALVSIETLWFKYGIKKAIDHKRLHHQLLPAYITVEEGFDPQVINGLRRIGHNITMSASAGSIVQGILQLEEGMIT--ANADYRKRGVPDG 621          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. TrEMBL
Match: A0A267G2M4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028621g2 PE=4 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 1.721e-130
Identity = 229/560 (40.89%), Postives = 342/560 (61.07%), Query Frame = 3
Query:  267 KKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFEN-----GDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNT-NPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDS-TLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCEN-LVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEV---VVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRK 1907
            ++ C     +DS   IY+  AV+SD+  C+++ + +++V GGNA+D  +A +LC    NFHS GI GGS L+YY +  K   AFD RE AP  A   M+        ++S++GG +I V G VAG    H   G++ W+++ EP   +L  G  VS  + +AI   +    +   FK L++ + NP T KP R G+++    +A TM  ++ +P +  NGSL +D++ E+ + G  I KDDL++Y+ +   P++  L     TLY+LPPPSSG +++  L ++  Y  D +   S ++  V F HRL+E+ KF++AKRS LGD  F++ T  EL+ N+TS  Y+ E+ S ITD  TH+++YY P    KED GT+H SLV  DG+AV+VTSTIN  FGS + G KTGIVYN+EMDDF+  N++N YGLP SP NFI   KRPMSSM+P+I+V  +G+V  V GASGGS+I ++   T      L + +K ++D  R+H+QL PN +     + + P+++ + L ++GH V      +VV+GI +  + Q   Q NAD RK
Sbjct:   54 RRNC----VSDSGTDIYQYNAVSSDSAVCSTIGDHVLNVLGGNAMDAGVATVLCVGVSNFHSAGIGGGSFLVYYNRTSKTATAFDFRESAPAAAYRDMYNTTSGLPSNASLYGGLAIGVPGEVAGLAAAHAAHGRLPWRSVVEPVSRVLREGQRVSRPLADAIATVYPRVPDVAPFKVLKNWMVNPNTNKPYRAGELLVDHAMASTMDKIASDPQSFYNGSLADDILQEVRAAGGNITKDDLMKYQTRRLTPLTATLPSKGLTLYSLPPPSSGAVLSLILGIMDGYAGDSAQARSTQDGYVNFLHRLVESFKFAYAKRSGLGDAAFVDVT--ELVANMTSSSYASELRSRITDDATHDINYYGPMFEWKEDSGTTHVSLVDSDGNAVAVTSTINTYFGSLVRGEKTGIVYNNEMDDFSQPNRTNYYGLPPSPTNFIAANKRPMSSMAPVIVVSADGDVKFVSGASGGSRITTAIAYTLARQLYLNETVKAAVDSYRLHHQLLPNVLNYNPAKCDPPESIKQRLRQKGHKVQPFSSTSVVEGIQRLSSGQL--QANADFRK 605          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. TrEMBL
Match: A0A210PFF9 (Gamma-glutamyltranspeptidase 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05975 PE=4 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 9.691e-130
Identity = 229/565 (40.53%), Postives = 341/565 (60.35%), Query Frame = 3
Query:  270 KTCPLPTCTDSFM-----GIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKE----LLRNLTSERYSKEIMSLI-TDKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +T  +PT ++ F+     G Y+  AVASDA  C++V   I++ + G+A+D AIA LLC C  N HSCGI GG  +  Y +     +    REMAP  A  +M+    SS  GG ++ + G + G Y   +  GK+ WKTLF+PTI +L  G PV+  +  AI    N    P  + LR +LTNP TG   + G+I+K P LA T   ++ E P A  NGSL  +++ ++   G II + DLL++    +EP+ +RL D+S++Y+ PPPSSG +    LN++ ++     S  + +  +L +HR+IE  KFS+AKRS LGD D  ++  +     LL+N+TS+ ++  + S I  D+TH   YY P+        T+H S+++P+GDAVSVTSTIN  FGS ++GS+TGI++N+EMDDF+T N +N++G+P+S  NFI+  KRP+SSM P II D  G V LV+GASGG+KI +ST    +   +   +IK++ID  R+H+QL P E+ VE+ FP+ ++  L   GH +   +   +VVQGI++      +  C  D RK G  DG
Sbjct:   69 QTSTVPTSSNVFVSSSKEGFYRYGAVASDAGICSTVGTDIMARQSGSAVDAAIAALLCQCVQNLHSCGIGGGHFMTVYNRENNTAYTIIAREMAPSAANENMYVGNQSSTEGGMTVGIPGEIKGMYTAWKLGGKLPWKTLFQPTIRLLRDGMPVNSALALAIQR--NGRFYPRQENLRQLLTNPTTGFFFKEGEIMKLPTLAATFTTIADEGPDAFYNGSLSQNIVKDIQDAGGIITEKDLLDFTAVVKEPLVIRLTDNSSVYSPPPPSSGAVYEMILNIVDEFGMSNDSISTPQKEILAWHRIIEAFKFSYAKRSSLGDGDGEDDAFRTELNVLLKNMTSKSFAAYVRSQIDDDRTHNTMYYGPTFYDVTKTSTAHLSVLAPNGDAVSVTSTINLHFGSKVVGSRTGIIFNNEMDDFSTPNTTNSFGVPASEANFIKPLKRPLSSMCPSIITDSNGVVRLVVGASGGTKITTSTAMVTIETLMFGLDIKQAIDHRRIHHQLLPKELAVEKGFPEDILDGLRSIGHNITLTDTAGSVVQGILQRHEGDITANC--DFRKSGYPDG 629          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Cavefish
Match: si:ch73-59p9.2 (gamma-glutamyltranspeptidase 1 [Source:NCBI gene;Acc:103031919])

HSP 1 Score: 375.17 bits (962), Expect = 7.631e-122
Identity = 219/564 (38.83%), Postives = 328/564 (58.16%), Query Frame = 3
Query:  255 LNSTKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDS-SVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP-AVVQGIMKSLNPQYSWQC-NADHRKKGICDG 1925
            L    K  P+P+  D F   Y + AVA+DA +C+ +   I+  + G+A+D +IA LLC   +N HS GI GG     Y  +  K+   D RE AP  AT  MF N    S  GG SIA+ G + GY   HRR G++ WK LFEP+I +   GFP+   +  AI+   N  +      + ++  +      K    I++ P+LA T + ++ E P    NG++   ++ ++ + G II  +DLLEYK +    P+ + +G+  T++    PSSG ++A  LN++  Y F   S  + E   L YHR++E  +F++AKRS LGD  +LN TD  L+ N+TS+ ++  I S ITD T H  +YY+P +   + HGT+H S+++ DG AV+ TSTIN  FGS +M   TGI++NDEMDDF++   +N +G+P SPNNFI+  KRP+SSM P II DK   V +V+GASGG+KI ++T    + +     ++K+++  PRVHNQL PN+ VVEQNF  ++++ L ++ H+      P AVVQ +++    Q    C  +D RK G   G
Sbjct:   26 LGVGNKRTPIPS--DHF---YSKAAVAADAGKCSEIGRDILK-RNGSAVDASIAALLCVGLLNAHSMGIGGGLFFTIYNASTGKVETIDARETAPMNATEDMFGNNTQLSRKGGLSIAIPGEIRGYEMAHRRHGRLPWKELFEPSITLARKGFPIGRALANAIEK--NKESIQGDLAMCEVFCDSDKNILKE-NAIVRFPRLADTYQKIAEEGPDVFYNGTMAQTIVDDIQAAGGIITLEDLLEYKPVLNESPLKLHVGE-YTMHVPDAPSSGPVLALILNIVDGYNFSDRSVSTAEKKTLTYHRIVEAFRFAYAKRSRLGDPRYLNITD--LIHNMTSDYFADNIRSKITDDTTHPDNYYEPEYFVPDSHGTAHLSVIAEDGSAVAATSTINLYFGSKVMSRSTGIIFNDEMDDFSSPYITNGFGIPPSPNNFIQPGKRPLSSMCPTIIFDKHNKVKMVVGASGGTKITTATALVILNSLFFNYDLKKAVTEPRVHNQLNPNKTVVEQNFEQSVLEGLAQKNHITEFLRTPGAVVQAVVR----QGDRLCAESDPRKGGYPAG 573          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Cavefish
Match: ggt1b (gamma-glutamyltranspeptidase 1-like [Source:NCBI gene;Acc:103029848])

HSP 1 Score: 360.918 bits (925), Expect = 2.662e-116
Identity = 216/544 (39.71%), Postives = 313/544 (57.54%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMR-ILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNK-NLYPAVVQGIMKSLNPQYSW-QCNADHRKKGICDG 1925
            Y   AVA+DA  C+ +   ++  KGG+A+D AIAGLLC   +N HS GI GG  L  Y     ++   D RE AP  A+  MF  N D S+ GG +IAV G + GY   H+R GK+ W+ LF P+I +   GFP+ + +  AI  + N       K L  +  +  +G   +  + I+  KLA T + I    P A   G++  ++I ++ +   II  +DL  Y  +    P+   +GD  T+YT   PSSG ++ F LN+L+ + F  +S  S E  +L  HR++E  KF++AKRS LGD  FLN T  E + N+TS+ +++ I   ITD  T + SYY+P     +DHGTSH S+++ DG AV+ TSTIN  FGS +M + TGI+ N+EMDDF++   +N++G+P SPNNFI+ +KRPMSSM P I+ DK   V +V+G SGG+KI +S  Q  + +     ++K S+  PRVHNQL PN  +VE  F  A+   L ++ HV+       AVVQ I +    +  W +  +D RK G   G
Sbjct:   39 YSLAAVAADAGTCSEIGRDVLQ-KGGSAVDAAIAGLLCAGLMNAHSAGIGGGLFLTIYNAKTGRVETIDARETAPANASKDMFGNNTDLSLTGGLAIAVPGEIRGYELAHKRHGKLPWRELFLPSIKLARDGFPLGKALAGAI--YSNRNIIRNDKTLCSVFCDE-SGAILKENNTIRFTKLADTFQEIADKGPSAFYEGTIAENLIKDIRNASGIITLEDLQSYTPVLNESPLQAYVGD-FTMYTPNAPSSGPILTFILNILSGFGFSSNSVSSTEKKILSTHRIVEAFKFAYAKRSVLGDPSFLNIT--EFIHNITSKSFAEGIRHKITDDSTQQESYYEPEFFVPDDHGTSHISVLAEDGSAVAATSTINRYFGSKVMSASTGIILNNEMDDFSSPLITNSFGVPPSPNNFIKPHKRPMSSMCPAILFDKNHKVKMVVGGSGGTKITTSVAQVILNSLSFNYDLKRSVVEPRVHNQLSPNITLVEAGFDQAVADGLAQKNHVIEVLTSTGAVVQAIER----RGMWIEAVSDPRKGGYAAG 571          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Cavefish
Match: ggt1b (gamma-glutamyltranspeptidase 1-like [Source:NCBI gene;Acc:103029848])

HSP 1 Score: 312.383 bits (799), Expect = 2.524e-98
Identity = 197/543 (36.28%), Postives = 285/543 (52.49%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMR-ILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNK-NLYPAVVQGIMKSLNPQYSW-QCNADHRKKGICDG 1925
            Y   AVA+DA  C+ +   ++  KGG+A+D AIAGLLC   +N HS GI GG  L  Y     ++   D RE AP  A+  MF  N D S+ GG +IAV G + GY   H+R GK+ W+ LF P+I +   GFP+ + +  AI  + N       K L  +  +  +G   +  + I+  KLA T + I    P A   G++  ++I ++ +                                                    + F  +S  S E  +L  HR++E  KF++AKRS LGD  FLN T  E + N+TS+ +++ I   ITD  T + SYY+P     +DHGTSH S+++ DG AV+ TSTIN  FGS +M + TGI+ N+EMDDF++   +N++G+P SPNNFI+ +KRPMSSM P I+ DK   V +V+G SGG+KI +S  Q  + +     ++K S+  PRVHNQL PN  +VE  F  A+   L ++ HV+       AVVQ I +    +  W +  +D RK G   G
Sbjct:   39 YSLAAVAADAGTCSEIGRDVLQ-KGGSAVDAAIAGLLCAGLMNAHSAGIGGGLFLTIYNAKTGRVETIDARETAPANASKDMFGNNTDLSLTGGLAIAVPGEIRGYELAHKRHGKLPWRELFLPSIKLARDGFPLGKALAGAI--YSNRNIIRNDKTLCSVFCDE-SGAILKENNTIRFTKLADTFQEIADKGPSAFYEGTIAENLIKDIRN--------------------------------------------------ASFGFSSNSVSSTEKKILSTHRIVEAFKFAYAKRSVLGDPSFLNIT--EFIHNITSKSFAEGIRHKITDDSTQQESYYEPEFFVPDDHGTSHISVLAEDGSAVAATSTINRYFGSKVMSASTGIILNNEMDDFSSPLITNSFGVPPSPNNFIKPHKRPMSSMCPAILFDKNHKVKMVVGGSGGTKITTSVAQVILNSLSFNYDLKRSVVEPRVHNQLSPNITLVEAGFDQAVADGLAQKNHVIEVLTSTGAVVQAIER----RGMWIEAVSDPRKGGYAAG 521          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Cavefish
Match: ggt5a (gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-GENE-080226-1])

HSP 1 Score: 243.432 bits (620), Expect = 4.477e-71
Identity = 165/509 (32.42%), Postives = 268/509 (52.65%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVH---GGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTM-RILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKED-HGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNK 1823
            +++ AVA+D+  C+ +  TI+  +GG+A+DGAIA L+CT  +N  S GI GG +    ++   K+   + RE AP+   P +     SS     G + I V G + GY   HR +G++ W  LF+PTI +   GF +  T+   I  FFN T+      ++++ T+   GK  + G+I+K  KLA+T+ RI +  P     G     +I+++   G  +  +DL  +++ E E  +V L  D T+Y  PPP+ G +++F LNV+  Y    +S  + E  VL YHR +E  KF+   +  + D    + ++   +     + ++  I  +I+ + TH+  YY  +  P  D  GT+H S++  +G AVSVTSTIN++FGS +   KTGI+ N+E+ DF            SP       ++P SS +P+I+  K     +VIG SGGS I +    T +      KN+++SI  P V+     N +  E +F   +I++L E GH V +
Sbjct:  117 FRKAAVAADSLTCSRIGRTILQ-EGGSAVDGAIAALICTSIINPQSMGIGGGVIFTIMER-NGKVKIINARETAPKQVKPDLLSECGSSTQQTSGPQWIGVPGEIRGYERAHRLYGRLPWARLFQPTIKLATEGFELP-TVLSRILPFFNGTSL-----MKELFTDA-EGKMLKEGNIVKFEKLAETLKRIANKGPDEFYTGETATALISDVQEAGGTLTLEDLKSFEVSESEAWTVPL-RDYTMYFPPPPAGGAVLSFILNVMQGYNLRRTSLQNKEERVLTYHRYVEACKFANGLKKFMRDPKISSASEASAM---IEDDFADHIRKMISSNTTHDAQYYNVT--PGLDTQGTTHVSVLDENGMAVSVTSTINHIFGSRVYSPKTGIILNNELSDFCGKTEQI-----SPG------EQPPSSQAPVILHSKANKHLVVIGGSGGSMITTGMAMTLMNYLWFGKNLEDSISAPVVYVD-GKNALKFEPDFDKDVIEALRELGHTVEE 598          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Cavefish
Match: ggt5a (gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-GENE-080226-1])

HSP 1 Score: 235.728 bits (600), Expect = 1.460e-68
Identity = 156/478 (32.64%), Postives = 253/478 (52.93%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVH---GGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTM-RILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKED-HGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVH 1730
            +++ AVA+D+  C+ +  TI+  +GG+A+DGAIA L+CT  +N  S GI GG +    ++   K+   + RE AP+   P +     SS     G + I V G + GY   HR +G++ W  LF+PTI +   GF +  T+   I  FFN T+      ++++ T+   GK  + G+I+K  KLA+T+ RI +  P     G     +I+++   G  +  +DL  +++ E E  +V L  D T+Y  PPP+ G +++F LNV+  Y    +S  + E  VL YHR +E  KF+   +  + D    + ++   +     + ++  I  +I+ + TH+  YY  +  P  D  GT+H S++  +G AVSVTSTIN++FGS +   KTGI+ N+E+ DF            SP       ++P SS +P+I+  K     +VIG SGGS I +    T +      KN+++SI  P V+
Sbjct:  117 FRKAAVAADSLTCSRIGRTILQ-EGGSAVDGAIAALICTSIINPQSMGIGGGVIFTIMER-NGKVKIINARETAPKQVKPDLLSECGSSTQQTSGPQWIGVPGEIRGYERAHRLYGRLPWARLFQPTIKLATEGFELP-TVLSRILPFFNGTSL-----MKELFTDA-EGKMLKEGNIVKFEKLAETLKRIANKGPDEFYTGETATALISDVQEAGGTLTLEDLKSFEVSESEAWTVPL-RDYTMYFPPPPAGGAVLSFILNVMQGYNLRRTSLQNKEERVLTYHRYVEACKFANGLKKFMRDPKISSASEASAM---IEDDFADHIRKMISSNTTHDAQYYNVT--PGLDTQGTTHVSVLDENGMAVSVTSTINHIFGSRVYSPKTGIILNNELSDFCGKTEQI-----SPG------EQPPSSQAPVILHSKANKHLVVIGGSGGSMITTGMAMTLMNYLWFGKNLEDSISAPVVY 568          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005677.1 (pep scaffold:Pmarinus_7.0:GL478518:21750:45518:-1 gene:ENSPMAG00000005105.1 transcript:ENSPMAT00000005677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.546 bits (815), Expect = 3.769e-101
Identity = 191/536 (35.63%), Postives = 302/536 (56.34%), Query Frame = 3
Query:  330 VASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHG--GKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKERE-PISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKS-NTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPA--VVQGIMKSLNPQYSWQCNADHRKKG 1913
            V +D+  C+ +   ++  +GG+A+D AI+ LLC      HS GI GG  L  Y  +   + A + RE AP  AT  MF  GD+S       +IAV G + GY   HRR G++ W  LF+P+I +   GF ++  +  A+    +         L D+  +   GK  +V   ++  +LA+T+++++ E P A  +GSL   ++ ++ + G II  +DL  Y+ +  E P+ V +G    +YT PPP+SG +++  LN+L  + F   S  + +   L YHR++E  KF+FAKRS L D  F +  D  L+RNLTSE Y++ +   I+ D TH   +Y+      ED G SH S+V+ DG AVS TS+IN  FGS +    TGI++N+ MD F++  + NT G+  SP N+I+  KRP+SSM P +++D++  V +V+GA+GG +I++S     +      ++IK ++  PR+H+QL PN+V+VE  F  A++  L  R H V      A  VVQ I++  +    W   +D+R+ G
Sbjct:    6 VTTDSPLCSDIGRDVLK-EGGSAVDAAISALLCVGLTCAHSTGIGGGLFLTIYNASTGTVEAINAREGAPLNATQDMF-GGDASSSRIVNLAIAVPGEIRGYALAHRRHGRLPWARLFQPSIALARNGFRMTGPLARAV--MEHRQAIEASPSLCDVFCDG-HGKILQVNSTVRDERLAETLQVIAAEGPDAFYDGSLSKSIVDDIQAEGGIIALEDLRAYEPELAEIPLLVEVGR-YRVYTPPPPASGAVLSLILNILEGFHFSADSVSTAKEKALTYHRIVEAFKFAFAKRSELADRRFADVRD--LVRNLTSEDYAQALRWKISGDSTHPARFYESMFSHAEDAGASHVSVVAGDGSAVSATSSINLGFGSLVRSRTTGIIFNNAMDSFSSPFTINTSGVQPSPANYIQPGKRPLSSMCPAVVMDEDAQVKMVVGAAGGIRIVTSAALAIINTLWFGQDIKAAVSAPRLHHQLLPNKVIVEDGFDQAVVDGLRCRNHEVALQSPAADSVVQAIVRVGS---HWCAESDYRRGG 530          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005618.1 (pep scaffold:Pmarinus_7.0:GL478518:2729:14084:1 gene:ENSPMAG00000005075.1 transcript:ENSPMAT00000005618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.705 bits (561), Expect = 3.079e-65
Identity = 146/448 (32.59%), Postives = 235/448 (52.46%), Query Frame = 3
Query:  597 SIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPY-AMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPN-NFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPA--VVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            +I V G +  Y   HRR G++ W  L EP+I +   G PVS  + E +             E+  +   P  G  K+  DI++ P LA+T+  ++ E   A  NGSL   ++ ++ + G ++  +DL  Y  +  +P+   +G   TL T  PP  G ++   +N L+ +          E   L +H ++E +KF++A+   L D +F N   K  ++ L S  Y +++  LI  D+THE S+Y P+   K  +GTSH S+++ DG AVSVTS+IN+ FGS ++ ++TGI+ ND+M DF+  +      P  P  NFIE +KRP+S MSP +++D+   V +VIGASGGSKI ++  Q       L  ++  ++  PR++       +  E  F +A IK L+E+   V    +P+  VVQ I +      +    +D RK  + DG
Sbjct:    2 AIGVPGELRAYALAHRRHGRLPWHKLLEPSIRMARDGVPVSRELAEKLAKIDERVKFKNDSEICALFCWP-NGTVKKENDIVRYPALARTLETIAREGEDAFYNGSLATLLVEDVRAKGGVLSLEDLRSYHAEIVKPLIFPVGK-YTLVTPAPPGGGAILTSIVNALSAFHMQRREMQDTEGRALDFHHMVEVLKFAYAQHRELADPEFENMAQK--VQELMSPAYGEKLRRLIQHDRTHERSFYTPTEPDKPHYGTSHLSVLAEDGGAVSVTSSINFYFGSQVVSNRTGIILNDQMSDFSCPQ------PGKPAFNFIEPWKRPISFMSPSLLLDEHRMVKMVIGASGGSKITAAIAQVLANVLWLGYDLPNAVCQPRLYINQEDFFLQNETGFNEA-IKLLLEKKSHVFTQTFPSVGVVQAIWRE---GRAITAVSDARKYSMADG 435          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006210.1 (pep scaffold:Pmarinus_7.0:GL492264:524:3304:1 gene:ENSPMAG00000005615.1 transcript:ENSPMAT00000006210.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.333 bits (451), Expect = 2.353e-52
Identity = 94/188 (50.00%), Postives = 128/188 (68.09%), Query Frame = 3
Query: 1101 YKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSST 1658
            YK    S D  E   L YHR++E  KF++AKR+ LGD +F+N TD  L++N+TS+ +++ +   I D  TH V YY+P     ED GT+H S+V PDG AVSVTSTIN+ FGS +    TGI++N+EMDDF++    N +G+P SP NFI   KRP+SSM P +IVDK+  V L++GASGG+KI + T
Sbjct:    2 YKMTSRSLDE-EQKSLTYHRIVEAFKFAYAKRTELGDPNFVNLTD--LMKNVTSKDFAEALRQKIWDNATHGVEYYEPMFYVPEDSGTAHLSVVGPDGSAVSVTSTINFYFGSKVRSPSTGIIFNNEMDDFSSPYIVNGFGVPPSPANFIRPGKRPLSSMCPTLIVDKQSRVKLIVGASGGTKITTGT 186          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001319.1 (pep scaffold:Pmarinus_7.0:GL476337:669740:697940:-1 gene:ENSPMAG00000001168.1 transcript:ENSPMAT00000001319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 1.791e-30
Identity = 138/530 (26.04%), Postives = 236/530 (44.53%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAP--QLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITG---KPKRVGDIIKTPKLAQTMRILSVEPYAMKNG-SLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGD--DSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEG--NVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLN 1868
            +Y    V SD + C+ +   I+  K G+++D A+A  LC   V+ HS G+ GG ++L +   E    A D   +AP   L   ++  N       G S+ V G++ G Y+ H+ +G++ W  +      + + GF V+  ++      F    P +F   R   T   +G     +R  +++   K     R ++  P     G ++    +A +     ++L    L+      +P S   GD     L + PPP +G  +  +L ++  Y     ST    NL   YH L E +KFSF + S LGD   ++ +  E ++N+ S+  +  I  LI D  T     Y    +       S   ++ PD   V++TS+++  FGS +M + +GI+ N  M DF T+ S +    +   N +   +RP++   P I     G     L +G S G    SS  Q  +     ++N+ +S+   R+H +     V+VE  FP+A    L  RGH V ++     V  +++ LN
Sbjct:  136 VYYNGTVVSDVRLCSDIGTDILH-KRGSSVDAAVATALCAGIVHPHSSGLGGGGVMLVHNIKENTTRAIDFWAVAPAEDLLFNNLNANLTLLTKAGLSVGVPGMIKGLYQAHQLYGRMPWGEVVAAAARVAKDGFNVTTELDRG----FVIGVPWDFSCRRIQFTFTNSGLYFSVERRAELLSGQK-----RNVAKMPEEWWGGCNITFPFVATVPMHSGLMLGSIFLQCIHMVHKPDS---GDVAGHLLLSAPPPHAGASLLLALGIMEGYNL---STHDDGNLT--YHWLTEALKFSFIQGSTLGD-PTVDASVAERMQNILSKLEAGRIRELINDTWTLPADSYGARQLIDSYGDASSVLVMGPDDLIVAMTSSLSGAFGSRVM-TPSGILLNSAMLDF-TDPSQSPNPTAGQANVMGPGRRPITWALPTIARPLRGLCGTYLSLGGSKGPADTSSLAQIIIDLFSFRRNVTDSVLLARLHPEPNLWRVLVEDGFPEAEASFLRSRGHNVVRSGGSLGVTHVVRRLN 644          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Yeast
Match: ECM38 (Gamma-glutamyltranspeptidase; major glutathione-degrading enzyme; involved in detoxification of electrophilic xenobiotics; expression induced mainly by nitrogen starvation [Source:SGD;Acc:S000004290])

HSP 1 Score: 235.728 bits (600), Expect = 6.753e-69
Identity = 181/563 (32.15%), Postives = 291/563 (51.69%), Query Frame = 3
Query:  327 AVASDAKQCA--SVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGD-SSVHGGKSIAVTGLVAGYYEI--HRRFGKINWKTLFEPTIDILEMGFPVSE----TIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRIL----SVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRL--------GDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD------KTHE-VSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFP---DALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADH-RKKGI 1916
            A++SD + C+  +++  ++   G NA D A+   LC   VNF + GI GG  +++  K ++   + D RE AP  +   MFEN    S  GG ++ V G + G Y +   R  G+++W+ L EP   +  +G+ + E    T+E   D F         KE    + N       + GD IK P L+  +  L    SV P+   +  +   MI  +     I+   D+  Y +   +P+S+++         +D T+ T    SSG  +  +L ++ +++         E     YH L+E+MK+  + RS LGD +      K +   L  E   K + S+  +      KT E  + Y P++     HGT+HFS+V   G+AVS+T+TIN LFGS +   KTG+++N+EMDDFA  NKSN++ L  S  NF E  KRP+SS +P I++ + G   LV+GASGGS+I +S +QT V        I E+I +PR+H+QL P+ + +E +FP    A++ +L E G+ + K ++P  V   ++  N +  W   +D+ RK+GI
Sbjct:  109 AISSDLEVCSNLTINEVLLKFPGSNAADAAVTQALCKGMVNFFNSGIGGGGYVVFSGKDDEDHLSIDFREKAPMDSHKFMFENCSLCSKIGGLAVGVPGELMGLYRLFKERGSGQVDWRDLIEPVAKLGSVGWQIGEALGATLELYEDVFLT------LKEDWSFVLNSTHDGVLKEGDWIKRPALSNMLMELAKNGSVAPFYDPDHWIAKSMIDTVAKYNGIMNLQDVSSYDVHVTKPLSMKIRKGANFIPDNDMTVLTSSGSSSGAALLAALRIMDNFQNQEGGDYEKETT---YH-LLESMKWMASARSRLGDFEG-EALPKHIEEVLDPEWALKAVKSIKRNSQDGNFKTLENWTLYDPAYDINNPHGTAHFSIVDSHGNAVSLTTTINLLFGSLVHDPKTGVIFNNEMDDFAQFNKSNSFELAPSIYNFPEPGKRPLSSTAPTIVLSELGIPDLVVGASGGSRITTSVLQTIVRTYWYNMPILETIAYPRIHHQLLPDRIELE-SFPMIGKAVLSTLKEMGYTM-KEVFPKSVVNAIR--NVRGEWHAVSDYWRKRGI 656          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Nematostella
Match: EDO44572 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVG4])

HSP 1 Score: 330.102 bits (845), Expect = 8.450e-105
Identity = 203/564 (35.99%), Postives = 305/564 (54.08%), Query Frame = 3
Query:  270 KTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMF-ENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGF----PVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMT--SGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTD--SCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTY-GLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVV-EQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQ-YSWQCNADHRKKGICDG 1925
            K  P+P   DS  G Y R AVA+DAK C+++   I+  KG +A+D AIA +LC   +N HS G+ GG  +L Y K      A D RE AP  A   MF +    +  GG ++ V G V GYY+   ++G++ W+ + +P IDI + GF    PV +   E  D   NN        LR++L        K     I   K A T++ +   P++  NG+L  ++I ++       I+  DDL  Y  + R+ +S RLG +  ++T+PPP+SG ++   L++L  Y F  SS D        L YHR+ E  KF+FA RS L D  F  + +K + + L           +  ++TH+   Y  ++   EDHGTSH ++++P+GDAVS+TS+IN  FG+    + TGI+YND+M DF    S  + GL  S  NF    KRP SSM+P+II D  GNV +V GASGG +I+++T Q  +      +++K+SI+  R+H QL P++ +  E NFP  ++  L   GH + +  + A VQGI++    + Y+W   +D RK G   G
Sbjct:   26 KPNPIPPV-DSSGGPYYRGAVAADAKNCSAIGVNILKRKG-SAVDAAIATMLCVGVINMHSTGVGGGGFMLVYNKTSNTTEAIDFREKAPVAANESMFVDKVRDAKFGGLAVGVPGEVRGYYKAWEKYGRLRWRDIVQPAIDIAKNGFYIGKPVHDAASELKDEIINNPG------LRELLFKTDGKTLKDRDSPITNLKYAATLKTIRDNPHSFYNGTLARNIIRDIQFMEPQGIMGLDDLKNYTAEIRKGLSGRLGPNLVMHTVPPPASGAVMHLLLDILKGYNFTESSRDLKDTNTSTLTYHRITEASKFAFAWRSRLADPAFDGSVEKYVEKMLDQSTADYLRAQIWDNQTHDNVSYYANYFSYEDHGTSHLAVLAPNGDAVSLTSSINLRFGNQHRSTTTGIIYNDQMSDFDNPGSKRHAGLSPSELNFPAPGKRPFSSMTPVIITDNNGNVKMVFGASGGKQIITATSQAIMNKLWFGRSLKQSIEDLRIHTQLIPDDFLYHEANFPRDILDGLRNLGHDLKELKHYAAVQGIVRETRGEIYAW---SDSRKSGKPGG 578          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Nematostella
Match: EDO37680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF26])

HSP 1 Score: 329.331 bits (843), Expect = 2.157e-104
Identity = 204/557 (36.62%), Postives = 304/557 (54.58%), Query Frame = 3
Query:  264 TKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVH-GGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMK-EREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHE-VSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVV----EQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRK 1907
            +K   P P   +   G +K   V+SDA +C+ +   ++ +KGG+A+D A+A L C   +N HS GI GG  +L Y++  KK    D RE+AP  A   M+ N       GG ++AV G V G +     +GK+ W+ L +PTID+ + GF +   + +A+       +      LR +L      KP+     IK P  A T+  +   P     GSL  D+  ++  GG I+  +DL  Y  +  + PI   LG   T++    PS G +V   +N++  Y   P +  S     L YHR++E+ KF+FA+R+ LGD  F N T  E++  LTS  Y+++I   I D +TH   SYY        D GT+H S+++ +GDAVSVTSTINY FG+  +G +TGI++N+EMDDF+T   +N YGLP S  NFI+  KRP SSM+P+I  D+EG+V LV GA+GGS I++ST   ++      +++ E++  PR+H+QLFP+ V          P A+ K+L  R H V+      +VQ +  S N   S    +D RK
Sbjct:   36 SKSADPKPILGE---GPFKSGVVSSDADECSELGAKML-IKGGSAVDSAVATLFCVGLLNLHSTGIGGGGFMLVYQRDTKKAKFLDFREVAPGAANSTMYVNQTEKAQLGGLAVAVPGEVRGLHTAWMEYGKLPWRDLVQPTIDMAKGGFKIIHALHDAMKGAIPKISAD--PGLRALLMENGNLKPEN--STIKHPAFALTLEKIRDNPNDFYEGSLAADIAKDIQDGGGIVTAEDLKNYTAQTNKVPIKNTLGG-RTMFATTGPSGGPVVTLIMNIMKGYNLGPEARASDSASGLTYHRIVESFKFAFARRALLGDPAFENIT--EIMSKLTSPVYAEKIRQNIWDNQTHSNASYYGAETGQTVDGGTTHLSILASNGDAVSVTSTINYRFGAAYLGRRTGILFNNEMDDFSTPGATNLYGLPPSEVNFIKPGKRPQSSMAPVIFTDQEGDVELVCGAAGGSMIITSTSLVSMSKLWFGRSLSEAVKEPRLHHQLFPDVVTYLDRSPYELPLAIRKALETRNHTVSPRTSQNIVQAV--SRNKDGSLYGMSDPRK 579          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Nematostella
Match: EDO44635 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVG5])

HSP 1 Score: 326.635 bits (836), Expect = 1.427e-103
Identity = 196/525 (37.33%), Postives = 306/525 (58.29%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDS--SVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRIL----SVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPS-HVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDF-ATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVN-KNLYPAVVQGIMK 1859
            ++  AVA+D  +C+ +   ++  K G A+D AIA +LC   +N HS G+ GG  +L Y    KK    D RE AP  A   +F+ GD+   + GG ++AV G + G     +++GK+ WK LF P+I + + GFP+ ET+  AI+ +       + K  R I      GK  + G+ ++ P LA+ + ++    S +P+   NG L + +++++ + G ++   DL  YK+K +E +   +G   TL T PPP+SG +++  LN+L+ Y F   S+D  ++ V  YHR+IE  KF++  RS LGD DF   +   ++ ++ SE+ +K    +I D KT   SYY    HVP +  GT+H S++S +GDAVSVTST+N  FG+  +  K GIVYN+EMDDF A   +N +GL  +P NFI+  KRP SS  P II+DK G+V +V+GA+GG+ I +S  Q  +      KN++ +I  PR+H+QL+P+    E   P++++  L   GH VN  +    VVQG++K
Sbjct:   15 FEHAAVAADNSRCSEIGRDVLK-KQGTAVDAAIATMLCVGVINLHSTGVGGGGFMLVYNSHLKKAEMIDFRETAPLQANRDLFQ-GDAIKGIKGGLAVAVPGELKGMEVAWKKYGKLPWKDLFAPSIALAKEGFPLPETVSIAINIWKKYLT--KDKGFRKIFMP--YGKLLKTGETVRRPNLAKVLSLIANANSSKPFY--NGKLSHTIVSDVKAAGGVLTLSDLRHYKVKVKEALKSHIGS-MTLMTGPPPTSGPVLSMILNILSGYNF--KSSDMKKHPVRTYHRIIEAFKFAYKYRSMLGDPDF-EKSVPGVVNDMLSEKVAKYYRHMILDNKTQTPSYYGSRYHVPVKT-GTTHISVLSKEGDAVSVTSTVNGYFGAKFISPKLGIVYNNEMDDFSAPGITNEFGLLPAPVNFIKPNKRPQSSAVPAIILDKFGHVNMVVGAAGGTIITTSVAQVIMNYFWFNKNLQNAITMPRLHDQLYPDYAFAETWMPESIVNGLRALGHKVNVSDTSHGVVQGVVK 526          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Nematostella
Match: EDO33350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSJ4])

HSP 1 Score: 307.375 bits (786), Expect = 1.895e-96
Identity = 183/548 (33.39%), Postives = 310/548 (56.57%), Query Frame = 3
Query:  309 GIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGD-SSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDI----LEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHE-VSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNF--PDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            G Y   AVA+D+ +C+ +   ++ ++ G+A+D  IA L C   +N HS GI GG  ++ Y ++ K    FD R  AP LA   M+ N   SS  G  ++AV G + GY    R++G++ WK L +P+ID+    +++G+    ++++      N+      + LR++L +   GK +++G+ IK PKLA+T+  +  +P +   G L  D++ E+   G +I  +D+  YK+K R+P+    G+   ++T PPP SG ++   LN+L  +K          + +L YHR++E  KF++A R+ LGD ++  +   + +  LT   +++ +   I+D +T++ ++YY    V K+  GT+H S+++P+GDAV+ T+TI++ FGS  MG  TGI+YN++M  FA  +          +NFI   KRP S+ +P +IV+K G+VTLV+GASGG+KI ++  Q  +      + + +S+  PRVH+QL P  + VE+++  P A++  L   GH V      AVVQ + K  + +      +D RK G   G
Sbjct:   10 GPYHHAAVATDSGKCSEIGRDMMKLRNGSAVDATIAALFCVGVMNMHSAGIGGGGFIVVYNRSTKFSEVFDFRGKAPGLANKTMYINSHLSSRIGPSAVAVPGEIKGYLAAWRKYGRLPWKVLIQPSIDLAREGVQIGYDTFSSMKDVQPVLINS------RGLRELLISE-DGKLRKLGETIKLPKLARTLEQIRDDPESFYTGDLARDIVNELQEEGGLITLEDMRNYKVKVRKPLKFPFGE-YNVFTTPPPGSGTVLNLILNILKGFKMTGEDRKDDASSILTYHRIVEAFKFAYANRALLGDPEY--SDIYQAISTLTDPAFAEGLRKRISDTQTYKNLTYYGKYFVDKDYEGTTHVSVLAPNGDAVAATTTISFHFGSKFMGRTTGILYNNQMAAFAVAEHPNKTYEREASNFISPGKRPSSTSAPSVIVNKMGDVTLVVGASGGTKINTAVSQAIMNFFWFNRTLSQSVMDPRVHHQLLPMYIRVEKDYPMPQAILDGLKRLGHEVVPKEGFAVVQAVTKGEDGRV--MAKSDPRKFGWAAG 545          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Nematostella
Match: EDO39002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBB1])

HSP 1 Score: 297.36 bits (760), Expect = 8.703e-93
Identity = 189/551 (34.30%), Postives = 297/551 (53.90%), Query Frame = 3
Query:  330 VASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLN----NTDKELLRNLTSERYSKEI-MSLITDKTH-EVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSM--------SPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKL-LKKNIKESIDFPRVHNQLFPNEVVVEQN---FPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            VA+DA  C+ +   I+  K G+A+D AIA   C   +N HS G+ GG  +L Y K+       D RE AP  A+  MF+N  SS+ GG +  V G V G YE +R++GK+ W+ L +P+ID+   GFP+   + EA+              LR +L N    K KR+G+ +  P+LA T+  +  +P++  NG L ND++ ++   G II   DL  Y  K ++ ++  +GD   +YT PPPSSG ++   LN+L  Y    +   S     L YHR+IE+ K+++A R+ LGD DF +    N +K ++ N+T   +++ I   ++ DKT   + +Y   +      GTSH S+++P+GDAVS+T+T+N+ FG+      TGI+YN++MDDF+T  + N +G+  SP+N+I   KRPMSS+        SP      +  V+L  G   G++I ++ +   V+ KL   + + +++  PRVHNQ+       ++     P A+   L+ RG+ +      AVVQ I K   P  S    +D RK     G
Sbjct:    2 VATDAGMCSEIGRDILK-KQGSAVDAAIASSFCIGVINMHSAGVGGGGFMLVYDKSSGVSETMDYREEAPSGASQDMFKN-KSSLLGGLATGVPGEVKGLYEAYRKYGKLQWRELLQPSIDLASKGFPLPLPVYEAM--VSGEEALRADPGLRQLLFN--GDKLKRLGEKMTNPQLANTLEKIRDDPHSFYNGCLANDIVRDVKKAGGIITLKDLAAYSPKWKKALASDVGD-LNMYTTPPPSSGAVITMILNILRGYNMTAADRSSDAQSALTYHRIIESFKYAYAWRAKLGDPDFSDAAYANINK-VVENMTDPSFAERIRQRILDDKTFFNMDHYGQYYAGTGPEGTSHLSVLAPNGDAVSLTTTVNWRFGAKYRSPATGIIYNNQMDDFSTPGQPNGFGVAPSPSNYIRPGKRPMSSIRDSYYHGYSP-----SDECVSLYRGWVIGTRI-ATALALVVMNKLWFGRELNDAVSDPRVHNQMSNTTYETKEKQYTLPQAIRDGLIARGNQLKGYHGFAVVQAIEKRNTPGKSIYAQSDPRKYAWAAG 538          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Medaka
Match: ggt1b (gamma-glutamyl transferase 1b [Source:NCBI gene;Acc:100820715])

HSP 1 Score: 366.696 bits (940), Expect = 4.572e-118
Identity = 222/566 (39.22%), Postives = 319/566 (56.36%), Query Frame = 3
Query:  285 PTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDS-SVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAI----DYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQT-MRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKI---------------LSSTIQTAVVAKL----------------LKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP-AVVQGIMK 1859
            P  +D F   Y + AVA+DA +C+ V   I+  K G+A+D +IA LLC   +N HS GI GG   + Y  +  K+   D RE AP  AT  MF N    S  GG SIA+ G + GY   H+R G++ WK LFEP+I +   GFP+ + +  A+    D    N N  E     D   N +     +  DII+ PKLA T  RI    P    NG++   ++ ++ + G II  DDLLEY+ +    P+ + +G+  T++    PSSG ++A  LN++  Y F  +S  + E   L YHR++E  +F++AKRS LGD  +LN TD  L++N+TS+ ++  I + ITD T H  +YY+P +   E+HGT+H S+++ DG AV+ TSTIN  FGS +M   TGI++NDEMDDF++   +N +G+P SPNNFI+  KRP+SSM P II DKE  V +V+GASGG+KI               L ST Q     KL                   ++K+++  PRVHNQL PN  VVEQ F  +++  L ++ HV      P +VVQ +++
Sbjct:   34 PPSSDHF---YSKAAVAADAGKCSEVGRDILK-KNGSAVDASIAALLCVGLLNAHSMGIGGGLFFVIYNASTGKVETIDARETAPMNATEDMFGNNTKLSRTGGLSIAIPGEIRGYEMAHKRHGRLPWKELFEPSIALARDGFPIGKALAHALFKSKDSIQRNANMCEV--FCDSENNIL-----KENDIIRFPKLADTYQRIAEEGPDVFYNGTMARSIVEDIQAEGGIITLDDLLEYQPVLNENPLKLNIGE-YTIHIPDAPSSGPVLALILNIVDGYNFSDTSVSTAEKKTLTYHRIVEAFRFAYAKRSRLGDPRYLNITD--LIQNMTSDYFADGIRNKITDDTTHPDTYYEPDYFVPENHGTAHLSVIAEDGSAVAATSTINLYFGSKVMSRSTGIIFNDEMDDFSSPYMTNGFGIPPSPNNFIQPGKRPLSSMCPTIIFDKENRVKMVVGASGGTKITTATALVCRTHSLTSLCSTFQHMRRLKLSSVFWNKKQVILNSLFFNYDLKKAVKEPRVHNQLNPNMTVVEQGFEKSVLDGLAQKNHVTQLLRTPDSVVQAVVR 585          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Medaka
Match: ggt1b (gamma-glutamyl transferase 1b [Source:NCBI gene;Acc:100820715])

HSP 1 Score: 362.459 bits (929), Expect = 6.084e-117
Identity = 213/535 (39.81%), Postives = 312/535 (58.32%), Query Frame = 3
Query:  285 PTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDS-SVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAI----DYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQT-MRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYK-MKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKT-HEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYP-AVVQGIMK 1859
            P  +D F   Y + AVA+DA +C+ V   I+  K G+A+D +IA LLC   +N HS GI GG   + Y  +  K+   D RE AP  AT  MF N    S  GG SIA+ G + GY   H+R G++ WK LFEP+I +   GFP+ + +  A+    D    N N  E     D   N +     +  DII+ PKLA T  RI    P    NG++   ++ ++ + G II  DDLLEY+ +    P+ + +G+  T++    PSSG ++A  LN++  Y F  +S  + E   L YHR++E  +F++AKRS LGD  +LN TD  L++N+TS+ ++  I + ITD T H  +YY+P +   E+HGT+H S+++ DG AV+ TSTIN  FGS +M   TGI++NDEMDDF++   +N +G+P SPNNFI+  KRP+SSM P II DKE  V +V+GASGG+KI ++T    + +     ++K+++  PRVHNQL PN   V        +  L ++ HV      P +VVQ +++
Sbjct:   34 PPSSDHF---YSKAAVAADAGKCSEVGRDILK-KNGSAVDASIAALLCVGLLNAHSMGIGGGLFFVIYNASTGKVETIDARETAPMNATEDMFGNNTKLSRTGGLSIAIPGEIRGYEMAHKRHGRLPWKELFEPSIALARDGFPIGKALAHALFKSKDSIQRNANMCEV--FCDSENNIL-----KENDIIRFPKLADTYQRIAEEGPDVFYNGTMARSIVEDIQAEGGIITLDDLLEYQPVLNENPLKLNIGE-YTIHIPDAPSSGPVLALILNIVDGYNFSDTSVSTAEKKTLTYHRIVEAFRFAYAKRSRLGDPRYLNITD--LIQNMTSDYFADGIRNKITDDTTHPDTYYEPDYFVPENHGTAHLSVIAEDGSAVAATSTINLYFGSKVMSRSTGIIFNDEMDDFSSPYMTNGFGIPPSPNNFIQPGKRPLSSMCPTIIFDKENRVKMVVGASGGTKITTATALVILNSLFFNYDLKKAVKEPRVHNQLNPNMTSV--------LDGLAQKNHVTQLLRTPDSVVQAVVR 546          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Medaka
Match: ggt1a (gamma-glutamyl transferase 1a [Source:NCBI gene;Acc:100820714])

HSP 1 Score: 348.206 bits (892), Expect = 2.136e-111
Identity = 205/554 (37.00%), Postives = 312/554 (56.32%), Query Frame = 3
Query:  312 IYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENG-DSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPIT---------GKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEY-KMKEREPISVRLGDDSTLYTLP-PPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNK-SNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNK-NLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            IY + AVA+DA  C+ +   I+ +KGG+A+D  IAGLLC   +N HS GI GG  L  Y     K+   D RE AP  AT  MF N  D +  GG +IAV G + GY   H+R GK+ WK LF+P+I + E GFP+   +  AI             + RDI+ N            G   +    IK  KLA+T R ++ E P A   GSL  +++ ++ + G II  +DL  Y  + +  P+ V +G+ + +  +P  P+SG +++  LN+L  Y F   S  S E  +L +HR++E  +F++AKRS LGD  FL  +   L++NLTS+ ++  +   I+D  T  V+YY P     ++HGT+H S+VS DG AV+ TSTIN+  GS +M + TG+++N+EMDDF+    +N +G+P S +NF+E  KRPMSSM+P I+ DK+  V + +G SGG+KI ++  Q  + A     ++++++  PR+HNQL PN    E +F   ++  L  + H       + AVVQ +++  +     +  +DHRK     G
Sbjct:   38 IYLKAAVAADAGPCSEIGRDIL-LKGGSAVDATIAGLLCVGLMNAHSMGIGGGLFLTIYNAKTGKVETIDARETAPHNATRDMFGNSTDLATTGGLAIAVPGEIRGYQMAHQRHGKLPWKDLFQPSIQLAEKGFPLGRALASAI------------SDKRDIILNDKVLCEVFCGEDGDVLKENKTIKFTKLAETYRKIAEEGPDAFYEGSLAQNLVNDIQAAGGIITMEDLKNYTAVLDESPLRVNVGEYAMV--VPNAPASGPVLSLILNILNGYNFTADSVASPEKKILTFHRIVEAYRFAYAKRSSLGDPRFL--SIDNLIQNLTSQSFADALREKISDSSTQPVNYYGPDFYLPDNHGTAHISVVSEDGSAVAATSTINHYLGSKVMSNSTGVIFNNEMDDFSFPLITNGFGVPPSNSNFVEPGKRPMSSMAPAILFDKDNKVKMAVGGSGGTKITTAIAQVILNALFFDYDLEKAVSDPRLHNQLLPNTTEAEPDFDQNILNGLKAKNHNTKYLKSFGAVVQAVVRYKD---GLRAQSDHRKFAYAAG 571          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Medaka
Match: ggt1a (gamma-glutamyl transferase 1a [Source:NCBI gene;Acc:100820714])

HSP 1 Score: 298.901 bits (764), Expect = 4.117e-94
Identity = 175/466 (37.55%), Postives = 261/466 (56.01%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSV---HGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPIT---------GKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEY-KMKEREPISVRLGDDSTLYTLP-PPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDK-THEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQ 1664
            +   AVA+DA  C+ +   I+ +KGG+A+D  IAGLLC   +N HS GI GG  L  Y     K+   D RE AP  AT  MF N   +     GG +IAV G + GY   H+R GK+ WK LF+P+I + E GFP+   +  AI             + RDI+ N            G   +    IK  KLA+T R ++ E P A   GSL  +++ ++ + G II  +DL  Y  + +  P+ V +G+ + +  +P  P+SG +++  LN+L  Y F   S  S E  +L +HR++E  +F++AKRS LGD  F   +D++L++NLTS+ ++  +   I+D  T  V+YY P     ++HGT+H S+VS DG AV+ TSTIN+  GS +M + TG+++N+EMDDF+  K             I+  KRPMSSM+P I+ DK+  V + +G SGG+KI ++  Q
Sbjct:    4 FHHAAVAADAGPCSEIGRDIL-LKGGSAVDATIAGLLCVGLMNAHSMGIGGGLFLTIYNAKTGKVETIDARETAPHNATRDMFGNNCKAFAYSKGGLAIAVPGEIRGYQMAHQRHGKLPWKDLFQPSIQLAEKGFPLGRALASAI------------SDKRDIILNDKVLCEVFCGEDGDVLKENKTIKFTKLAETYRKIAEEGPDAFYEGSLAQNLVNDIQAAGGIITMEDLKNYTAVLDESPLRVNVGEYAMV--VPNAPASGPVLSLILNILNGYNFTADSVASPEKKILTFHRIVEAYRFAYAKRSSLGDPSF---SDRQLIQNLTSQSFADALREKISDSSTQPVNYYGPDFYLPDNHGTAHISVVSEDGSAVAATSTINHYLGSKVMSNSTGVIFNNEMDDFSYQKQT-----------IQTRKRPMSSMAPAILFDKDNKVKMAVGGSGGTKITTAIAQ 440          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Medaka
Match: ENSORLT00000043223.1 (glutathione hydrolase 5 proenzyme [Source:NCBI gene;Acc:101161114])

HSP 1 Score: 245.743 bits (626), Expect = 1.125e-72
Identity = 172/543 (31.68%), Postives = 281/543 (51.75%), Query Frame = 3
Query:  315 YKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENG-DSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVE-PYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDH-GTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERG--HVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            + + AVA+D++ C+ +   I+  KGG+A+D AIA LLCT   N HS GI GG++      +   +   + RE +P      + ++  + S+   K I V G + GY   H+ +GK+ W  LF+P I +   G P+S+ +   I+   N  N  E + LR + T+       + GD +K  KLA T+ +++ + P     G +  D++ ++ + G  +   DL  YK    +  +V +G +  +Y  PPP++G L+   LN++  +  +P S    E   LFYHR IE+ KF+   +  + D  F   T ++  +  T E ++  I S IT DKTHE+ +Y  +  P  D  GT+H S++  DG AV+VTSTINY+FGS ++  +TGI+ N+E+ DF     +   LP          +RP SSMSP+++  K  + TL IG SGG +I ++     +    L K++K++I +  +      N V  E++F   +I+ L   G  H   +  Y + V  + K     ++    +D RKKG  DG
Sbjct:   36 FSKAAVATDSEICSGIGRAILKEKGGSAVDAAIAALLCTFVANPHSAGIGGGTIFTVM-DSSGDVRIINSREASPTKVKSDLLKSCPEESMTDVKWIGVPGEIRGYEAAHKLYGKLPWADLFQPAIKLAREGIPISDFLHSHIE---NIPNSNETQSLRKLFTDN-NNNFLKAGDFVKFEKLADTLEMIANQGPDVFYTGKIAEDLVQDVKAAGGTLELQDLASYKATLTDAWNVSMG-EYRMYFPPPPAAGSLLTLILNIMRGFPLNPDSLTGKEK-TLFYHRYIESFKFANGLKKYIRDPRF---TSEKRAKEFTEESFANYIRSFITDDKTHELQFYNVT--PHLDSTGTTHVSVLHEDGSAVAVTSTINYIFGSRVVSPRTGIILNNELRDFCGRADSI--LPG---------ERPPSSMSPVVL--KSKSRTLTIGGSGGGRITTAMASALINHLWLGKSLKDAI-YTSIAVVDSENAVDFERDFDKDVIEGLKALGHNHTTLRKFYNS-VNAVEKKDGCIFAV---SDFRKKGKPDG 548          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Planmine SMEST
Match: SMESG000047024.1 (SMESG000047024.1)

HSP 1 Score: 1176.39 bits (3042), Expect = 0.000e+0
Identity = 596/604 (98.68%), Postives = 597/604 (98.84%), Query Frame = 3
Query:  117 MLMLLDSPQTSTRNRKRSKMCXXXXXXXXXXXXXXXXXXXXXYCSPLNSTKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDGT 1928
            MLML+DSPQT   NRKRSKMCLIISWVLTSVLVVVVIFLLIFYCSPL STKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINW TLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIK PKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEG VTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDGT
Sbjct:    1 MLMLVDSPQT---NRKRSKMCLIISWVLTSVLVVVVIFLLIFYCSPLYSTKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWMTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKIPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITDKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGYVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDGT 601          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Planmine SMEST
Match: SMESG000047031.1 (SMESG000047031.1)

HSP 1 Score: 862.062 bits (2226), Expect = 0.000e+0
Identity = 426/563 (75.67%), Postives = 477/563 (84.72%), Query Frame = 3
Query:  243 YCSPLNSTKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            Y   LN  KKTCPLP+   S  G+Y  +AVASDA  CASVSN IIS+KGGNAIDGAIAGL C+CSVNFHSCGIAGGS LL+Y K +KK++A+DIREMAP+LA+  MF +  SS  GGKSIAV+GLV+GYYEIH+RFG+I+WKTL EPTIDILE GF VS+++EEAID++F NTNPPEFKELRD LTNPITGKPKR GDIIK PKLA TMRILSVEPYAMKNGSLVNDMIAE+TS G II K D   Y+MKEREPISV LGD+STLYTLPPPSSGVLVAFSLNVL DYKF PS  DSCEN  LF+HRLIETMKFSFAKRS LGDIDF+NNT  ELLRNLTSE YSK IMSLIT DKTH+VSYY PS   KEDHGTSHFSLVSPDGDAVSVTSTINY FGS IMG+KTGIVYNDEMDDF++ NKSN Y LP SP+NFI  YKRPMSSMSPIIIVD EGNV LV+GASGGSKILS+T Q ++++KLLKK IKE+ID PR+H+QL P+EVV E NFPD L++SL ++GH+V K+   AV QGIMKSL+  YSWQCNAD RK G+CDG
Sbjct:   36 YVRLLNK-KKTCPLPSSNSSSRGLYMHSAVASDAIPCASVSNNIISIKGGNAIDGAIAGLFCSCSVNFHSCGIAGGSFLLFYNKIQKKVYAYDIREMAPKLASKDMFADNVSSTIGGKSIAVSGLVSGYYEIHKRFGRIDWKTLIEPTIDILENGFYVSKSMEEAIDFYFKNTNPPEFKELRDTLTNPITGKPKRAGDIIKIPKLANTMRILSVEPYAMKNGSLVNDMIAEITSEGGIISKYDFSAYEMKEREPISVHLGDNSTLYTLPPPSSGVLVAFSLNVLADYKFGPSFLDSCENTGLFFHRLIETMKFSFAKRSALGDIDFVNNT--ELLRNLTSETYSKWIMSLITDDKTHKVSYYHPSFETKEDHGTSHFSLVSPDGDAVSVTSTINYYFGSLIMGTKTGIVYNDEMDDFSSPNKSNIYNLPPSPSNFIMPYKRPMSSMSPIIIVDNEGNVDLVLGASGGSKILSATTQVSILSKLLKKTIKEAIDIPRIHHQLIPDEVVAEMNFPDVLVESLRQKGHIVRKDPDYAVCQGIMKSLDSAYSWQCNADFRKMGLCDG 595          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Planmine SMEST
Match: SMESG000047031.1 (SMESG000047031.1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 426/563 (75.67%), Postives = 477/563 (84.72%), Query Frame = 3
Query:  243 YCSPLNSTKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
            Y   LN  KKTCPLP+   S  G+Y  +AVASDA  CASVSN IIS+KGGNAIDGAIAGL C+CSVNFHSCGIAGGS LL+Y K +KK++A+DIREMAP+LA+  MF +  SS  GGKSIAV+GLV+GYYEIH+RFG+I+WKTL EPTIDILE GF VS+++EEAID++F NTNPPEFKELRD LTNPITGKPKR GDIIK PKLA TMRILSVEPYAMKNGSLVNDMIAE+TS G II K D   Y+MKEREPISV LGD+STLYTLPPPSSGVLVAFSLNVL DYKF PS  DSCEN  LF+HRLIETMKFSFAKRS LGDIDF+NNT  ELLRNLTSE YSK IMSLIT DKTH+VSYY PS   KEDHGTSHFSLVSPDGDAVSVTSTINY FGS IMG+KTGIVYNDEMDDF++ NKSN Y LP SP+NFI  YKRPMSSMSPIIIVD EGNV LV+GASGGSKILS+T Q ++++KLLKK IKE+ID PR+H+QL P+EVV E NFPD L++SL ++GH+V K+   AV QGIMKSL+  YSWQCNAD RK G+CDG
Sbjct:   50 YVRLLNK-KKTCPLPSSNSSSRGLYMHSAVASDAIPCASVSNNIISIKGGNAIDGAIAGLFCSCSVNFHSCGIAGGSFLLFYNKIQKKVYAYDIREMAPKLASKDMFADNVSSTIGGKSIAVSGLVSGYYEIHKRFGRIDWKTLIEPTIDILENGFYVSKSMEEAIDFYFKNTNPPEFKELRDTLTNPITGKPKRAGDIIKIPKLANTMRILSVEPYAMKNGSLVNDMIAEITSEGGIISKYDFSAYEMKEREPISVHLGDNSTLYTLPPPSSGVLVAFSLNVLADYKFGPSFLDSCENTGLFFHRLIETMKFSFAKRSALGDIDFVNNT--ELLRNLTSETYSKWIMSLITDDKTHKVSYYHPSFETKEDHGTSHFSLVSPDGDAVSVTSTINYYFGSLIMGTKTGIVYNDEMDDFSSPNKSNIYNLPPSPSNFIMPYKRPMSSMSPIIIVDNEGNVDLVLGASGGSKILSATTQVSILSKLLKKTIKEAIDIPRIHHQLIPDEVVAEMNFPDVLVESLRQKGHIVRKDPDYAVCQGIMKSLDSAYSWQCNADFRKMGLCDG 609          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Planmine SMEST
Match: SMESG000047031.1 (SMESG000047031.1)

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 413/537 (76.91%), Postives = 462/537 (86.03%), Query Frame = 3
Query:  321 RTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT-DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNADHRKKGICDG 1925
             +AVASDA  CASVSN IIS+KGGNAIDGAIAGL C+CSVNFHSCGIAGGS LL+Y K +KK++A+DIREMAP+LA+  MF +  SS  GGKSIAV+GLV+GYYEIH+RFG+I+WKTL EPTIDILE GF VS+++EEAID++F NTNPPEFKELRD LTNPITGKPKR GDIIK PKLA TMRILSVEPYAMKNGSLVNDMIAE+TS G II K D   Y+MKEREPISV LGD+STLYTLPPPSSGVLVAFSLNVL DYKF PS  DSCEN  LF+HRLIETMKFSFAKRS LGDIDF+NNT  ELLRNLTSE YSK IMSLIT DKTH+VSYY PS   KEDHGTSHFSLVSPDGDAVSVTSTINY FGS IMG+KTGIVYNDEMDDF++ NKSN Y LP SP+NFI  YKRPMSSMSPIIIVD EGNV LV+GASGGSKILS+T Q ++++KLLKK IKE+ID PR+H+QL P+EVV E NFPD L++SL ++GH+V K+   AV QGIMKSL+  YSWQCNAD RK G+CDG
Sbjct:    2 HSAVASDAIPCASVSNNIISIKGGNAIDGAIAGLFCSCSVNFHSCGIAGGSFLLFYNKIQKKVYAYDIREMAPKLASKDMFADNVSSTIGGKSIAVSGLVSGYYEIHKRFGRIDWKTLIEPTIDILENGFYVSKSMEEAIDFYFKNTNPPEFKELRDTLTNPITGKPKRAGDIIKIPKLANTMRILSVEPYAMKNGSLVNDMIAEITSEGGIISKYDFSAYEMKEREPISVHLGDNSTLYTLPPPSSGVLVAFSLNVLADYKFGPSFLDSCENTGLFFHRLIETMKFSFAKRSALGDIDFVNNT--ELLRNLTSETYSKWIMSLITDDKTHKVSYYHPSFETKEDHGTSHFSLVSPDGDAVSVTSTINYYFGSLIMGTKTGIVYNDEMDDFSSPNKSNIYNLPPSPSNFIMPYKRPMSSMSPIIIVDNEGNVDLVLGASGGSKILSATTQVSILSKLLKKTIKEAIDIPRIHHQLIPDEVVAEMNFPDVLVESLRQKGHIVRKDPDYAVCQGIMKSLDSAYSWQCNADFRKMGLCDG 536          
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Planmine SMEST
Match: SMESG000000747.1 (SMESG000000747.1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 308/559 (55.10%), Postives = 405/559 (72.45%), Query Frame = 3
Query:  261 STKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNAIDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLATPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDILEMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKTPKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKEREPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVLFYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLITD-KTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMGSKTGIVYNDEMDDFAT-NKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDKEGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPNEVVVEQNFPDALIKSLVERGHVVNKNL-YPAVVQGIMKSLNPQYSWQCNADHRKKGICDGT 1928
            + +  C +P    S    +  +AVASDA  CA++S  I+  KGGNAIDGAIAG+LCTCSVNFHSCGI GG+  +YY +  K  +AFDIRE+AP LA+ +MF +  S + GGKSIAV GL++ YYEIH+RFG++ W  LF+P I++L  GF VSE +E AI  FF N +P EFKELR+ LTN  TGK  R GD I+  K A T+ ILS EPYAMKNGSLV+ +I E+T  G II K+DL  Y+MK R+P+ +++    TL+TLPPPSSG LVAF+LNVL  Y  DP    +C+N +LFYHRL+ET KFS+A RS LGD+DF++    +L+  ++S+ Y+K I SLI D KT+  SYY P    KEDHGTSHFSL+S +GDAVS+TS+INY FGS ++G++TGI+YND+MDDF+  N+ N Y L  S +NF+  YKRPMSSMSPII+V+K GNV LV+G+SGGSKI+SST Q+A +A L ++++K SID PRVH+QL PN ++ E+N P  ++K L+++GH++ KN  Y  V  GI +S   +   QCNAD RK G CDG+
Sbjct:   11 AERGKCAIPVNNLSSQRFFHHSAVASDANHCATISKNIMISKGGNAIDGAIAGILCTCSVNFHSCGIGGGAFFIYYNRLHKTSYAFDIREIAPGLASENMFHSQKSYIAGGKSIAVMGLISSYYEIHQRFGRLKWNDLFKPIIELLRKGFLVSEDLETAIISFFQNQSPTEFKELREFLTNHKTGKHFRAGDKIRRLKFANTLEILSKEPYAMKNGSLVDTIITEITKAGGIITKNDLNIYQMKIRKPLLMKMESGKTLHTLPPPSSGGLVAFNLNVL-QYYHDPKFFKNCQNKILFYHRLVETFKFSYALRSRLGDMDFVD--VHKLVNKMSSKTYAKLIKSLINDNKTNPSSYYGPPGDFKEDHGTSHFSLISDEGDAVSITSSINYKFGSLVLGNETGIIYNDQMDDFSYPNRINIYKLRPSKSNFVRPYKRPMSSMSPIIVVNKAGNVDLVLGSSGGSKIISSTTQSAALALLFRESMKSSIDAPRVHHQLHPNVILYEKNMPKTILKGLMKKGHILKKNKNYSGVCDGIKRSSKNRRLLQCNADFRKGGSCDGS 566          
The following BLAST results are available for this feature:
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GGT17.947e-12238.26gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
GGT17.947e-12238.26gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
GGT17.947e-12238.26gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
GGT24.887e-11036.41gamma-glutamyltransferase 2 [Source:HGNC Symbol;Ac... [more]
GGT21.752e-10535.86gamma-glutamyltransferase 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C53D5.55.513e-11038.36pep chromosome:WBcel235:I:305811:310082:-1 gene:WB... [more]
C53D5.55.513e-11038.36pep chromosome:WBcel235:I:305811:311130:-1 gene:WB... [more]
C53D5.51.927e-10938.36pep chromosome:WBcel235:I:305811:310966:-1 gene:WB... [more]
C53D5.51.927e-10938.36pep chromosome:WBcel235:I:305811:310802:-1 gene:WB... [more]
H14N18.41.003e-9836.92pep chromosome:WBcel235:V:8924264:8927853:-1 gene:... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG48296.423e-11238.56gene:FBgn0030796 transcript:FBtr0112994[more]
CG48291.685e-11138.56gene:FBgn0030796 transcript:FBtr0112995[more]
CG48293.601e-11138.56gene:FBgn0030796 transcript:FBtr0074337[more]
CG48293.601e-11138.56gene:FBgn0030796 transcript:FBtr0074338[more]
CG48291.396e-11038.56gene:FBgn0030796 transcript:FBtr0074336[more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ggt1b6.496e-11540.22gamma-glutamyltransferase 1b [Source:ZFIN;Acc:ZDB-... [more]
ggt1a2.510e-11438.93gamma-glutamyltransferase 1a [Source:ZFIN;Acc:ZDB-... [more]
ggt1a1.066e-10038.84gamma-glutamyltransferase 1a [Source:ZFIN;Acc:ZDB-... [more]
ggt1l2.27.536e-8234.66gamma-glutamyltransferase 1 like 2.2 [Source:ZFIN;... [more]
ggt1l2.15.479e-7933.01gamma-glutamyltransferase 1 like 2.1 [Source:ZFIN;... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ggt18.890e-12039.49gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:... [more]
ggt19.888e-11439.73gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:... [more]
ggt16.131e-11039.03gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:... [more]
ggt11.734e-10939.35gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:... [more]
ggt14.364e-10641.79gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ggt16.225e-12037.84gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc... [more]
Ggt16.225e-12037.84gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc... [more]
Ggt58.979e-6930.73gamma-glutamyltransferase 5 [Source:MGI Symbol;Acc... [more]
Ggt11.068e-4134.51gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc... [more]
Ggt74.307e-4027.25gamma-glutamyltransferase 7 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P07314|GGT1_RAT7.273e-12538.64Glutathione hydrolase 1 proenzyme OS=Rattus norveg... [more]
sp|P20735|GGT1_PIG1.046e-12138.03Glutathione hydrolase 1 proenzyme OS=Sus scrofa OX... [more]
sp|P19440|GGT1_HUMAN3.816e-12138.26Glutathione hydrolase 1 proenzyme OS=Homo sapiens ... [more]
sp|Q60928|GGT1_MOUSE4.354e-11937.84Glutathione hydrolase 1 proenzyme OS=Mus musculus ... [more]
sp|P0DPU3|TX14A_SCODE7.254e-11539.82Scoloptoxin SSD14 OS=Scolopendra dehaani OX=260977... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PJB81.374e-13940.21Gamma-glutamyltranspeptidase 1 OS=Mizuhopecten yes... [more]
A0A267GH361.627e-13640.99Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
K1R1G54.159e-13441.41Gamma-glutamyltranspeptidase 1 OS=Crassostrea giga... [more]
A0A267G2M41.721e-13040.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210PFF99.691e-13040.53Gamma-glutamyltranspeptidase 1 OS=Mizuhopecten yes... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-59p9.27.631e-12238.83gamma-glutamyltranspeptidase 1 [Source:NCBI gene;A... [more]
ggt1b2.662e-11639.71gamma-glutamyltranspeptidase 1-like [Source:NCBI g... [more]
ggt1b2.524e-9836.28gamma-glutamyltranspeptidase 1-like [Source:NCBI g... [more]
ggt5a4.477e-7132.42gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-... [more]
ggt5a1.460e-6832.64gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000005677.13.769e-10135.63pep scaffold:Pmarinus_7.0:GL478518:21750:45518:-1 ... [more]
ENSPMAT00000005618.13.079e-6532.59pep scaffold:Pmarinus_7.0:GL478518:2729:14084:1 ge... [more]
ENSPMAT00000006210.12.353e-5250.00pep scaffold:Pmarinus_7.0:GL492264:524:3304:1 gene... [more]
ENSPMAT00000001319.11.791e-3026.04pep scaffold:Pmarinus_7.0:GL476337:669740:697940:-... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ECM386.753e-6932.15Gamma-glutamyltranspeptidase; major glutathione-de... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445728.450e-10535.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376802.157e-10436.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446351.427e-10337.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333501.895e-9633.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390028.703e-9334.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ggt1b4.572e-11839.22gamma-glutamyl transferase 1b [Source:NCBI gene;Ac... [more]
ggt1b6.084e-11739.81gamma-glutamyl transferase 1b [Source:NCBI gene;Ac... [more]
ggt1a2.136e-11137.00gamma-glutamyl transferase 1a [Source:NCBI gene;Ac... [more]
ggt1a4.117e-9437.55gamma-glutamyl transferase 1a [Source:NCBI gene;Ac... [more]
ENSORLT00000043223.11.125e-7231.68glutathione hydrolase 5 proenzyme [Source:NCBI gen... [more]
back to top
BLAST of glutathione hydrolase 1 proenzyme isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047024.10.000e+098.68SMESG000047024.1[more]
SMESG000047031.10.000e+075.67SMESG000047031.1[more]
SMESG000047031.10.000e+075.67SMESG000047031.1[more]
SMESG000047031.10.000e+076.91SMESG000047031.1[more]
SMESG000000747.10.000e+055.10SMESG000000747.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003824 ID=SMED30003824|Name=glutathione hydrolase 1 proenzyme isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=2030bp
ATTAATTTCAAATTAAAAAGTTATCATTTATTTACTAAAAATATTTCTCC
CAGATTTGAAACCAATAATATAAAAGGAATAACAATTCACATTGTGAAAT
GTCTGGTTATGAAAATATGCTTATGTTACTTGATTCGCCTCAAACTTCTA
CTAGGAATAGAAAACGTTCCAAAATGTGTTTAATTATCTCCTGGGTTTTG
ACCTCAGTTCTTGTAGTAGTTGTCATTTTTTTATTGATTTTTTATTGTAG
TCCATTAAACTCAACAAAAAAAACGTGTCCCCTGCCAACCTGCACTGATA
GTTTCATGGGGATTTATAAGCGTACCGCAGTCGCATCTGATGCAAAACAA
TGCGCATCAGTTTCAAATACCATAATTTCCGTGAAAGGCGGGAATGCCAT
TGATGGTGCTATTGCTGGATTACTTTGTACATGCTCTGTCAATTTTCACA
GTTGCGGAATCGCTGGGGGATCTTTACTTCTTTATTATAAAAAAGCTGAA
AAGAAAATCTTCGCATTTGACATTCGAGAAATGGCCCCACAACTGGCAAC
ACCACATATGTTTGAAAATGGTGATTCGTCTGTACATGGCGGGAAATCTA
TTGCTGTAACGGGGTTGGTTGCTGGATATTATGAGATCCACAGGAGGTTC
GGGAAAATTAACTGGAAGACATTATTTGAACCAACCATCGACATTTTAGA
AATGGGCTTCCCAGTTTCTGAAACTATCGAAGAAGCCATTGATTATTTTT
TTAATAATACAAATCCGCCAGAATTTAAAGAATTAAGGGATATATTGACG
AATCCAATAACTGGTAAACCGAAAAGAGTCGGTGATATTATCAAAACACC
GAAACTCGCCCAAACTATGAGGATTTTGTCTGTTGAGCCTTATGCTATGA
AGAATGGATCATTAGTCAATGACATGATTGCGGAAATGACTTCCGGAGGA
AGCATTATTTTAAAAGATGATCTTTTGGAATATAAAATGAAAGAAAGAGA
ACCAATTTCGGTGCGTTTAGGAGATGACAGCACATTGTATACGTTACCTC
CACCATCAAGTGGTGTACTTGTTGCATTTAGCCTCAATGTTTTAACGGAT
TATAAATTCGACCCATCATCTACCGATTCCTGTGAAAATCTTGTGTTGTT
TTACCACAGATTAATTGAAACAATGAAATTTTCATTTGCCAAACGTTCAT
GTCTTGGTGACATAGATTTTCTTAATAACACAGATAAGGAGTTATTACGA
AATTTGACATCCGAGAGATACTCTAAAGAGATTATGTCTTTAATAACAGA
TAAGACTCACGAGGTTTCATATTATCAACCAAGTCATGTACCAAAAGAAG
ATCATGGCACCTCTCATTTCAGTCTGGTCAGTCCGGATGGAGATGCTGTT
TCTGTTACATCGACAATTAATTATCTTTTTGGATCATTTATTATGGGAAG
TAAAACCGGAATAGTTTATAACGATGAGATGGATGATTTTGCTACAAATA
AATCAAACACTTACGGTTTACCATCATCTCCCAATAATTTCATTGAGCGA
TATAAAAGGCCAATGTCATCCATGTCCCCAATTATCATTGTTGATAAAGA
AGGTAACGTTACTTTAGTTATTGGAGCATCTGGAGGAAGTAAAATACTTT
CATCTACAATACAAACTGCTGTTGTTGCCAAATTATTGAAAAAAAACATT
AAAGAGTCAATAGATTTTCCCCGAGTTCATAACCAATTATTTCCAAATGA
AGTTGTTGTTGAACAGAATTTCCCGGATGCTCTAATTAAAAGTCTGGTGG
AAAGAGGTCATGTGGTGAACAAAAATTTATATCCTGCAGTAGTTCAAGGC
ATAATGAAATCTTTGAATCCACAATATTCGTGGCAGTGCAATGCCGATCA
TAGGAAAAAGGGCATATGTGATGGAACTTAATGATTAGACACTTTTTAAT
TTATTATTTTCTGTAGCTTATTTGGTAGTTTCTTTTTTAACTTTTATATC
TTATATAAATATATAAATTTGACTTTTAAA
back to top

protein sequence of SMED30003824-orf-1

>SMED30003824-orf-1 ID=SMED30003824-orf-1|Name=SMED30003824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=611bp
MSGYENMLMLLDSPQTSTRNRKRSKMCLIISWVLTSVLVVVVIFLLIFYC
SPLNSTKKTCPLPTCTDSFMGIYKRTAVASDAKQCASVSNTIISVKGGNA
IDGAIAGLLCTCSVNFHSCGIAGGSLLLYYKKAEKKIFAFDIREMAPQLA
TPHMFENGDSSVHGGKSIAVTGLVAGYYEIHRRFGKINWKTLFEPTIDIL
EMGFPVSETIEEAIDYFFNNTNPPEFKELRDILTNPITGKPKRVGDIIKT
PKLAQTMRILSVEPYAMKNGSLVNDMIAEMTSGGSIILKDDLLEYKMKER
EPISVRLGDDSTLYTLPPPSSGVLVAFSLNVLTDYKFDPSSTDSCENLVL
FYHRLIETMKFSFAKRSCLGDIDFLNNTDKELLRNLTSERYSKEIMSLIT
DKTHEVSYYQPSHVPKEDHGTSHFSLVSPDGDAVSVTSTINYLFGSFIMG
SKTGIVYNDEMDDFATNKSNTYGLPSSPNNFIERYKRPMSSMSPIIIVDK
EGNVTLVIGASGGSKILSSTIQTAVVAKLLKKNIKESIDFPRVHNQLFPN
EVVVEQNFPDALIKSLVERGHVVNKNLYPAVVQGIMKSLNPQYSWQCNAD
HRKKGICDGT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0003840gamma-glutamyltransferase activity
GO:0036374glutathione hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR043138GGT_lsub_C
IPR043137GGT_ssub
IPR000101GGT_peptidase
IPR029055Ntn_hydrolases_N
Vocabulary: biological process
TermDefinition
GO:0006749glutathione metabolic process
GO:0006508proteolysis
GO:0006751glutathione catabolic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01210GGTRANSPTASEcoord: 509..526
score: 39.39
coord: 316..335
score: 37.5
coord: 99..124
score: 45.28
coord: 185..204
score: 32.95
coord: 445..463
score: 42.34
coord: 484..499
score: 50.0
coord: 167..185
score: 38.04
coord: 286..302
score: 34.49
coord: 421..439
score: 52.87
NoneNo IPR availablePFAMPF01019G_glu_transpeptcoord: 96..605
e-value: 6.5E-142
score: 473.9
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
IPR043138Gamma-glutamyltranspeptidase, large subunit, C-terminal domainGENE3DG3DSA:1.10.246.130coord: 302..413
e-value: 7.4E-32
score: 111.5
IPR043137Gamma-glutamyltranspeptidase, small subunitGENE3DG3DSA:3.60.20.40coord: 416..609
e-value: 1.4E-63
score: 216.1
IPR000101Gamma-glutamyltranspeptidasePANTHERPTHR11686GAMMA GLUTAMYL TRANSPEPTIDASEcoord: 26..605
IPR029055Nucleophile aminohydrolases, N-terminalSUPERFAMILYSSF56235N-terminal nucleophile aminohydrolases (Ntn hydrolases)coord: 71..608