Tyrosine-protein phosphatase-like protein

Overview
NameTyrosine-protein phosphatase-like protein
Smed IDSMED30003822
Length (bp)2760
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein phosphatase-like protein (SMED30003822) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase-like protein (SMED30003822) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003822

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30003822h1SMcG0016318 dd_10872dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30003822h1SMcG0016318 dd_Smed_v4_10872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003822h1SMcG0016318 dd_Smed_v4_10872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003822h1SMcG0016318 dd_Smed_v6_10872_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Human
Match: PTPRT (protein tyrosine phosphatase receptor type T [Source:HGNC Symbol;Acc:HGNC:9682])

HSP 1 Score: 69.3218 bits (168), Expect = 3.365e-11
Identity = 49/190 (25.79%), Postives = 87/190 (45.79%), Query Frame = 1
Query: 2071 YIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMS---NDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL----MNFTFMTREQYVFIY 2619
            YI +  P    + +F  ++W+EN   IVM++  +      C +YWPD   +  + GD     + L + +    + IRTFT++  K Y EI++++L++     +  +      +  F       N     P ++H ++       FI ID M+  + E    + IFN   +L    +N    T EQYVF++
Sbjct:  592 YIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPD---DTEVYGD---IKVTLIETEPLAEYVIRTFTVQ-KKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLD-MAENEGVVDIFNCVRELRAQRVNL-VQTEEQYVFVH 772          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Human
Match: PTPRT (protein tyrosine phosphatase receptor type T [Source:HGNC Symbol;Acc:HGNC:9682])

HSP 1 Score: 68.9366 bits (167), Expect = 3.551e-11
Identity = 49/190 (25.79%), Postives = 87/190 (45.79%), Query Frame = 1
Query: 2071 YIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMS---NDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL----MNFTFMTREQYVFIY 2619
            YI +  P    + +F  ++W+EN   IVM++  +      C +YWPD   +  + GD     + L + +    + IRTFT++  K Y EI++++L++     +  +      +  F       N     P ++H ++       FI ID M+  + E    + IFN   +L    +N    T EQYVF++
Sbjct:  575 YIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPD---DTEVYGD---IKVTLIETEPLAEYVIRTFTVQ-KKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLD-MAENEGVVDIFNCVRELRAQRVNLV-QTEEQYVFVH 755          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 68.5514 bits (166), Expect = 4.925e-11
Identity = 66/272 (24.26%), Postives = 125/272 (45.96%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   E+  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  I+ML+K +      C +YWP    +A   GD    T+ +T E     ++IR FT+K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct: 1029 YFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEIVLPEWTIRDFTVKNIQT-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1291          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 68.5514 bits (166), Expect = 5.318e-11
Identity = 66/272 (24.26%), Postives = 125/272 (45.96%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   E+  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  I+ML+K +      C +YWP    +A   GD    T+ +T E     ++IR FT+K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct: 1030 YFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEIVLPEWTIRDFTVKNIQT-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1292          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 68.5514 bits (166), Expect = 5.552e-11
Identity = 66/272 (24.26%), Postives = 125/272 (45.96%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   E+  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  I+ML+K +      C +YWP    +A   GD    T+ +T E     ++IR FT+K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct: 1034 YFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEIVLPEWTIRDFTVKNIQT-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1296          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Celegans
Match: dep-1 (Receptor-type tyrosine-protein phosphatase dep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGJ9])

HSP 1 Score: 63.5438 bits (153), Expect = 3.211e-10
Identity = 44/195 (22.56%), Postives = 83/195 (42.56%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL-KYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF-----HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            + E+I +  P  +    F  + W++    I+ L+K +      C QYWPDH    VL GD     + +  EK ++ F IR   L K     R  + ++ ++ +   +         + +F     H + +    AP ++H ++    +  FI IDR+++    G   I +F    ++           +QY+FI+
Sbjct:  186 RREFIAAQGPLPTTRDHFWQMTWEQQCPAIIALTKCVEKGRDKCHQYWPDHENVPVLYGD---IEVTIVAEKEFDEFVIRDIRLEKSGPDGRVTRFVRHWHYMAWPDFGAPSHPNGIIQFSRMFRHHLPHSPHNAPTIVHCSAGVGRSGTFISIDRLLQSSSFG-DPIDVFGTVCEMRYERCQMVQNEQQYIFIH 376          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Celegans
Match: ptp-4 (Tyrosine-protein phosphatase 4 [Source:UniProtKB/Swiss-Prot;Acc:P28192])

HSP 1 Score: 58.5362 bits (140), Expect = 2.439e-8
Identity = 46/207 (22.22%), Postives = 82/207 (39.61%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSY----REIKQIQLYNSIDLVETNLEQIDEVVYKF----HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFT------FMTREQYVFIYSYFEHFL 2640
            +N YI +  P  S   +F  ++W+E  N IV ++  + + +  C QYWP         G+   + + L  E     FS R   LK +K+     R++ Q+      D        +   V+      H  S+   T P ++H ++    +  +I +D M + L+      R  N+   L +          T EQY+F +      +
Sbjct:  665 RNAYIATQAPLPSTFSDFWSMIWQERSNIIVCITNMVEDGKRKCDQYWPSQQDSPQTFGN---YQVTLVSESTNAHFSHRILDLKIAKAVPAVERKVHQLHFMGWPD------HGVPSSVFPLLSFVHYTSDIHSTGPVVVHCSAGVGRSGSYILVDSMRRHLI----SFRRLNVQGHLTHMRRQRAKLVQTLEQYIFCHEAIRQLI 858          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Celegans
Match: ptp-4 (Tyrosine-protein phosphatase 4 [Source:UniProtKB/Swiss-Prot;Acc:P28192])

HSP 1 Score: 58.151 bits (139), Expect = 2.945e-8
Identity = 46/207 (22.22%), Postives = 82/207 (39.61%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSY----REIKQIQLYNSIDLVETNLEQIDEVVYKF----HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFT------FMTREQYVFIYSYFEHFL 2640
            +N YI +  P  S   +F  ++W+E  N IV ++  + + +  C QYWP         G+   + + L  E     FS R   LK +K+     R++ Q+      D        +   V+      H  S+   T P ++H ++    +  +I +D M + L+      R  N+   L +          T EQY+F +      +
Sbjct:  711 RNAYIATQAPLPSTFSDFWSMIWQERSNIIVCITNMVEDGKRKCDQYWPSQQDSPQTFGN---YQVTLVSESTNAHFSHRILDLKIAKAVPAVERKVHQLHFMGWPD------HGVPSSVFPLLSFVHYTSDIHSTGPVVVHCSAGVGRSGSYILVDSMRRHLI----SFRRLNVQGHLTHMRRQRAKLVQTLEQYIFCHEAIRQLI 904          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Celegans
Match: T13H5.1 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EGJ3])

HSP 1 Score: 58.151 bits (139), Expect = 2.988e-8
Identity = 48/182 (26.37%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 2110 EFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLE---------QIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMN---FTFMTREQYVFIY 2619
            EF  +VW+   NCIVML+K    M   C QYWP      +      +  +  T+ K Y  F IRTF L  +++  E  + ++       E  L+         ++   V +F  M  + + AP ++H ++    +  F+ +D  ++L+ +  Q +  F     L+N       + EQY+FIY
Sbjct:  290 EFWRMVWELGSNCIVMLTKVFDFMRVMCLQYWP------LTKFQFREIEVETTEVKTYSHFVIRTFKL--TRTTPESIETRIVKHFHFTEWELDSFPYISAFIELRRRVRQF--MEKNPVEAPMVVHCSNGAGRSGAFLALDANLELMKKTGQ-LDFFEYAKTLVNSRPHLIDSVEQYMFIY 460          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Celegans
Match: T13H5.1 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EGJ3])

HSP 1 Score: 57.7658 bits (138), Expect = 3.354e-8
Identity = 48/182 (26.37%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 2110 EFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLE---------QIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMN---FTFMTREQYVFIY 2619
            EF  +VW+   NCIVML+K    M   C QYWP      +      +  +  T+ K Y  F IRTF L  +++  E  + ++       E  L+         ++   V +F  M  + + AP ++H ++    +  F+ +D  ++L+ +  Q +  F     L+N       + EQY+FIY
Sbjct:  246 EFWRMVWELGSNCIVMLTKVFDFMRVMCLQYWP------LTKFQFREIEVETTEVKTYSHFVIRTFKL--TRTTPESIETRIVKHFHFTEWELDSFPYISAFIELRRRVRQF--MEKNPVEAPMVVHCSNGAGRSGAFLALDANLELMKKTGQ-LDFFEYAKTLVNSRPHLIDSVEQYMFIY 416          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 67.781 bits (164), Expect = 4.349e-11
Identity = 66/279 (23.66%), Postives = 121/279 (43.37%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIK-NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IP+ E++   E  K  + +   +EYE  I   Q+    N  +  N+S     ++T          +VE +  S + I+  + +   K N Y+ +  P     ++F  + W+     IVM+++        C QYWP    E        Q  + +T+ +   ++SIRTF L  +     REIKQ+Q     D  V  +     + + +   ++  E + P ++H ++       +I ID M++  M+  + I I+     L    N+   T +QY+FI+
Sbjct: 1454 IPISEFANHIERLKSNDNQKFSQEYES-IEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGS-DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY-----GQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPE-SGPVIVHCSAGVGRTGCYIVIDSMLE-RMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIH 1723          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331239)

HSP 1 Score: 67.781 bits (164), Expect = 4.424e-11
Identity = 66/279 (23.66%), Postives = 121/279 (43.37%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIK-NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IP+ E++   E  K  + +   +EYE  I   Q+    N  +  N+S     ++T          +VE +  S + I+  + +   K N Y+ +  P     ++F  + W+     IVM+++        C QYWP    E        Q  + +T+ +   ++SIRTF L  +     REIKQ+Q     D  V  +     + + +   ++  E + P ++H ++       +I ID M++  M+  + I I+     L    N+   T +QY+FI+
Sbjct: 1457 IPISEFANHIERLKSNDNQKFSQEYES-IEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGS-DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY-----GQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPE-SGPVIVHCSAGVGRTGCYIVIDSMLE-RMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIH 1726          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331240)

HSP 1 Score: 67.781 bits (164), Expect = 4.579e-11
Identity = 66/279 (23.66%), Postives = 121/279 (43.37%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIK-NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IP+ E++   E  K  + +   +EYE  I   Q+    N  +  N+S     ++T          +VE +  S + I+  + +   K N Y+ +  P     ++F  + W+     IVM+++        C QYWP    E        Q  + +T+ +   ++SIRTF L  +     REIKQ+Q     D  V  +     + + +   ++  E + P ++H ++       +I ID M++  M+  + I I+     L    N+   T +QY+FI+
Sbjct: 1360 IPISEFANHIERLKSNDNQKFSQEYES-IEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGS-DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY-----GQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPE-SGPVIVHCSAGVGRTGCYIVIDSMLE-RMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIH 1629          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331241)

HSP 1 Score: 67.781 bits (164), Expect = 5.066e-11
Identity = 66/279 (23.66%), Postives = 121/279 (43.37%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIK-NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IP+ E++   E  K  + +   +EYE  I   Q+    N  +  N+S     ++T          +VE +  S + I+  + +   K N Y+ +  P     ++F  + W+     IVM+++        C QYWP    E        Q  + +T+ +   ++SIRTF L  +     REIKQ+Q     D  V  +     + + +   ++  E + P ++H ++       +I ID M++  M+  + I I+     L    N+   T +QY+FI+
Sbjct: 1352 IPISEFANHIERLKSNDNQKFSQEYES-IEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGS-DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY-----GQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPE-SGPVIVHCSAGVGRTGCYIVIDSMLE-RMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIH 1621          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331242)

HSP 1 Score: 67.781 bits (164), Expect = 5.247e-11
Identity = 66/279 (23.66%), Postives = 121/279 (43.37%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIK-NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IP+ E++   E  K  + +   +EYE  I   Q+    N  +  N+S     ++T          +VE +  S + I+  + +   K N Y+ +  P     ++F  + W+     IVM+++        C QYWP    E        Q  + +T+ +   ++SIRTF L  +     REIKQ+Q     D  V  +     + + +   ++  E + P ++H ++       +I ID M++  M+  + I I+     L    N+   T +QY+FI+
Sbjct: 1366 IPISEFANHIERLKSNDNQKFSQEYES-IEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGS-DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY-----GQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPE-SGPVIVHCSAGVGRTGCYIVIDSMLE-RMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIH 1635          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Zebrafish
Match: ptprjb.1 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-090304-1])

HSP 1 Score: 67.0106 bits (162), Expect = 2.360e-11
Identity = 64/285 (22.46%), Postives = 126/285 (44.21%), Query Frame = 1
Query: 1801 SIPVDEYSRKYEYFKEREFKP---LYKEYEELIS-EFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFIY 2619
            ++ V++Y    EYFK           +EYEEL S   Q++  + + I +   N  +N L  + S            + +N  H+P  N   + E+I +  P    + EF  ++W++NV  IVML+K        C +YWP            +  ++  T E   + ++IR F +K  K+  E + ++ ++     +  + +  E++  F  +  + +      +P ++H ++       FI ID +    +E    + I+ +  D+ M+   M  T +QYV+++
Sbjct:    4 ALKVEDYE---EYFKRNSADSNCGFAEEYEELKSVGTQQSKAAALAIENKAKNRYSNVLPYDASRVKLSMCGSPFDDYINANHVPGYNS--RKEFIAAQGPLPVTLNEFWRMIWEKNVYTIVMLTKCNEMGRVKCEKYWPSATSHY------NNISVTTTSEIELDDWTIRDFRIKNVKT-AETRYVRQFHFTAWPDHGVPETTEILIDFRHLVREHMDQYSRHSPTVVHCSAGVGRTGTFIAIDHL-SFQIERDSMVDIYGIVHDMRMHRALMVQTEDQYVYLH 275          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Zebrafish
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 68.9366 bits (167), Expect = 2.468e-11
Identity = 45/192 (23.44%), Postives = 89/192 (46.35%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTF---MTREQYVFIY 2619
             + YI +  P    + +F  ++W+E   CIVM++  +      C +YWPD   +A + GD   F +   + +    + +RTFTL+  + + E+++++ ++     +  +      +  F    +MSN     P ++H ++       +I ID M+  + E    + I+N    L +       T EQY+FI+
Sbjct:  666 PSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPD---DAEVYGD---FKVTFVEVEPLAEYVVRTFTLE-RRGFNEVREVKQFHFTGWPDHGVPYHATGLLSFIRRVKMSNPPTAGPIVVHCSAGAGRTGCYIVIDIMLD-MAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIH 849          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Zebrafish
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 68.9366 bits (167), Expect = 2.604e-11
Identity = 45/192 (23.44%), Postives = 89/192 (46.35%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTF---MTREQYVFIY 2619
             + YI +  P    + +F  ++W+E   CIVM++  +      C +YWPD   +A + GD   F +   + +    + +RTFTL+  + + E+++++ ++     +  +      +  F    +MSN     P ++H ++       +I ID M+  + E    + I+N    L +       T EQY+FI+
Sbjct:  676 PSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPD---DAEVYGD---FKVTFVEVEPLAEYVVRTFTLE-RRGFNEVREVKQFHFTGWPDHGVPYHATGLLSFIRRVKMSNPPTAGPIVVHCSAGAGRTGCYIVIDIMLD-MAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIH 859          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Zebrafish
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 68.9366 bits (167), Expect = 2.690e-11
Identity = 45/192 (23.44%), Postives = 89/192 (46.35%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTF---MTREQYVFIY 2619
             + YI +  P    + +F  ++W+E   CIVM++  +      C +YWPD   +A + GD   F +   + +    + +RTFTL+  + + E+++++ ++     +  +      +  F    +MSN     P ++H ++       +I ID M+  + E    + I+N    L +       T EQY+FI+
Sbjct:  640 PSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPD---DAEVYGD---FKVTFVEVEPLAEYVVRTFTLE-RRGFNEVREVKQFHFTGWPDHGVPYHATGLLSFIRRVKMSNPPTAGPIVVHCSAGAGRTGCYIVIDIMLD-MAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIH 823          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Zebrafish
Match: ptprt (protein tyrosine phosphatase receptor type T [Source:ZFIN;Acc:ZDB-GENE-101028-4])

HSP 1 Score: 67.3958 bits (163), Expect = 5.356e-11
Identity = 47/186 (25.27%), Postives = 85/186 (45.70%), Query Frame = 1
Query: 2071 YIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMS---NDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTFMTREQYVFIY 2619
            YI +  P    + +F  ++W+EN   IVM++  +      C +YWPD   E  + GD     + L + +    + IRTFT++  K + EI++I+ ++     +  +      +  F       N     P ++H ++       FI +D M+  + E    + IFN   +L +     REQYVF++
Sbjct:  155 YIATQGPMQETVRDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPD---ETEVYGD---IKVTLIETEPLAEYVIRTFTVQ-KKGHHEIREIRQFHFTSWPDHGVPCYATGLLGFIRQVKFLNPPDAGPIVVHCSAGAGRTGCFIAVDIMLD-MAESEGVVDIFNCIRELRS----QREQYVFVH 328          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 71.633 bits (174), Expect = 6.325e-12
Identity = 53/211 (25.12%), Postives = 102/211 (48.34%), Query Frame = 1
Query: 2032 IHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHE-MSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNL--TLDLMNFTFM-TREQYVFIYSYFEHFLSKYM 2652
            I +P  N+E+   YI    P  S + +F  +VW++N + I M+++++   +  C +YWP+ +G  + I +  Q T+ +T  ++ ESF +R   L+  +   E++QI   N     + +       +  F   M +   + P + H ++    +   IC+D M+ L+ +   E  I N+  T+ L     + T EQY+F Y    + L + +
Sbjct: 2201 IKMPVGNEELI--YIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMT--QHLESFVLRVLELEDVQG-EEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSGPIITHCSAGIGRSGTLICLDVMLALISK-DLEFDILNMVHTMRLHRHGMIQTEEQYIFCYQVILYILKRLL 2405          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 71.633 bits (174), Expect = 6.524e-12
Identity = 53/211 (25.12%), Postives = 102/211 (48.34%), Query Frame = 1
Query: 2032 IHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHE-MSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNL--TLDLMNFTFM-TREQYVFIYSYFEHFLSKYM 2652
            I +P  N+E+   YI    P  S + +F  +VW++N + I M+++++   +  C +YWP+ +G  + I +  Q T+ +T  ++ ESF +R   L+  +   E++QI   N     + +       +  F   M +   + P + H ++    +   IC+D M+ L+ +   E  I N+  T+ L     + T EQY+F Y    + L + +
Sbjct: 2302 IKMPVGNEELI--YIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMT--QHLESFVLRVLELEDVQG-EEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSGPIITHCSAGIGRSGTLICLDVMLALISK-DLEFDILNMVHTMRLHRHGMIQTEEQYIFCYQVILYILKRLL 2506          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 71.633 bits (174), Expect = 7.021e-12
Identity = 53/211 (25.12%), Postives = 102/211 (48.34%), Query Frame = 1
Query: 2032 IHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHE-MSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNL--TLDLMNFTFM-TREQYVFIYSYFEHFLSKYM 2652
            I +P  N+E+   YI    P  S + +F  +VW++N + I M+++++   +  C +YWP+ +G  + I +  Q T+ +T  ++ ESF +R   L+  +   E++QI   N     + +       +  F   M +   + P + H ++    +   IC+D M+ L+ +   E  I N+  T+ L     + T EQY+F Y    + L + +
Sbjct: 2250 IKMPVGNEELI--YIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMT--QHLESFVLRVLELEDVQG-EEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSGPIITHCSAGIGRSGTLICLDVMLALISK-DLEFDILNMVHTMRLHRHGMIQTEEQYIFCYQVILYILKRLL 2454          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 68.1662 bits (165), Expect = 7.906e-11
Identity = 41/166 (24.70%), Postives = 82/166 (49.40%), Query Frame = 1
Query: 2032 IHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHE-MSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLL 2526
            I +P  N+E+   YI    P  S + +F  +VW++N + I M+++++   +  C +YWP+ +G  + I +  Q T+ +T  ++ ESF +R   L+  +   E++QI   N     + +       +  F   M +   + P + H ++    +   IC+D M+ L+
Sbjct: 1866 IKMPVGNEELI--YIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMT--QHLESFVLRVLELEDVQG-EEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSGPIITHCSAGIGRSGTLICLDVMLALI 2026          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 67.781 bits (164), Expect = 8.333e-11
Identity = 41/166 (24.70%), Postives = 82/166 (49.40%), Query Frame = 1
Query: 2032 IHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHE-MSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLL 2526
            I +P  N+E+   YI    P  S + +F  +VW++N + I M+++++   +  C +YWP+ +G  + I +  Q T+ +T  ++ ESF +R   L+  +   E++QI   N     + +       +  F   M +   + P + H ++    +   IC+D M+ L+
Sbjct: 2013 IKMPVGNEELI--YIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMT--QHLESFVLRVLELEDVQG-EEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSGPIITHCSAGIGRSGTLICLDVMLALI 2173          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 68.1662 bits (165), Expect = 4.633e-11
Identity = 67/272 (24.63%), Postives = 124/272 (45.59%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   EI  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  IVML+K +      C +YWP    +A   GD    T+ +T E     ++IR F +K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct:  949 YFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEVVLPEWTIRDFVVKNMQN-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1211          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 68.1662 bits (165), Expect = 5.055e-11
Identity = 67/272 (24.63%), Postives = 124/272 (45.59%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   EI  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  IVML+K +      C +YWP    +A   GD    T+ +T E     ++IR F +K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct:  856 YFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEVVLPEWTIRDFVVKNMQN-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1118          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 68.1662 bits (165), Expect = 5.547e-11
Identity = 67/272 (24.63%), Postives = 124/272 (45.59%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   EI  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  IVML+K +      C +YWP    +A   GD    T+ +T E     ++IR F +K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct: 1042 YFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEVVLPEWTIRDFVVKNMQN-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1304          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Mouse
Match: Ptpn7 (protein tyrosine phosphatase, non-receptor type 7 [Source:MGI Symbol;Acc:MGI:2156893])

HSP 1 Score: 63.1586 bits (152), Expect = 5.965e-10
Identity = 50/203 (24.63%), Postives = 92/203 (45.32%), Query Frame = 1
Query: 2071 YIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITA---PFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIYSYFEHFLSKYMITI 2661
            YI +  P  + + +F ++VW+E+V+ IVML+ +L   +  C  YWP    E    G    F I + D K +  +++R  T+++ +  R +K I L+++    +T  E    ++    E+   E  A   P ++H ++       FI   R+    ++   E+ I  +   L         T EQY F++    H L+ Y   +
Sbjct:  165 YIATQGPMPNTVADFWEMVWQEDVSLIVMLT-QLREGKEKCVHYWPT---EEEAYGP---FQIRIQDMKEHPEYTVRQLTIQHQQECRSVKHI-LFSAWPDHQTP-ESAGPLLRLVAEVETPETAANSGPIVVHCSAGIGRTGCFIAT-RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLH----HTLALYAAQL 353          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Mouse
Match: Ptpn7 (protein tyrosine phosphatase, non-receptor type 7 [Source:MGI Symbol;Acc:MGI:2156893])

HSP 1 Score: 63.1586 bits (152), Expect = 5.965e-10
Identity = 50/203 (24.63%), Postives = 92/203 (45.32%), Query Frame = 1
Query: 2071 YIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITA---PFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIYSYFEHFLSKYMITI 2661
            YI +  P  + + +F ++VW+E+V+ IVML+ +L   +  C  YWP    E    G    F I + D K +  +++R  T+++ +  R +K I L+++    +T  E    ++    E+   E  A   P ++H ++       FI   R+    ++   E+ I  +   L         T EQY F++    H L+ Y   +
Sbjct:  165 YIATQGPMPNTVADFWEMVWQEDVSLIVMLT-QLREGKEKCVHYWPT---EEEAYGP---FQIRIQDMKEHPEYTVRQLTIQHQQECRSVKHI-LFSAWPDHQTP-ESAGPLLRLVAEVETPETAANSGPIVVHCSAGIGRTGCFIAT-RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLH----HTLALYAAQL 353          
BLAST of Tyrosine-protein phosphatase-like protein vs. UniProt/SwissProt
Match: sp|Q9W6V5|PTPRJ_CHICK (Receptor-type tyrosine-protein phosphatase eta OS=Gallus gallus OX=9031 GN=PTPRJ PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.597e-11
Identity = 67/272 (24.63%), Postives = 125/272 (45.96%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEM-----SNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYEEL S      +   EI  NR  N   N L  +IS            + +N  ++P  +   K  +I +  P  + I +F  ++W++N+  IVML+K +      C QYWPD   ++   GD     + +  E     ++IR F ++ + +  E   ++ ++     +  + +  +++  F  +     S + I +P L+H ++       FI IDR+I+ + E    + ++ +  DL M+   M  T +QYVF+
Sbjct: 1098 YFKKQQADSNCGFAEEYEELKSAGVHQPKFAAEIAENRGKNRYNNVLPYDISRVKLSNPSCTTDDYINANYMPGYSS--KKAFIAAQGPLPNTIEDFWRMIWEKNIYSIVMLTKCVEQARTKCEQYWPDKQSKS--YGD---IIVTMVSEVVLPEWTIRDFNVENADT-MESHTVRQFHFTSWPDHGVPETTDLLINFRHLVHEYSSQNPIDSPILVHCSAGVGRTGTFIAIDRLIQQI-EMENTVDVYGVVYDLRMHRPLMVQTEDQYVFL 1360          
BLAST of Tyrosine-protein phosphatase-like protein vs. UniProt/SwissProt
Match: sp|Q12913|PTPRJ_HUMAN (Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 2.365e-10
Identity = 66/272 (24.26%), Postives = 125/272 (45.96%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   E+  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  I+ML+K +      C +YWP    +A   GD    T+ +T E     ++IR FT+K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct: 1029 YFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEIVLPEWTIRDFTVKNIQT-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1291          
BLAST of Tyrosine-protein phosphatase-like protein vs. UniProt/SwissProt
Match: sp|Q64455|PTPRJ_MOUSE (Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 3.423e-10
Identity = 67/272 (24.63%), Postives = 124/272 (45.59%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEIT-----APFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYE+L        +   EI  NR  N   N L  +IS         +  + +N  ++P  +   K ++I +  P  + + +F  +VW++NV  IVML+K +      C +YWP    +A   GD    T+ +T E     ++IR F +K  ++  E   ++ ++     +  +    +++  F  +  D +      +P L+H ++       FI IDR+I   +E    + ++ +  DL M+   M  T +QYVF+
Sbjct:  930 YFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSK--QAQDYGD---ITVAMTSEVVLPEWTIRDFVVKNMQN-SESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLI-YQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFL 1192          
BLAST of Tyrosine-protein phosphatase-like protein vs. UniProt/SwissProt
Match: sp|P16621|LAR_DROME (Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.359e-10
Identity = 66/279 (23.66%), Postives = 121/279 (43.37%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIK-NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IP+ E++   E  K  + +   +EYE  I   Q+    N  +  N+S     ++T          +VE +  S + I+  + +   K N Y+ +  P     ++F  + W+     IVM+++        C QYWP    E        Q  + +T+ +   ++SIRTF L  +     REIKQ+Q     D  V  +     + + +   ++  E + P ++H ++       +I ID M++  M+  + I I+     L    N+   T +QY+FI+
Sbjct: 1454 IPISEFANHIERLKSNDNQKFSQEYES-IEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGS-DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY-----GQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPE-SGPVIVHCSAGVGRTGCYIVIDSMLE-RMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIH 1723          
BLAST of Tyrosine-protein phosphatase-like protein vs. UniProt/SwissProt
Match: sp|Q8BUM3|PTN7_MOUSE (Tyrosine-protein phosphatase non-receptor type 7 OS=Mus musculus OX=10090 GN=Ptpn7 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.172e-9
Identity = 50/203 (24.63%), Postives = 92/203 (45.32%), Query Frame = 1
Query: 2071 YIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITA---PFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIYSYFEHFLSKYMITI 2661
            YI +  P  + + +F ++VW+E+V+ IVML+ +L   +  C  YWP    E    G    F I + D K +  +++R  T+++ +  R +K I L+++    +T  E    ++    E+   E  A   P ++H ++       FI   R+    ++   E+ I  +   L         T EQY F++    H L+ Y   +
Sbjct:  165 YIATQGPMPNTVADFWEMVWQEDVSLIVMLT-QLREGKEKCVHYWPT---EEEAYGP---FQIRIQDMKEHPEYTVRQLTIQHQQECRSVKHI-LFSAWPDHQTP-ESAGPLLRLVAEVETPETAANSGPIVVHCSAGIGRTGCFIAT-RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLH----HTLALYAAQL 353          
BLAST of Tyrosine-protein phosphatase-like protein vs. TrEMBL
Match: A0A210PXZ6 (Tyrosine-protein phosphatase 10D OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07778 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.895e-18
Identity = 80/295 (27.12%), Postives = 138/295 (46.78%), Query Frame = 1
Query: 1792 KNYSIPVDEYSRK-YEYFKEREFKPLYKEYEELISEFQKTNRSN------IEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMN---FTFMTREQYVFIYSYFEHFLS 2643
            K   I V E++ K YE  K+   K  + E  +L+ E    ++++      + I++  +N    D +  +      E  E+ S+ +N  +IP  N   K EYI +  P +    +F  ++W++NV+ IVML++ +      C QYWP+ V E    GD     + +  E N   + IR  +L+     R++KQ+      D+   T    +   V    +  N  +  P ++H ++       FI +D +I+ L  GHQE+ IFN+ L + N       T +QY+FI+   + FLS
Sbjct: 1263 KARKIKVSEFAEKFYELSKDSNMK--FSEEVKLLKEISPVHKTSCAEEQAVRIKNRYTNILAFDHSR-VKLLPLDE--EDGSDYINANYIPGHNS--KREYIAAQGPLVCTKDDFWRMIWEQNVSVIVMLTQLVERGRRKCDQYWPEVVSEPFYFGD---LIVRIDSESNLPDYVIRVISLQLGDIQRQVKQLLYLAWPDMGTPTTSNSMLHFVESCRKHKNPSLHGPIVVHCSAGVGRTGTFIAVDHLIQKLNAGHQEVDIFNMVLGMRNERPNMVQTEDQYIFIHECIKDFLS 1547          
BLAST of Tyrosine-protein phosphatase-like protein vs. TrEMBL
Match: A0A4Y2BRM4 (Receptor-type tyrosine-protein phosphatase eta OS=Araneus ventricosus OX=182803 GN=PTPRJ PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.977e-13
Identity = 63/229 (27.51%), Postives = 107/229 (46.72%), Query Frame = 1
Query: 1996 ESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYN-SIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNF---TFMTREQYVFIYSYFEHFLSKYMITI*NI 2670
            +   N SN +N  +IP ++  I  EYI +  P  + + +F  +VW+++V  +VML++ +     +C +YWP   GE+ L GD     +    E    S  +R F ++Y    R I  +   N  +D    N       +    E  ++    P LIH ++       FI +DR+++ L +   +I I+N  L++  +      T EQYVFIYS  + F+    +   NI
Sbjct:  812 DGTSNRSNFINANYIPGESHII--EYIATQGPLPNTVNDFWTVVWQQSVPIVVMLTQCVERAVKNCEKYWPAS-GESKLYGD---IRVQTKQETMLTSHIMRVFLVQYQNQQRHIVHMHFTNWPVDGTPRNPVDFLHFIRLVREQVSERRPGPILIHCSAGVGRTGTFIAVDRLMQHL-QSKDDIDIYNTVLEMRRYRPHMVHTMEQYVFIYSCVQQFIQDASVPQENI 1033          
BLAST of Tyrosine-protein phosphatase-like protein vs. TrEMBL
Match: R7UGL4 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_127070 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.203e-12
Identity = 52/192 (27.08%), Postives = 91/192 (47.40%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQID---EVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTFM---TREQYVFIY 2619
            K EYI +  P    + EF  ++W++N + IVM++  L + +  C QYWP+   E VL GD     + L  E     + IR   +   +++REI+Q Q  +  D   ++L+Q     E V          +  P ++H ++       FI +DR+++ + E  QEI I+    ++     +      QY+FI+
Sbjct:  102 KTEYIAAQGPKSRTVNEFWRMIWEQNSSIIVMVTNLLEHGKAKCFQYWPNADSEPVLFGD---LQVQLRSESVIGKYIIRIIDVYLGETHREIRQFQFLSFPD--HSSLDQTSHFLEFVKTVRNCVRPTMPGPMVVHCSAGVGRTGTFIAVDRLLQQI-ETEQEIDIYGTVSEMRKHRVLMVQVESQYIFIH 287          
BLAST of Tyrosine-protein phosphatase-like protein vs. TrEMBL
Match: A0A091SM93 (Receptor-type tyrosine-protein phosphatase eta (Fragment) OS=Pelecanus crispus OX=36300 GN=N334_06898 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.953e-12
Identity = 70/272 (25.74%), Postives = 129/272 (47.43%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEM-----SNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYEEL S      +   E+  NR  N   N L  +IS     +      + +N  ++P  N   K  +I +  P  + I +F  ++W++N+  IVML+K +      C QYWPD   ++   GD    T+ +  E     ++IR FT++ S +  E   ++ ++ +   +  + +  +++  F  +     S + I +P L+H ++       FI IDR+I+ + E    + ++ +  DL M+   M  T +QYVF+
Sbjct:  372 YFKKQQADSNCGFAEEYEELKSAGVHQPKFAAELAENRGKNRYNNVLPYDISRVKLPDQSSAGDDYINANYMPGYNS--KKAFIAAQGPLPNTIEDFWRMIWEKNIYSIVMLTKCVEQARTKCEQYWPDKQSKS--YGD---ITVTIVSEIVLPEWTIRDFTIQKSNA-SESHTVRQFHFMSWPDHGVPETTDLLINFRHLVHEYSSQNPIDSPTLVHCSAGVGRTGTFIAIDRLIQQI-EMENTVDVYGVVYDLRMHRPLMVQTEDQYVFL 634          
BLAST of Tyrosine-protein phosphatase-like protein vs. TrEMBL
Match: A0A093PRE6 (Receptor-type tyrosine-protein phosphatase eta (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_09817 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.913e-12
Identity = 70/272 (25.74%), Postives = 126/272 (46.32%), Query Frame = 1
Query: 1837 YFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEM-----SNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFI 2616
            YFK+++        +EYEEL S      +   E+  NR  N   N L  +IS            + +N  +IP  N   K  +I +  P  + I +F  ++W++N+  IVML+K +      C QYWPD   ++   GD     + +  E     ++IR FT++ S +  E   ++ ++     +  + +  +++  F  +     S + + +P L+H ++       FI IDR+I+  ME    + ++ +  DL M+   M  T +QYVF+
Sbjct:  576 YFKKQQADSNCGFAEEYEELKSAGVHQPKFAAELPENRGKNRYNNVLPYDISRVKLSNESSGTGDYINANYIPGYNS--KKAFIAAQGPLPNTIDDFWQMIWEKNIYSIVMLTKCMEQARTKCEQYWPDK--QSKTYGD---IMVTMVSEIVLPEWTIRDFTVEKSNT-PENHTVRQFHFTSWPDHGVPETTDLLIDFRHLVHQYNSQNPVDSPTLVHCSAGVGRTGTFIAIDRLIQ-QMEMENTVDVYGVVYDLRMHRPLMVQTEDQYVFL 838          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Cavefish
Match: ptprjb.1 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-090304-1])

HSP 1 Score: 61.6178 bits (148), Expect = 6.887e-10
Identity = 63/283 (22.26%), Postives = 124/283 (43.82%), Query Frame = 1
Query: 1795 NYSIPVDEYSRKYEYFKEREFKP---LYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEI-----TAPFLIHFNSKRCVA----AIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFMTREQ 2604
            N S+ ++EY    +YF++++        +EYE+L        +S+     N+     N++  + S      S     + +N  +I   N   K EYI +  P  + + EF  ++W+++V+ IVML++        C +YWP        +G      +  T E   E ++I  FT+K  K+  E +Q++ ++     +  + +  EV+  F  +  + +      +P ++H     C        FI +D +I   +E    + IF +  D+ M+ T M + +
Sbjct:    2 NISVRIEEYE---DYFRKQQADSNCGFAEEYEDLKIVGTAQAKSSALAIENKGKNRYNNVLPDSSRVKLSPSGSPFDDYINANYIAGYNS--KKEYIAAQGPLPATVNEFWRMIWEKHVHTIVMLTRCNEQGRVKCEKYWPSQSKMYNNLG------VTNTSEIPLEDWTISDFTIKNVKT-AETRQVRHFHFTAWPDHGVPETTEVLINFRHLVREHMDQYSRNSPTVVH-----CAGVGRTGTFIALDHLI-FQIERDSMVDIFGIVYDMRMHRTLMVQTE 266          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Cavefish
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 63.929 bits (154), Expect = 6.984e-10
Identity = 43/184 (23.37%), Postives = 85/184 (46.20%), Query Frame = 1
Query: 2086 NPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTF---MTREQYVFIY 2619
             P    + +F  ++W+E   CIVM++  +      C +YWPD   +A + GD   F +   + +    + +RTFTL+  + + E+++++ ++     +  +      +  F    +MSN     P ++H ++       +I ID M+  + E    + I+N    L +       T EQY+FI+
Sbjct:  918 GPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPD---DAEVYGD---FKVTFVEVEPLAEYVVRTFTLE-RRGFNELREVKQFHFTGWPDHGVPYHATGLLSFIRRVKMSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLD-MAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIH 1093          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Cavefish
Match: ptprea (protein tyrosine phosphatase receptor type Ea [Source:ZFIN;Acc:ZDB-GENE-100714-1])

HSP 1 Score: 62.003 bits (149), Expect = 2.082e-9
Identity = 55/210 (26.19%), Postives = 94/210 (44.76%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDH-------VGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKY-----SKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLT---LDLMNFTFMTREQYVFIY-SYFEHFL 2640
            KN++I +  P    + +F  ++W++    IVML+      E  C QYWPD        V  AV     + FT+ +        ++IR F ++Y     SK+ R + Q+   +  D  V  +   + + + K  ++ N     P ++H ++       FI ID MI ++ E  Q++ +F       D  +    T  QY FIY +  E+FL
Sbjct:  102 KNKFIAAQGPKQETVSDFWRMIWEQKSATIVMLTNLKERKEDKCYQYWPDQGCWTYGNVRVAV-----EDFTVLV-------DYTIRKFCIQYQASDGSKTPRLVTQLHFTSWPDFGVPFSPIGMLKFLKKVKQV-NPSYAGPIVVHCSAGVGRTGTFIVIDGMIDMMHE-EQKVDVFGFVSKIRDQRSQLIQTDMQYSFIYQALLEYFL 297          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Cavefish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 62.3882 bits (150), Expect = 2.446e-9
Identity = 66/281 (23.49%), Postives = 112/281 (39.86%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKT-NRSNIEI---RSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IPV + +   E  K  +     +EYE +    Q T   SN+E+   ++  +N    D +  I    +G    +  N+  V          +N YI +  P    + +F  +VW++  N IVM++K        C QYWP    E           + + D     ++S+RTF L    S   RE++Q Q     D              +  +  N     P ++H ++       FI ID M++  M+  + + I+     +    N+   T +QYVFI+
Sbjct: 1269 IPVCDLADHIERLKANDGLRFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYV-----DGYRKQNAYIGTQGPLPETLSDFWRMVWEQRTNTIVMMTKLEEKSRVKCDQYWPSRGTETY-----GMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLE-RMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYVFIH 1538          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Cavefish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 62.3882 bits (150), Expect = 2.449e-9
Identity = 66/281 (23.49%), Postives = 112/281 (39.86%), Query Frame = 1
Query: 1804 IPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKT-NRSNIEI---RSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            IPV + +   E  K  +     +EYE +    Q T   SN+E+   ++  +N    D +  I    +G    +  N+  V          +N YI +  P    + +F  +VW++  N IVM++K        C QYWP    E           + + D     ++S+RTF L    S   RE++Q Q     D              +  +  N     P ++H ++       FI ID M++  M+  + + I+     +    N+   T +QYVFI+
Sbjct: 1247 IPVCDLADHIERLKANDGLRFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYV-----DGYRKQNAYIGTQGPLPETLSDFWRMVWEQRTNTIVMMTKLEEKSRVKCDQYWPSRGTETY-----GMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLE-RMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYVFIH 1516          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Sea Lamprey
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 70.8626 bits (172), Expect = 7.066e-13
Identity = 73/298 (24.50%), Postives = 120/298 (40.27%), Query Frame = 1
Query: 1789 EKNYSIPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKT-NRSNIEIRSNR---SNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSK--SYREIKQIQLYNSIDLVETNLEQIDEVVYKF-----HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLM-EGHQEIRIFNLTLDLM------NFTFMTREQYVFIYSYF 2628
            E +  IPV E++   E  K  +     +EYE +    Q T + SN+EI  ++   +N    D +  I +  +G    +  N+ N I          N YI S  P    + +F  +VW++  + IVM++K        C QYWP+   E+  +       + LTD     ++S R+FTL  S     R+++Q Q     D     + +    V  F         +     P ++H   +  V   F      + L M EGH      +L L +       N+   T EQY F+++  
Sbjct:  175 EMHPPIPVSEFAGHVERLKANDNMLFSQEYESIDPGQQFTWDHSNLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINA-NYI----DGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESYGL-----VQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPD---HGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFF-----VGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTAL 454          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Sea Lamprey
Match: PTPN12 (protein tyrosine phosphatase non-receptor type 12 [Source:HGNC Symbol;Acc:HGNC:9645])

HSP 1 Score: 59.3066 bits (142), Expect = 1.533e-9
Identity = 59/272 (21.69%), Postives = 112/272 (41.18%), Query Frame = 1
Query: 1897 FQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIK------------------------NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNY-ESFSIRTFTLKYSKSYREIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGH--QEIRIFNLTLDLMN---FTFMTREQYVFIY 2619
             Q+  R ++  RS+R+   T+           GE+ +N+  +     +PF++  +K                          YI +  P    +++F  ++W+ NV  IVM  +++      C +Y+     E + +G    FTI L ++++  E + IRT ++ Y    R + Q    N  D  V ++ + I E++    E  +DE  +P  +H ++          ID    LL  G   +   +FNL  D+         T++QY  ++
Sbjct:    1 LQRLRRQSMRYRSDRTYPTTS-----------GENEDNMRKNRYKDILPFEHSRVKLAIQLPAVNSDYINANFIKGVSNPRAYIATQGPLPHTLVDFWSMLWEHNVKVIVMACQEVEMGRKKCERYYALTQEEPLTLGP---FTISLVEKQHRGEDYCIRTLSVHYGNESRTVFQFHYSNWPDHDVPSSFDPILEMIAIMREYQDDE-DSPICVHCSAGCGRTGAICAIDYTRNLLKLGKIPENFSVFNLIQDMRTQRPSAVQTKDQYELVH 257          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000174.1 (pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 gene:ENSPMAG00000000154.1 transcript:ENSPMAT00000000174.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 9.358e-8
Identity = 71/301 (23.59%), Postives = 131/301 (43.52%), Query Frame = 1
Query: 1780 ETEEKNYSIPVDEYSRKYEYFKEREFKPLY---KEYEELISEFQKTNRSNIEIRSNRS-NTNTNDLTENISYCTNGESVENLSNS--LNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEI-----TAPFLIHFNSKRCVA-------AIFICIDRMIKLLMEGHQEIRIFNLTLDL-MNFTFM--TREQYVFIY 2619
            +T  K    PV  +S+  +Y+K+RE    Y   +EY+EL S  +        +  NR+ N  TN L  +++      SVE++ +S  +N  +I  +      EYI +  P      +F  +VW++ VN IVML+  +   +  C  YWP  +   V  GD     + +  +K    ++IR   +K      E + +  ++     +  +    + +  F  +    +       P ++H    RC +         FI +D +++ + +   EI I+ +  D+ M+   M  T  QY+FI+
Sbjct: 1106 DTSNKKKRNPV-PFSKFPDYYKKREADSGYLFSEEYQELSSVGKGQAMEAATLAENRTKNRYTNILPFDVTRV-KLASVEDIPHSDYINANYI--KGHSSSREYIAAQGPLAGTREDFWRMVWEQKVNQIVMLTNCVERGQPKCECYWPMDI-TPVRYGD---IGLVMEWDKPSPEWTIRHLVVKAQHKTDEKRSLYHFHFTAWPDHGVPDTTDSLTNFVRLFRTHVNTTNKGGPIVVHC---RCGSSAGVGRTGTFISLDHLLQDI-DKKPEIDIYGIVHDMRMSRVLMVQTEMQYIFIH 1394          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003525.1 (pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 gene:ENSPMAG00000003196.1 transcript:ENSPMAT00000003525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 9.638e-8
Identity = 44/189 (23.28%), Postives = 88/189 (46.56%), Query Frame = 1
Query: 1999 SVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSK----SYREIKQIQLYNSID-LVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLM-EGHQEI 2547
            S E  S+ +N  ++      I+  YI +  P  +   +F  ++W++  + IVM++K     +  C QYWP    +    GD    T+ + DEK Y    IRT ++ +SK        +  +QL +  D  V  +   + ++  + +  +    TA  ++H ++    +  +I +D +++ L  EGH ++
Sbjct:  449 SGEGESDYINASYVDGYKSSIR--YIAAQGPLENTAGDFWQMIWEKKSSVIVMVTKCEEMGKVKCFQYWPHPDEDKRAYGD---VTVTIMDEKPYADIVIRTLSISHSKHRGFGAHWVTHVQLVSWPDHGVPEDPNLLLKLRRRVNSFNGAGCTA-VVVHCSAGVGRSGTYIGLDCLVRQLENEGHVDV 631          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002738.1 (pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 gene:ENSPMAG00000002497.1 transcript:ENSPMAT00000002738.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.220e-7
Identity = 47/196 (23.98%), Postives = 86/196 (43.88%), Query Frame = 1
Query: 2062 KNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVA--AIFICIDRMIKLLMEGHQE-IRIFN----LTLDLMNFTFMTREQYVFIY 2619
            + +YI +  P     ++F  +VW+E  + IVM++  +      C +YWPD   +   +GD     + L   +    + IRTF++K  K Y +  +++ ++     +  +      +  F    + SN     P + H            ++ ID M++  M G +  I ++N    L L  +N    T EQYVFI+
Sbjct:   89 QRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWPDDTQQ---LGD---IAVTLLHTELLAEYVIRTFSVK-RKGYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPPEAGPIITHCRDSAGAGRTGCYVVIDVMLE--MAGREGVIDVYNCVRELRLQRVNMV-QTEEQYVFIH 274          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Nematostella
Match: EDO29984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T229])

HSP 1 Score: 72.7886 bits (177), Expect = 2.608e-14
Identity = 46/197 (23.35%), Postives = 87/197 (44.16%), Query Frame = 1
Query: 2053 DEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHE-----MSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            D     YI +  P  S+  +F  +VW+E  + IVML+  +   E  C QYWP     A         T+ L  ++ +  +++R+  L    + +E++ I  Y         + Q    + +F +       +   + P++IH ++      IF+ ID M++   E  + + I+N    +     +   T++QYVFI+
Sbjct:   26 DGTPKTYIAAQGPLESSCDDFWQMVWQEKCSVIVMLTGLIEGNELKCHQYWPSTDQPATY----GVLTVSLKKKEEFSDYTVRSLLLSKQGTLKEVRLIHQYQFTSWPHRGVPQQTAALLRFRKNIINRSPHVPKSGPWIIHCSAGVGRTGIFLVIDAMLRQAKE-KKVVDIYNYVYAIEEDRPYIIQTKDQYVFIH 217          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Nematostella
Match: EDO47893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL98])

HSP 1 Score: 72.4034 bits (176), Expect = 7.251e-14
Identity = 46/197 (23.35%), Postives = 87/197 (44.16%), Query Frame = 1
Query: 2053 DEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHE-----MSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            D     YI +  P  S+  +F  +VW+E  + IVML+  +   E  C QYWP     A         T+ L  ++ +  +++R+  L    + +E++ I  Y         + Q    + +F +       +   + P++IH ++      IF+ ID M++   E  + + I+N    +     +   T++QYVFI+
Sbjct:   55 DGTPKTYIAAQGPLESSCNDFWQMVWQEKCSVIVMLTGLIERNELKCHQYWPSTDQPAAY----GVLTVSLKKKEEFSDYTVRSLLLSKQGTLKEVRLIHQYQFTSWPHRGVPQQTAALLRFRKNIINRSPHVSESGPWIIHCSAGVGRTGIFLVIDAMLRQAKE-KKVVDIYNYVHSIEEDRPYIIQTKDQYVFIH 246          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Nematostella
Match: EDO47890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL95])

HSP 1 Score: 68.5514 bits (166), Expect = 3.630e-13
Identity = 45/186 (24.19%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2086 NPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEI-----TAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
             P  S+  +F  +VW+E  + IVML+  +   E  C QYWP     A         T+ L  ++ +  +++R+FT  Y  + + ++ I  Y         + Q    + +F +   D       + P++IH ++      IF+ ID M++   E  + + I+N    +     +   T++QYVFI+
Sbjct:    1 GPLESSCDDFWQMVWQEKCSVIVMLTGLIEGNELKCHQYWPSTDQPAAY----GVLTVSLKKKEEFSDYTVRSFTTFYRWTLKGVRLIHQYQFTSWPHRGVPQQTAALLRFRKNIIDRPPHVPESGPWIIHCSAGIGRTGIFLVIDAMLRQAKE-KKVVDIYNYVHSIEEDRPYIIQTKDQYVFIH 181          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Nematostella
Match: EDO35064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI6])

HSP 1 Score: 70.4774 bits (171), Expect = 1.756e-12
Identity = 53/194 (27.32%), Postives = 87/194 (44.85%), Query Frame = 1
Query: 2065 NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSY------REIKQIQLYNSIDL-VETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMI-KLLMEGHQEIRIFNLTLDLM-NFTFMTREQYVFIY 2619
             +YI +  P    I +F  L+W++    IVML      +  DC +YWP+   +    GD     + + D  +   +++RTF L + + +      RE+ Q Q     D  V  N   +    +K+    + E T P L+H  +       FI ID ++ +++MEG  ++  F   +    NF   T EQY FIY
Sbjct:   64 QKYIAAQGPLTETIKDFWRLIWEKGCTTIVMLGDTEHKLRSDCERYWPEDGHQE--YGD---VAVSVVDVTHMTDWTVRTF-LVWVRLHPECMDKREVTQFQFTAWPDQGVPENTAPLIIFHHKYRYHLSSEETGPILVHCGAGVGRTGTFIAIDSLMDQMMMEGVVDVYGFVAQMRTQRNFMVQTHEQYAFIY 251          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 68.1662 bits (165), Expect = 2.510e-12
Identity = 53/237 (22.36%), Postives = 103/237 (43.46%), Query Frame = 1
Query: 1936 NRSNTNTNDLTENISYCTNGESVENLSNS--LNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQL----YNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIY 2619
            N++NT+ N     + Y      +   S    +N  HI    D+    YI +  P  +   +F  ++W++ V  + M++      +  C +YWPD+  + + +G   +F + L  + NY+SF  R   +K+ +S + I+   L    +    +  + +E +  V Y    ++  +  AP ++H ++        I +D  +  LME  +   I     DL         T++QY+F Y
Sbjct:   53 NQANTDKNRYRNVLPYEATRVRLSGSSGEDYINANHIRVLVDDDTYHYIATQGPLPNTTKDFWQMIWEQGVEVVAMVTLDKEGGKVKCHRYWPDNTNQPLKLG--GRFEVSLLKQTNYDSFVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPRSPVEMVQFVAY-MRSLATSQ--APVVVHCSAGIGRTGALIAVDVALG-LMERDKPFDINQTIRDLREQRQGMIQTKDQYIFCY 283          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Medaka
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:NCBI gene;Acc:101160865])

HSP 1 Score: 72.4034 bits (176), Expect = 1.944e-12
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = 1
Query: 2065 NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTF---MTREQYVFIY 2619
            + YI +  P    + +F  +VW+E   CIVM++  +      C +YWPD   +A L GD   F +   + +    + +RTFTL+  + + E+++++ ++     +  +      +  F    +MSN     P ++H ++       FI ID M+  + E    + I+N    L +       T EQY+FI+
Sbjct:  980 SHYIATQGPVHETVYDFWRMVWQEQSACIVMVTNLVEVGRVKCYKYWPD---DAELYGD---FKVTFVEVEPLAEYVVRTFTLE-RRGFNEVREVKQFHFTGWPDHGVPYHATGLLSFIRRVKMSNPPTAGPIVVHCSAGAGRTGCFIVIDIMLD-MAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIH 1162          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Medaka
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:NCBI gene;Acc:101160865])

HSP 1 Score: 72.4034 bits (176), Expect = 1.955e-12
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = 1
Query: 2065 NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTF---MTREQYVFIY 2619
            + YI +  P    + +F  +VW+E   CIVM++  +      C +YWPD   +A L GD   F +   + +    + +RTFTL+  + + E+++++ ++     +  +      +  F    +MSN     P ++H ++       FI ID M+  + E    + I+N    L +       T EQY+FI+
Sbjct:  963 SHYIATQGPVHETVYDFWRMVWQEQSACIVMVTNLVEVGRVKCYKYWPD---DAELYGD---FKVTFVEVEPLAEYVVRTFTLE-RRGFNEVREVKQFHFTGWPDHGVPYHATGLLSFIRRVKMSNPPTAGPIVVHCSAGAGRTGCFIVIDIMLD-MAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIH 1145          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Medaka
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:NCBI gene;Acc:101160865])

HSP 1 Score: 72.4034 bits (176), Expect = 1.968e-12
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = 1
Query: 2065 NEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKF---HEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTF---MTREQYVFIY 2619
            + YI +  P    + +F  +VW+E   CIVM++  +      C +YWPD   +A L GD   F +   + +    + +RTFTL+  + + E+++++ ++     +  +      +  F    +MSN     P ++H ++       FI ID M+  + E    + I+N    L +       T EQY+FI+
Sbjct:  951 SHYIATQGPVHETVYDFWRMVWQEQSACIVMVTNLVEVGRVKCYKYWPD---DAELYGD---FKVTFVEVEPLAEYVVRTFTLE-RRGFNEVREVKQFHFTGWPDHGVPYHATGLLSFIRRVKMSNPPTAGPIVVHCSAGAGRTGCFIVIDIMLD-MAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIH 1133          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Medaka
Match: ptprc (protein tyrosine phosphatase receptor type C [Source:NCBI gene;Acc:101167945])

HSP 1 Score: 68.1662 bits (165), Expect = 4.109e-11
Identity = 48/199 (24.12%), Postives = 89/199 (44.72%), Query Frame = 1
Query: 2068 EYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL---KYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSN---DEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMN---FTFMTREQYVFIY-SYFEH 2634
            +YI +  P    +L+F  +VW++  + IVM+++        CAQYWP    E  +    ++F + LT EK +  ++IR  +L   +   S RE+  IQ    I   +  +    +++ K     N   +  + P ++H ++       +I ID M++ L E    + I+   + L            QY+ I+ +  EH
Sbjct:  752 KYIAAQGPKDETVLDFWRMVWEQQSSIIVMVTRCEEGNRIKCAQYWPSPDRETEIY---EEFIVKLTSEKEFPDYTIRHLSLTNKREKNSEREVTHIQF---ISWPDHGVPGEPQLLLKLRRRVNAFKNLFSGPIVVHCSAGVGRTGTYIGIDAMMEGL-EAEGRVDIYGYVVRLRRQRCLMVQVEAQYILIHQALLEH 943          
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Medaka
Match: ptprc (protein tyrosine phosphatase receptor type C [Source:NCBI gene;Acc:101167945])

HSP 1 Score: 68.1662 bits (165), Expect = 4.109e-11
Identity = 48/199 (24.12%), Postives = 89/199 (44.72%), Query Frame = 1
Query: 2068 EYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL---KYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSN---DEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMN---FTFMTREQYVFIY-SYFEH 2634
            +YI +  P    +L+F  +VW++  + IVM+++        CAQYWP    E  +    ++F + LT EK +  ++IR  +L   +   S RE+  IQ    I   +  +    +++ K     N   +  + P ++H ++       +I ID M++ L E    + I+   + L            QY+ I+ +  EH
Sbjct:  752 KYIAAQGPKDETVLDFWRMVWEQQSSIIVMVTRCEEGNRIKCAQYWPSPDRETEIY---EEFIVKLTSEKEFPDYTIRHLSLTNKREKNSEREVTHIQF---ISWPDHGVPGEPQLLLKLRRRVNAFKNLFSGPIVVHCSAGVGRTGTYIGIDAMMEGL-EAEGRVDIYGYVVRLRRQRCLMVQVEAQYILIHQALLEH 943          
BLAST of Tyrosine-protein phosphatase-like protein vs. Planmine SMEST
Match: SMESG000048775.1 (SMESG000048775.1)

HSP 1 Score: 1530 bits (3960), Expect = 0.000e+0
Identity = 792/816 (97.06%), Postives = 804/816 (98.53%), Query Frame = 1
Query:  214 IRKSGENRIYPKNYGISCRLNELVRFQIKFIKIETPLEIPFNVSCVEKCDWLKEMEISEKVTKDGLLINWTFNLNVVQYFVYILSNKYEQEAIILDKSQTSTFLATPKLNKTQQVCVAAINNKWETSIFKCKQIVKRFAVNYAIQNVSYEARSCQINLSWSNGILYNYVVDIIGTDNDICRTIIIQMINLTVVGYNTTCPQTDYFLWRRMKVLEVTNLPAYSTFNVNILLVDVDMMQTEVKTMSIRTKQGKSQGVQNLKLKIKSNNLIAISFSPPRRPNGVVDEYRVRIRPTKENFPVMENYTKKTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEFQNSMNFRSVSVNPTLTLDYLKLDFNGTLKHTKCPGEGILIDFVNVYNSDDCFVRILSIDNCRNFTENFSNPKKCRNFECLIFNFKSVSINISGTSFRNYPLKFRLRIFHISAQLDEIYSGVVGIQQFNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSVFSDVDIYETEEKNYSIPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTFMTREQYVFIYSYFEHFLSKYMITI 2661
            IRKSGENRIYPKNYGISCRLNELVRFQIKFIKI TPLEIPFNVSCVEKCDWLKE+EISEKVTK GLLINWTFNLNVVQYFVYILS +YEQEAIILDKSQTSTFLATPKLNKT+QVCVAAINNKWETSIFKCKQI+KRFAVNYAI+NVSYEARSCQINLSWSNGILYNYVVDIIGTDNDICRTIIIQMINLT+VGYNTTCPQTDYFLWRRMKVLEVTNLPAYSTFNVNIL VDVDMMQTEVKTMSIRTKQGKS+GVQNLKLKIKSNNLIAISFSPPRRPNGVVD+YRVRIRPTKE FPVMENYTKKTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEF+NSMNFRS+SVNPTLTLDYLKLDFNGTLKHTKCPGEGILIDFVNVYNSDDCFVRILSIDNCRNFTENFSNPKKCRNFECLIFNF+SVSINISGTSFRNY LKFRLRIFHISAQLDEIYSGVVGIQQF EIRYLFKILIFLLIFLSGILVVFISFKKIS +IFDKRKRN VFSDVDIYETEEKNYSIPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCT  ESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPD SNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTFMTREQYVFIYSYFEHFLSKYMITI
Sbjct:   59 IRKSGENRIYPKNYGISCRLNELVRFQIKFIKIRTPLEIPFNVSCVEKCDWLKEVEISEKVTKGGLLINWTFNLNVVQYFVYILSREYEQEAIILDKSQTSTFLATPKLNKTKQVCVAAINNKWETSIFKCKQIMKRFAVNYAIKNVSYEARSCQINLSWSNGILYNYVVDIIGTDNDICRTIIIQMINLTLVGYNTTCPQTDYFLWRRMKVLEVTNLPAYSTFNVNILPVDVDMMQTEVKTMSIRTKQGKSEGVQNLKLKIKSNNLIAISFSPPRRPNGVVDKYRVRIRPTKEIFPVMENYTKKTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEFRNSMNFRSISVNPTLTLDYLKLDFNGTLKHTKCPGEGILIDFVNVYNSDDCFVRILSIDNCRNFTENFSNPKKCRNFECLIFNFQSVSINISGTSFRNYSLKFRLRIFHISAQLDEIYSGVVGIQQFKEIRYLFKILIFLLIFLSGILVVFISFKKISSLIFDKRKRNFVFSDVDIYETEEKNYSIPVDEYSRKYEYFKEREFKPLYKEYEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTKEESVENLSNSLNVIHIPFQNDEIKNEYIVSFNPDSSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTFMTREQYVFIYSYFEHFLSKYMITI 874          

HSP 2 Score: 112.849 bits (281), Expect = 3.375e-25
Identity = 56/57 (98.25%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 RIKFSINLIKLIIEFNLIFGVVSDFIDLSEFYPTFVNNFETYFIQFSHFSPDTEIEV 173
            RIKFSINLIKLIIEFNLIFGVVSDFIDLSEFYPTFVNNFETYFIQFSHFSPDTEIE+
Sbjct:    3 RIKFSINLIKLIIEFNLIFGVVSDFIDLSEFYPTFVNNFETYFIQFSHFSPDTEIEI 59          
BLAST of Tyrosine-protein phosphatase-like protein vs. Planmine SMEST
Match: SMESG000049222.1 (SMESG000049222.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.739e-47
Identity = 134/488 (27.46%), Postives = 233/488 (47.75%), Query Frame = 1
Query:  247 KNYGISCRLNELVRFQIKFIKIETPLEIPFNVSC------------VEKCDWLKEMEISEKVTKDGLLINWT--FNLNVVQYFVYILSNKYEQEAIILDKSQTSTFLATPKLNKTQQVCVAAINNKWETSIFKCKQIVKRFAVNYAIQNVSYEARSCQINLSWSN-----GILYNYVVDIIGTDNDICR-TIIIQMI-NLTVVGYNTTCPQTDYFLWRRMKVLEVTNLPAYSTFNVNILLVDVDMMQTEVKTMSIRTKQGKSQGVQNLKLKIKSNNLIAISFSPPRRPNGVVDEYRVRIRPTKENFP------VMENY-TKKTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEFQNSMNFRS-VSVNPTL-TLDYLKLDFNGTLK-HTKCPGEGILIDFVNVYNSDDCFVRILSIDNCRNFTENFSNPKKCRNFECLIFNFKSVSINISGTSFRNYPLKFRLRIFHISAQLDEIYSGVVG 1617
            K+  I+C+ NE ++  +   K+   ++ PFN SC            ++  +  K ++IS ++    L  N T     +++ Y ++           I+  +  +T           Q+C+A+I+ KW T  F C+QI+  F     + N +  A    + LSW        I   Y+V + G +  +CR TIII M  N+ +   +  CP+ D   W  ++ LE+ +LPAYS F ++I+  + D  Q  + ++S+ TKQG+S  VQ L++K   +N + I F  P  PNG++++YR+RI   K N        ++E++ T KT   +N+ +   C  YS+E++PING   N G G+S+   F++     S +SVN    + + + L  N   + + +C   G     +N YN  DC + + +   CR      +  K C N   L F     S+    +    +  K++ +I  I+  + EI SG++G
Sbjct:   64 KDRKINCQTNETIQTNVTLRKVSKFMKTPFNASCDASDINSWEVRVIKVINGTKHIKISWEI----LPTNKTTAAAADIIYYLLHFTKTTGSYTHRIISSATPNTSFKDLNEKSWHQICIASIDRKWITGKFTCRQILTDFPTTGPVTNANASADVHAVYLSWHKPEYQYDIPQGYIVHVKGQNVSLCRHTIIISMTDNVPITTPDQACPKQDRQSWTELQTLEIKDLPAYSKFTISIIPFNRDKPQAPL-SISVVTKQGESSAVQELEIKRYKDNSMLIGFKEPSMPNGIIEKYRIRIIQRKINMCNETNQIILESHITGKTEGWVNLDNARNCGLYSLEVTPINGGHINGGLGKSSAISFRHQAAAPSPISVNVQFQSQNSISLHLNELHRINAQCQPMGFTATIINTYNQYDCAINVFTNARCREL--ELAINKSCSNVTYLPFGNHGASVKSVFSGVIRHQSKYKYKISLITDLIREINSGIIG 544          
BLAST of Tyrosine-protein phosphatase-like protein vs. Planmine SMEST
Match: SMESG000049097.1 (SMESG000049097.1)

HSP 1 Score: 181.03 bits (458), Expect = 1.250e-46
Identity = 135/481 (28.07%), Postives = 234/481 (48.65%), Query Frame = 1
Query:  247 KNYGISCRLNELVRFQIKFIKIETPLEIPFNVSCVEKCDW----LKEMEISEKVTKDGLLINWTFNL--NVVQYFVYIL--SNKYEQEAIILDKSQTSTFLATPKLNKTQ--QVCVAAINNKWETSIFKCKQIVKRFAVNYAIQNVSYEARSCQINLSWSN-----GILYNYVVDIIGTDNDICRTIIIQMI-NLTVVGYNTTCPQTDYFLWRRMKVLEVTNLPAYSTFNVNILLVDVDMMQTEVKTMSIRTKQGKSQGVQNLKLKIKSNNLIAISFSPPRRPNGVVDEYRVRIRPTKENFPVMEN-------YTKKTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEFQNSMNFRS-VSVNPTL-TLDYLKLDFNGTLKHTKCPGEGILIDFVNVYNSDDCFVRILSIDNCRNFTENFSNPKKCRNFECLIFNFKSVSINISGTSFRNYPLKFRLRIFHISAQLDEIYSGVV 1614
            K+  I+C+ NEL++  +   K    ++ PFNVSC E  D     ++E+ +  K  +  +++   F    +++ Y ++    +  Y    I    S  + + +   LN+    Q+C+A I+ KW T  F C+QI+  F     + N +  A    I LSW        I   Y+V + G +  +CRTI+I M  N+ +   N  CP+ +   W  ++ LE+ +LPA+S F +NI+  + D  Q  + ++S+ TKQG+S  VQ L++K  ++  + I F  P  PNG++++YR+RI   K N     N       +T KT   +N+ +   C  YS+E++PING   N G G+S+   F    +  S +SVN    + + + L  N   ++ +C   GI    +N  N  DC + I +   C     +  +   C+N + L F+   VSI    +       +++ +I  I+ Q+ E  S ++
Sbjct:   64 KDRKINCQGNELIQTNVTLRKGSKSIKSPFNVSC-EASDINVHEVREIRVIPKTNRITIILENPFAAAADIIYYLLHFTKTTGSYTHRII----SSATPYASFTDLNEKSWYQICIALIDRKWITGKFTCRQILTDFPTTGPVTNANASADVHAIYLSWHKPEYQYDIPQGYIVHVTGQNAQVCRTIVISMTDNVPITTPNQACPKQNRQSWTELQQLEIKDLPAHSKFTINIIPFNRDKPQAPL-SISVVTKQGESSAVQQLEIKRYNDKFMLIGFKEPSMPNGIIEKYRIRIIQLKINMCNETNQIIHESHFTGKTEGWVNLDNARNCGLYSLEVTPINGGHINGGLGKSSAISFSYPYSKPSPISVNVQFQSQNSISLHLNELHRNAQCQPIGISAAIINTNNHKDCAIIIFTNIKCDKLETDLIS--ICQNLKYLSFDNAWVSIKPVFSGIIQPRSEYKYQISRITDQIIETNSKII 536          
BLAST of Tyrosine-protein phosphatase-like protein vs. Planmine SMEST
Match: SMESG000049097.1 (SMESG000049097.1)

HSP 1 Score: 182.185 bits (461), Expect = 1.317e-46
Identity = 135/481 (28.07%), Postives = 234/481 (48.65%), Query Frame = 1
Query:  247 KNYGISCRLNELVRFQIKFIKIETPLEIPFNVSCVEKCDW----LKEMEISEKVTKDGLLINWTFNL--NVVQYFVYIL--SNKYEQEAIILDKSQTSTFLATPKLNKTQ--QVCVAAINNKWETSIFKCKQIVKRFAVNYAIQNVSYEARSCQINLSWSN-----GILYNYVVDIIGTDNDICRTIIIQMI-NLTVVGYNTTCPQTDYFLWRRMKVLEVTNLPAYSTFNVNILLVDVDMMQTEVKTMSIRTKQGKSQGVQNLKLKIKSNNLIAISFSPPRRPNGVVDEYRVRIRPTKENFPVMEN-------YTKKTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEFQNSMNFRS-VSVNPTL-TLDYLKLDFNGTLKHTKCPGEGILIDFVNVYNSDDCFVRILSIDNCRNFTENFSNPKKCRNFECLIFNFKSVSINISGTSFRNYPLKFRLRIFHISAQLDEIYSGVV 1614
            K+  I+C+ NEL++  +   K    ++ PFNVSC E  D     ++E+ +  K  +  +++   F    +++ Y ++    +  Y    I    S  + + +   LN+    Q+C+A I+ KW T  F C+QI+  F     + N +  A    I LSW        I   Y+V + G +  +CRTI+I M  N+ +   N  CP+ +   W  ++ LE+ +LPA+S F +NI+  + D  Q  + ++S+ TKQG+S  VQ L++K  ++  + I F  P  PNG++++YR+RI   K N     N       +T KT   +N+ +   C  YS+E++PING   N G G+S+   F    +  S +SVN    + + + L  N   ++ +C   GI    +N  N  DC + I +   C     +  +   C+N + L F+   VSI    +       +++ +I  I+ Q+ E  S ++
Sbjct:   64 KDRKINCQGNELIQTNVTLRKGSKSIKSPFNVSC-EASDINVHEVREIRVIPKTNRITIILENPFAAAADIIYYLLHFTKTTGSYTHRII----SSATPYASFTDLNEKSWYQICIALIDRKWITGKFTCRQILTDFPTTGPVTNANASADVHAIYLSWHKPEYQYDIPQGYIVHVTGQNAQVCRTIVISMTDNVPITTPNQACPKQNRQSWTELQQLEIKDLPAHSKFTINIIPFNRDKPQAPL-SISVVTKQGESSAVQQLEIKRYNDKFMLIGFKEPSMPNGIIEKYRIRIIQLKINMCNETNQIIHESHFTGKTEGWVNLDNARNCGLYSLEVTPINGGHINGGLGKSSAISFSYPYSKPSPISVNVQFQSQNSISLHLNELHRNAQCQPIGISAAIINTNNHKDCAIIIFTNIKCDKLETDLIS--ICQNLKYLSFDNAWVSIKPVFSGIIQPRSEYKYQISRITDQIIETNSKII 536          

HSP 2 Score: 159.458 bits (402), Expect = 1.798e-39
Identity = 79/215 (36.74%), Postives = 127/215 (59.07%), Query Frame = 1
Query: 2023 LNVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLSNMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTL--KYSKSYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSKRCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDL---MNFTFMTREQYVFIYSYFEHFLSKYM 2652
            +N  +IPF++DE K EYI S  P   ++ +F  ++W++N+N I+ML++ +   +F C QYWPD VGE V  G  +Q+ + L +EK  E    R+F++  K +   R I Q+ ++   D    NL+  D++++ F E  N+ +T P+LIH ++        I +DR+IK L+ G QEI I+   L+L    NF    + QY+FI+ Y  HF++KYM
Sbjct: 1235 INASYIPFKDDEKKVEYIASQGPIDDSLSDFWQMIWEQNINYIIMLTQTMEGDKFKCLQYWPDEVGETVTFGSNNQYNVTLVEEKEMEGHIERSFSVTNKVNNEERNIMQLHMHTWFDHSAPNLDYFDKLLFSFQEKVNNCVTHPYLIHCSAGVGRTGTLISLDRIIKDLVSGCQEINIYETVLELRHYRNFIVQRQAQYIFIHDYLNHFITKYM 1449          
BLAST of Tyrosine-protein phosphatase-like protein vs. Planmine SMEST
Match: SMESG000049200.1 (SMESG000049200.1)

HSP 1 Score: 178.718 bits (452), Expect = 6.341e-46
Identity = 130/479 (27.14%), Postives = 233/479 (48.64%), Query Frame = 1
Query:  247 KNYGISCRLNELVRFQIKFIKIETPLEIPFNVSCVEK---CDWLKEMEISEKVTKDGLLINW-TFNLNVVQYFVYIL--SNKYEQEAIILDKSQTSTFLATPKLNKT--QQVCVAAINNKWETSIFKCKQIVKRFAVNYAIQNVSYEARSCQINLSWSN-----GILYNYVVDIIGTDNDICRTIIIQMI-NLTVVGYNTTCPQTDYFLWRRMKVLEVTNLPAYSTFNVNILLVDVDMMQTEVKTMSIRTKQGKSQGVQNLKLKIKSNNLIAISFSPPRRPNGVVDEYRVRIRPTKENFPVMEN-------YTKKTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEFQNSMNFRS-VSVNPTL-TLDYLKLDFNGTLKHTKCPGEGILIDFVNVYNSDDCFVRILSIDNCRNFTENFSNPKKCRNFECLIFNFKSVSINISGTSFRNYPLKFRLRIFHISAQLDEIYSGVV 1614
            K+  I+C+ NE ++  +   K    ++ PFNVSC         ++E+ +  K  +  +++   +   +++ Y ++    +  Y    I    S  + + +   LN+    Q+C+A+I+ KW T  F C++I+  F     + N +  A    I LSW        I   Y+V + G +  +CRTI+I M  N+ +   +  CP+ D + W  ++ LE+ +LPA+S F +NI+  + D  Q  + ++S+ TKQG+S  VQ LK+K  ++N + I F  P  PNG++++YR+RI   K N     N       +T KT   +N+ +   C  YS+E++PING    +G G+S+   F    +  S +SVN    + + + L  N   ++ +C   G     +N  N  DC + I +   C     +  +   C+N + L F+   VSI    +       +++ +I  I+ Q+ E  S ++
Sbjct:   64 KDRKINCQTNETIQTNVTLRKGSKSIKSPFNVSCDASDINVHEVREIRVILKTNRITIILETPSAAADIIYYLLHFTKTTGSYTHRII----SSATPYASFTDLNEKSWHQICIASIDMKWITGKFTCRKILTDFPTTGPVTNANASADVHAIYLSWHKPEYQYDIPQGYIVHVTGQNAQVCRTIVISMTDNVPITTPDQACPKQDRYSWTELQQLEIKDLPAHSKFKINIIPFNRDKPQAPL-SISVVTKQGESSAVQQLKIKHYNDNFMFIGFKEPSMPNGIIEKYRIRIIQLKINVCNETNQIIHESHFTGKTEGWVNLDNARNCGLYSLEVTPINGGHIKDGLGKSSAISFSYPYSKPSPISVNVQFQSQNSISLHLNELHRNAQCQPMGFTAAIINANNHKDCAIIIFTNIKCDKLETDLIS--ICQNLKYLSFDNAWVSIKPVFSGIIQPRSEYKYQISRITDQIIETNSEII 535          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRT3.365e-1125.79protein tyrosine phosphatase receptor type T [Sour... [more]
PTPRT3.551e-1125.79protein tyrosine phosphatase receptor type T [Sour... [more]
PTPRJ4.925e-1124.26protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ5.318e-1124.26protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ5.552e-1124.26protein tyrosine phosphatase receptor type J [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dep-13.211e-1022.56Receptor-type tyrosine-protein phosphatase dep-1 ... [more]
ptp-42.439e-822.22Tyrosine-protein phosphatase 4 [Source:UniProtKB/... [more]
ptp-42.945e-822.22Tyrosine-protein phosphatase 4 [Source:UniProtKB/... [more]
T13H5.12.988e-826.37Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
T13H5.13.354e-826.37Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lar4.349e-1123.66gene:FBgn0000464 transcript:FBtr0081260[more]
Lar4.424e-1123.66gene:FBgn0000464 transcript:FBtr0331239[more]
Lar4.579e-1123.66gene:FBgn0000464 transcript:FBtr0331240[more]
Lar5.066e-1123.66gene:FBgn0000464 transcript:FBtr0331241[more]
Lar5.247e-1123.66gene:FBgn0000464 transcript:FBtr0331242[more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprjb.12.360e-1122.46protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprk2.468e-1123.44protein tyrosine phosphatase receptor type K [Sour... [more]
ptprk2.604e-1123.44protein tyrosine phosphatase receptor type K [Sour... [more]
ptprk2.690e-1123.44protein tyrosine phosphatase receptor type K [Sour... [more]
ptprt5.356e-1125.27protein tyrosine phosphatase receptor type T [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasgrf16.325e-1225.12Ras protein specific guanine nucleotide releasing ... [more]
rasgrf16.524e-1225.12Ras protein specific guanine nucleotide releasing ... [more]
rasgrf17.021e-1225.12Ras protein specific guanine nucleotide releasing ... [more]
rasgrf17.906e-1124.70Ras protein specific guanine nucleotide releasing ... [more]
rasgrf18.333e-1124.70Ras protein specific guanine nucleotide releasing ... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprj4.633e-1124.63protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj5.055e-1124.63protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj5.547e-1124.63protein tyrosine phosphatase, receptor type, J [So... [more]
Ptpn75.965e-1024.63protein tyrosine phosphatase, non-receptor type 7 ... [more]
Ptpn75.965e-1024.63protein tyrosine phosphatase, non-receptor type 7 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W6V5|PTPRJ_CHICK1.597e-1124.63Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q12913|PTPRJ_HUMAN2.365e-1024.26Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q64455|PTPRJ_MOUSE3.423e-1024.63Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|P16621|LAR_DROME4.359e-1023.66Tyrosine-protein phosphatase Lar OS=Drosophila mel... [more]
sp|Q8BUM3|PTN7_MOUSE4.172e-924.63Tyrosine-protein phosphatase non-receptor type 7 O... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PXZ62.895e-1827.12Tyrosine-protein phosphatase 10D OS=Mizuhopecten y... [more]
A0A4Y2BRM41.977e-1327.51Receptor-type tyrosine-protein phosphatase eta OS=... [more]
R7UGL41.203e-1227.08Uncharacterized protein (Fragment) OS=Capitella te... [more]
A0A091SM933.953e-1225.74Receptor-type tyrosine-protein phosphatase eta (Fr... [more]
A0A093PRE64.913e-1225.74Receptor-type tyrosine-protein phosphatase eta (Fr... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprjb.16.887e-1022.26protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprk6.984e-1023.37protein tyrosine phosphatase receptor type K [Sour... [more]
ptprea2.082e-926.19protein tyrosine phosphatase receptor type Ea [Sou... [more]
ptprfa2.446e-923.49protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa2.449e-923.49protein tyrosine phosphatase receptor type Fa [Sou... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa7.066e-1324.50protein tyrosine phosphatase receptor type Sa [Sou... [more]
PTPN121.533e-921.69protein tyrosine phosphatase non-receptor type 12 ... [more]
ENSPMAT00000000174.19.358e-823.59pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 g... [more]
ENSPMAT00000003525.19.638e-823.28pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 ge... [more]
ENSPMAT00000002738.11.220e-723.98pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO299842.608e-1423.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478937.251e-1423.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478903.630e-1324.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350641.756e-1227.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383042.510e-1222.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprk1.944e-1225.13protein tyrosine phosphatase receptor type K [Sour... [more]
ptprk1.955e-1225.13protein tyrosine phosphatase receptor type K [Sour... [more]
ptprk1.968e-1225.13protein tyrosine phosphatase receptor type K [Sour... [more]
ptprc4.109e-1124.12protein tyrosine phosphatase receptor type C [Sour... [more]
ptprc4.109e-1124.12protein tyrosine phosphatase receptor type C [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048775.13.375e-2597.06SMESG000048775.1[more]
SMESG000049222.11.739e-4727.46SMESG000049222.1[more]
SMESG000049097.11.250e-4628.07SMESG000049097.1[more]
SMESG000049097.11.317e-4628.07SMESG000049097.1[more]
SMESG000049200.16.341e-4627.14SMESG000049200.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003822 ID=SMED30003822|Name=Tyrosine-protein phosphatase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2760bp
AACGAATTAAATTTTCAATTAATTTAATAAAATTAATAATAGAATTTAAT
TTGATTTTTGGGGTCGTTTCAGATTTTATAGACCTGTCTGAATTTTATCC
GACATTTGTTAATAATTTCGAAACCTATTTCATTCAATTTTCACATTTCT
CCCCGGATACAGAAATAGAGGTAAATTTTGCCAGATGTCCCATTGACAAA
TTGTCAGTTCTAGATCCGGAAATCGGGCGAGAACAGAATTTATCCAAAGA
ATTATGGCATCTCGTGCAGACTAAATGAGTTGGTTAGATTTCAAATAAAA
TTCATTAAAATAGAAACCCCTTTGGAGATACCTTTTAACGTGTCATGCGT
TGAAAAATGTGATTGGTTAAAGGAAATGGAAATCAGCGAGAAAGTCACAA
AAGACGGCTTGCTAATAAATTGGACATTTAACTTAAATGTTGTTCAGTAT
TTTGTATATATTCTCTCGAACAAGTATGAGCAGGAAGCGATAATATTGGA
CAAGTCACAAACATCAACATTTTTAGCCACCCCCAAATTGAATAAGACTC
AGCAAGTTTGCGTTGCAGCAATAAATAACAAATGGGAAACAAGCATATTT
AAATGCAAACAAATTGTGAAAAGGTTTGCTGTAAATTATGCTATACAAAA
TGTTAGTTACGAGGCGAGAAGTTGTCAAATAAACCTTTCGTGGAGCAATG
GAATATTATATAATTATGTCGTGGACATCATTGGAACTGATAATGACATA
TGTCGAACAATAATTATACAAATGATAAATTTAACGGTAGTAGGTTATAA
CACAACTTGTCCACAGACAGACTACTTTCTATGGAGGAGAATGAAAGTTC
TGGAGGTTACTAATTTGCCTGCCTATTCAACCTTCAATGTCAACATCCTG
CTTGTCGATGTAGATATGATGCAAACCGAGGTCAAGACCATGAGCATACG
AACGAAACAAGGAAAAAGTCAGGGAGTACAAAATTTGAAATTAAAAATAA
AATCAAATAATTTAATTGCAATATCCTTTTCGCCACCTCGTAGACCGAAT
GGAGTTGTGGACGAATATAGAGTTAGAATAAGGCCAACAAAGGAAAATTT
TCCAGTTATGGAGAATTATACAAAAAAAACGACAATCGTTATAAATATAA
CGGACTTGTCAAAATGCGATTTTTATTCGGTTGAGATCAGCCCCATTAAC
GGGTGGGATTCAAACAACGGATCGGGAGAATCAACGCATTCCGAATTCCA
AAATTCTATGAATTTCCGTTCCGTATCAGTGAATCCAACCTTGACATTGG
ATTACCTTAAACTAGATTTTAATGGTACACTTAAACATACCAAATGTCCT
GGAGAAGGAATTCTCATTGACTTTGTCAATGTCTATAACTCAGATGATTG
TTTTGTGAGAATACTATCAATAGATAATTGTCGAAATTTCACAGAAAATT
TTTCAAACCCAAAGAAATGTAGAAATTTCGAATGTTTGATTTTTAACTTC
AAATCTGTGAGTATAAATATTTCTGGAACTTCATTTAGGAATTACCCCTT
GAAGTTCCGGTTACGTATATTTCACATTTCTGCTCAACTAGATGAGATTT
ATTCTGGAGTTGTGGGAATCCAACAATTTAATGAAATTAGGTATTTATTC
AAGATTCTAATATTTCTGCTCATCTTTTTATCGGGCATCCTGGTTGTTTT
TATTAGTTTTAAAAAAATAAGCAGGATAATATTTGATAAAAGAAAACGCA
ACTCTGTATTTTCAGATGTGGATATTTATGAAACTGAAGAGAAAAATTAT
TCCATTCCGGTAGATGAATATTCAAGAAAATACGAATACTTCAAAGAAAG
AGAATTTAAGCCCCTTTATAAGGAATATGAAGAACTTATTTCTGAATTCC
AAAAGACCAATCGTTCTAATATTGAAATTCGATCCAACCGATCAAATACC
AATACAAATGATCTTACAGAAAATATCAGCTATTGCACGAATGGAGAATC
TGTAGAAAATCTAAGTAATTCTTTGAACGTAATTCATATCCCATTTCAAA
ATGATGAGATCAAAAATGAATACATTGTATCATTCAACCCGGATTTGAGC
AATATCCTAGAATTCTTGGACTTGGTCTGGAAGGAAAACGTTAACTGCAT
TGTGATGCTTTCGAAAAAGTTGTCAAACATGGAATTCGATTGCGCTCAAT
ATTGGCCCGACCATGTTGGGGAGGCTGTGCTAATCGGGGACCCAGATCAG
TTTACAATATTTCTTACTGATGAAAAGAACTATGAGTCTTTCAGTATTCG
AACGTTCACTCTCAAATACTCAAAAAGTTATAGAGAAATCAAACAAATTC
AGTTGTATAATTCAATAGACCTGGTGGAGACAAATCTAGAGCAAATAGAT
GAAGTCGTTTACAAATTTCATGAAATGAGCAATGATGAAATTACCGCTCC
ATTTCTGATTCATTTCAATTCGAAAAGATGCGTAGCGGCCATATTTATTT
GCATAGATCGGATGATAAAACTTTTGATGGAGGGCCATCAGGAAATTCGT
ATTTTTAACTTAACTTTGGATTTAATGAATTTTACATTTATGACAAGAGA
ACAATACGTATTTATTTACAGTTACTTTGAACATTTCTTGTCGAAATATA
TGATAACTATATGAAATATCAGTAAAAGCTATTGTAAATATGTTCGCTGA
CATTTTGACATTATATATAAATAATACCGAGTTTAAAATTTCCGAAATGA
AATAATTCTG
back to top

protein sequence of SMED30003822-orf-1

>SMED30003822-orf-1 ID=SMED30003822-orf-1|Name=SMED30003822-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=763bp
MEISEKVTKDGLLINWTFNLNVVQYFVYILSNKYEQEAIILDKSQTSTFL
ATPKLNKTQQVCVAAINNKWETSIFKCKQIVKRFAVNYAIQNVSYEARSC
QINLSWSNGILYNYVVDIIGTDNDICRTIIIQMINLTVVGYNTTCPQTDY
FLWRRMKVLEVTNLPAYSTFNVNILLVDVDMMQTEVKTMSIRTKQGKSQG
VQNLKLKIKSNNLIAISFSPPRRPNGVVDEYRVRIRPTKENFPVMENYTK
KTTIVINITDLSKCDFYSVEISPINGWDSNNGSGESTHSEFQNSMNFRSV
SVNPTLTLDYLKLDFNGTLKHTKCPGEGILIDFVNVYNSDDCFVRILSID
NCRNFTENFSNPKKCRNFECLIFNFKSVSINISGTSFRNYPLKFRLRIFH
ISAQLDEIYSGVVGIQQFNEIRYLFKILIFLLIFLSGILVVFISFKKISR
IIFDKRKRNSVFSDVDIYETEEKNYSIPVDEYSRKYEYFKEREFKPLYKE
YEELISEFQKTNRSNIEIRSNRSNTNTNDLTENISYCTNGESVENLSNSL
NVIHIPFQNDEIKNEYIVSFNPDLSNILEFLDLVWKENVNCIVMLSKKLS
NMEFDCAQYWPDHVGEAVLIGDPDQFTIFLTDEKNYESFSIRTFTLKYSK
SYREIKQIQLYNSIDLVETNLEQIDEVVYKFHEMSNDEITAPFLIHFNSK
RCVAAIFICIDRMIKLLMEGHQEIRIFNLTLDLMNFTFMTREQYVFIYSY
FEHFLSKYMITI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR000242PTPase_domain
IPR013783Ig-like_fold
IPR029021Prot-tyrosine_phosphatase-like
IPR003961FN3_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0004721phosphoprotein phosphatase activity
GO:0008013beta-catenin binding
GO:0016787hydrolase activity
GO:0016790thiolester hydrolase activity
GO:0016791phosphatase activity
GO:0045294alpha-catenin binding
GO:0045295gamma-catenin binding
GO:0045296cadherin binding
GO:0051393alpha-actinin binding
GO:0070097delta-catenin binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 423..676
e-value: 1.1E-6
score: 1.1
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 479..669
e-value: 1.6E-15
score: 57.4
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 417..674
score: 16.984
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 393..678
e-value: 1.7E-27
score: 98.5
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 473..679
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 102..214
e-value: 2.9E-9
score: 39.0
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 182..672
NoneNo IPR availableCDDcd00047PTPccoord: 483..668
e-value: 7.95698E-22
score: 91.9632
NoneNo IPR availableTMHMMTMhelixcoord: 343..365
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 120..217
score: 11.819
IPR003961Fibronectin type IIICDDcd00063FN3coord: 121..210
e-value: 2.15239E-4
score: 38.6315
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 21..201