Vitellogenin domain-containing protein

Overview
NameVitellogenin domain-containing protein
Smed IDSMED30003809
Length (bp)11527
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vitellogenin domain-containing protein (SMED30003809) t-SNE clustered cells

Violin plots show distribution of expression levels for Vitellogenin domain-containing protein (SMED30003809) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vitellogenin domain-containing protein (SMED30003809) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vitellogenin domain-containing protein (SMED30003809) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003809

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30003809h1SMcG0012529 SmedASXL_018034SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30003809h1SMcG0012529 dd_Smed_v4_636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003809h1SMcG0012529 dd_Smed_v4_636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003809h1SMcG0012529 dd_Smed_v4_636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003809h1SMcG0012529 dd_Smed_v4_636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003809h1SMcG0012529 dd_Smed_v4_636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003809h1SMcG0012529 dd_Smed_v4_636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003809h1SMcG0012529 Contig38662uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003809h1SMcG0012529 Contig38662newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003809h1SMcG0012529 Contig37387uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003809h1SMcG0012529 Contig37387newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003809h1SMcG0012529 Contig42106uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003809h1SMcG0012529 Contig42106newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30003809h1SMcG0012529 dd_Smed_v6_636_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30003809h1SMcG0012529 SMED30003809smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30003809h1SMcG0012529 SMED30003809smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30003809h1SMcG0012529 dd_Smed_v6_636_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30003809h1SMcG0012529 dd_Smed_v6_636_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003809h1SMcG0012529 dd_Smed_v4_636_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: AC099489.1 (novel lipoprotein amino terminal region containing protein)

HSP 1 Score: 163.31 bits (412), Expect = 7.418e-39
Identity = 169/691 (24.46%), Postives = 300/691 (43.42%), Query Frame = 3
Query:  111 SCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCA-RKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSD------KTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFL--------IEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPG-CVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQ--RGYSAVKLDTNILFX-XXXXXXXXXXXXXXDIFGRSVNILEFGIR---GKGISEKLFGR 2117
            SC ++C G         G  Y Y F +  +    +   E   L L G A +  +  C   L L +  +         + K+ + +   L    LRF    GRV  +C    +  + +NVK+A++S LQ    +   P    E DI G C T Y    +      + K K +A C+ R+ +  S+L  +             L     C ++  R+  L+E+ C E     P  +       +T S + + HE+  D         +  +      +   ++ P   +        + ++LC+       + E   LF+  +  L  +    + E+ +Y   + +C  N   L    +DALP    E     +        +E   ++ +    ++F    T  ++ +    +  P+    A L +S+++ + C    G C   P +   +  L   +  +C      D++K+   L+A+GN+G       L   L +C S + S  ++++ A++A R+ PC AD  + L ++Y  +   +E+RI AYL+L+RCP  E F ++ +    E + Q+GSFVWSHI  L+ET D  K  LRD L     P + L+++F+ +   +S   + TF+   G     L+  +LFS  S +P S + N+++   GR+ N+LE G+R    + I+ +LFGR
Sbjct:   34 SCMTACTGSAGP-HLPVGTRYTYHFSTNTSTSLQDVLVEGSGLGLQGLAVLDVLGLCQMALWLQDFQVTSILGAKVELLKESESLSATLGRNPLRFILHSGRVAHLCPHPTEPRWVLNVKRAVLSLLQGHPGAHS-PKTFDEVDILGRCPTTYQHHGD-----WLHKTKDLARCSLRRGR--SSLHSQALPGVAPG-----LTSRLTC-VQSFRAGVLREASCTELDSAGPLPAKASAVQMRTLSSLSLLHEMPQDPAGTDPDDRDDEDMTPSSLLYEWEETP--SQAMVATAATLVRRLCLA---QTTSLEAMDLFLTLVSQLQGLSGGELMELWQY--SSFKCRDNGQPL----LDALPSCGTEHCVGLMKELIASAAVEADEVEAWLS-SLAFLPQPTDAMVHMLLPLLQTPRASPGAFLGISALVHNLCASLDGPCGQLPGVGSLVRILGDALGENCTIQEPSDDDKLQLVLKAVGNAG--LAAMALTPTLSACASLRSSTPEIRLGAIQAFRRVPCSAD-RSVLSRLYQSLEEDAEIRINAYLALMRCPSEEVFAQVRRTQAGELSTQVGSFVWSHILQLLETHDPLKRALRDTL-----PEDILSQEFHPEMWKHSSYSDVTFRSVSGSLGANLEGTLLFSPASFLPRSATVNLTIHTMGRAFNLLELGLRLENAEEIAHRLFGR 689          

HSP 2 Score: 70.0922 bits (170), Expect = 1.273e-10
Identity = 75/262 (28.63%), Postives = 119/262 (45.42%), Query Frame = 2
Query: 9806 RKLLP-PFSKTAWVLDGNSILTFDGNAIKIGSGQC-SYLLARDFKKGSFSLVMN-VDSKNNKIEYELSYINKIVIRNDGRVSVDGKIVNILPA-VFKDEKRNFAIYRND-DLVKIKTSEGIVIKYFNEFKSLKIMAIGFW-HGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSL-GKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRC 10570
            R+LL  P+   A V     ++TFDG    + S QC S LLA+DF   +FSL ++   S    +  EL++   I+  +     +     + LP     D K + A  R D   +++ + +G+ +   +    L  + +G W HG   GLLG+ND E  N+L  P G +      LS +W + G C A  K      +    QL  C   F     S L+ CF +++P P+ +LC +     P    E +   C+L+  Y+  C
Sbjct: 3004 RRLLAGPWEYHALVAGAQHVVTFDGRVWDL-STQCGSILLAQDFAHNTFSLTLSRTGSGLTALFVELNHKTLILYPSLQAYRLYN---SSLPGDSCPDLKLHPATTRKDVSRIELASEDGVSVS-CDVPTGLCSLTLGLWQHGISAGLLGTNDNEAGNELMLPDGSMARSLEELSLAWQVGGDCRATEKP--QQEQACPGQLPACW-AFFEGPHSSLRDCFRVVDPTPFLSLCVQV----PCGTQELQP-ACNLAAAYIHLC 3252          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: APOB (apolipoprotein B [Source:HGNC Symbol;Acc:HGNC:603])

HSP 1 Score: 104.76 bits (260), Expect = 1.952e-21
Identity = 154/690 (22.32%), Postives = 297/690 (43.04%), Query Frame = 3
Query:  150 KYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVK------KDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVI-VKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKM-KRSEGLKESICKETQVFKPFS-SDKTGSKIEVKHEIRF-DTVK-NGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLC-MTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNE--EAFKFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILES----CVSSKVSQNDVKIFAVEALRQF-PCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIE-----KTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFG-RSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            +++  + Y Y++ +  +   P +        ++ K E+     C F LK S   LKE +  N   K      K+ +     +  Y L+    +G+ V +  +K +  + +N+K+ IIS+L V  ++ ++   L    + G+C T ++      N    +   + +  C R     + +S     + M      L+  S  C   +  + + + E+ICKE  +F PFS  +K G   +V   ++  DT K N +   E          +    +P    K+   VL   ++L  +T+ + N   ++A LF K +  L  +  + +  +     + S  SP    L+ L+    P       +  K +  +  L +     ++     +   ++   N   D +   + L  LS  + ++    P      +++   N L++ I++ C      D +     LR +GN G     + L   L+S    CV S      ++  A++ALR+  P   D +  L    DD S   + R+ AYL L+R P +    KI+Q L  E N+Q+ +FV SHI+N++ + +    +++DL ++  + + +      +DFR +S+N +            ++ K++ N++F  +  +P       ++  FG  S +++E G+ GKG     E LFG+  F+P
Sbjct:   45 RFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSP---PKQAEAVLKTLQELKKLTISEQNI--QRANLFNKLVTELRGLSDEAVTSLLPQLIEVS--SP--ITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQR-SRATLYALSHAVNNYHKTNPTG--TQELLDIANYLMEQIQDDC----TGDEDYTYLILRVIGNMG--QTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASP-GDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEE---LDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFP 712          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: APOB (apolipoprotein B [Source:HGNC Symbol;Acc:HGNC:603])

HSP 1 Score: 102.449 bits (254), Expect = 1.961e-20
Identity = 155/690 (22.46%), Postives = 298/690 (43.19%), Query Frame = 3
Query:  150 KYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVK------KDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVI-VKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKM-KRSEGLKESICKETQVFKPFS-SDKTGSKIEVKHEIRF-DTVK-NGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLC-MTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNE--EAFKFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILES----CVSSKVSQNDVKIFAVEALRQF-PCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIE-----KTFQRGYSAVKLDTNILFX-XXXXXXXXXXXXXXDIFG-RSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            +++  + Y Y++ +  +   P +        ++ K E+     C F LK S   LKE +  N   K      K+ +     +  Y L+    +G+ V +  +K +  + +N+K+ IIS+L V  ++ ++   L    + G+C T ++      N    +   + +  C R     + +S     + M      L+  S  C   +  + + + E+ICKE  +F PFS  +K G   +V   ++  DT K N +   E          +    +P    K+   VL   ++L  +T+ + N   ++A LF K +  L  +  + +  +     + S  SP    L+ L+    P       +  K +  +  L +     ++     +   ++   N   D +   + L  LS  + ++    P      +++   N L++ I++ C      D +     LR +GN G     + L   L+S    CV S      ++  A++ALR+  P   D +  L    DD S   + R+ AYL L+R P +    KI+Q L  E N+Q+ +FV SHI+N++ + +    +++DL ++  + + +      +DFR +S+N +            ++ K++ N++F  N+ +P       ++  FG  S +++E G+ GKG     E LFG+  F+P
Sbjct:   45 RFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSP---PKQAEAVLKTLQELKKLTISEQNI--QRANLFNKLVTELRGLSDEAVTSLLPQLIEVS--SP--ITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQR-SRATLYALSHAVNNYHKTNPTGT--QELLDIANYLMEQIQDDC----TGDEDYTYLILRVIGNMG--QTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDAS-PGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEE---LDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFP 712          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: AC099489.1 (novel lipoprotein amino terminal region containing protein)

HSP 1 Score: 78.5666 bits (192), Expect = 1.064e-13
Identity = 77/277 (27.80%), Postives = 124/277 (44.77%), Query Frame = 2
Query: 9806 RKLLP-PFSKTAWVLDGNSILTFDGNAIKIGSGQC-SYLLARDFKKGSFSLVMN-VDSKNNKIEYELSYINKIVIRNDGRVSVDG-KIVNI-LPA-VFKDEKRNFAIYRND-DLVKIKTSEGIVIKYFNEFKSLKIMAIGFW-HGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCV 10612
            R+LL  P+   A V     ++TFDG    + S QC S LLA+DF   +FSL ++   S    +  EL++   I+       S+   ++ N  LP     D K + A  R D   +++ + +G+ +   +    L  + +G W HG   GLLG+ND E  N+L  P G +      LS +W +G  D +        +    QL  C   F     S L+ CF +++P P+ +LC +     P    E +   C+L+  Y+  C    + +     CV
Sbjct:  193 RRLLAGPWEYHALVAGAQHVVTFDGRVWDL-STQCGSILLAQDFAHNTFSLTLSRTGSGLTALFVELNHKTLILY-----PSLQAYRLYNSSLPGDSCPDLKLHPATTRKDVSRIELASEDGVSVS-CDVPTGLCSLTLGLWQHGISAGLLGTNDNEAGNELMLPDGSMARSLEELSLAWQVGG-DCRATEKPQQEQACPGQLPACWAFFE-GPHSSLRDCFRVVDPTPFLSLCVQV----PCGTQELQP-ACNLAAAYIHLCARGFVPLAPPPQCV 455          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: KCP (kielin cysteine rich BMP regulator [Source:HGNC Symbol;Acc:HGNC:17585])

HSP 1 Score: 66.6254 bits (161), Expect = 1.165e-9
Identity = 64/261 (24.52%), Postives = 113/261 (43.30%), Query Frame = 2
Query: 9866 TFDGNAIKIGSGQCSYLLARDFKKGSFSL-VMNVDSKNNKIEY--ELSY-INKIVIR--NDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGS-NDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTS--QLQECENTFHPDSL-----------SYLKRCFSLINPEPYFALC-HRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGI 10585
            TFDG  +    G CSY+LA+D   G FS+ V N D   + + +  E++  +  + +R   DG V+VDG  V +    F  E   +   R   ++ +    G+ + +  + + +++   G + G   GL G+ N F + +DL  P GL+         SW + +       GL+  +  ++  ++  C    +               S   RC +++ PEP+FA C +     GP S ++    LC     Y   C+  G+
Sbjct: 1161 TFDGRLLHF-QGSCSYVLAKDCHSGDFSVHVTNDDRGRSGVAWTQEVAVLLGDMAVRLLQDGAVTVDGHPVAL---PFLQEPLLYVELRGHTVI-LHAQPGLQVLWDGQSQ-VEVSVPGSYQGRTCGLCGNFNGFAQ-DDLQGPEGLLLPSEAAFGNSWQVSE-------GLWPGRPCSAGREVDPCRAAGYRARREANARCGVLKSSPFSRCHAVVPPEPFFAACVYDLCACGPGSSADA--CLCDALEAYASHCRQAGV 1405          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: Apoltp (gene:FBgn0032136 transcript:FBtr0303874)

HSP 1 Score: 162.925 bits (411), Expect = 5.563e-39
Identity = 181/752 (24.07%), Postives = 318/752 (42.29%), Query Frame = 3
Query:   45 ACIIYVIFIA-SSAYSLN-LKPGESCA-SSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLE-------NSNVKKDYQMMKTLL------ENYS-----------------LRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKN---GKVSTETPN---TRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKK---NNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLI-----EDSNLQNFQDL--GISFFENTTPTIIKLFSN--KIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIEN--SCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMND-LTRKFNLDFRSYSKNIEKT--FQRGYSAVKLDTNILFXXXXXXXXXXXXX-XXDIFGRSVNILEFGIRGKGISEKLFGRFYPK 2129
            A I  ++ IA + A   N LK    C    C  K   F Y E ++Y Y +      +   S   +  L L    EI     C+  L++++  L +T  E       +S   K+Y     L       +NY                  LRF F DG +  +C  +++  + +N+KK I+S+ Q ++   D     TETD+SG C  +Y+      ++V ++K K I  C ++    S L    +    +     +L     CN+ +  +   KE  C ET +  PFS+  +G+       ++ D V++   G+   + P     R+ L  +H         K     +  A++L + + +    N   E   +F  F++    +DYKT+  + +     S C   +    N L+++LP   +  ++K +      E    Q   D    +SF        ++ F +  +    + D    L  ++++ SFC     C  N  +   +N L     N  + +    +  E+++  L+ LGN G   +     + L+  +    +  D+++  + A R+  C      FL   Y + +  SE+RI +YL  +RCP   +   I   L  E+  Q+GSFVWSH++NL +++   + E + LL      +ND L+ +F +D R +S+N E +  F         D N++F        I++   + D+FG+SVN  EF  R +G+ E     F PK
Sbjct:    8 AAIWLLLLIAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGE-QLYKYQYTVAVRTEFAGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSEKTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYALEDTDSSYVTIRKTKDINSCRQRYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNV-YKEIKCLETHLLVPFSNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERRATLVFDHTPAV-----KPSHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQ--RSASTCEQGR----NHLLESLPFIGSTASYKVMRDQIINEKLTKQMAHDWMTALSFITRPDEETLETFHSILEYAKNRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVILLKGLGNIGVVSS--AFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARHRSYFL-DNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSPVRIEAQGLL------LNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPK 737          

HSP 2 Score: 121.709 bits (304), Expect = 1.365e-26
Identity = 165/741 (22.27%), Postives = 305/741 (41.16%), Query Frame = 2
Query: 9356 LEKIMQTDIIKQRIKYYQ-----DAIKDSEETINLILSFKNKVLEYFKTSNAVTNILKTIEFIRSLKYKEAF---LNLVKLEETKLQMNLDEASIEFKMYVPPVSMTYFKILKTFTNWLPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAI-------KIGSG----QCSYLLARDFKKGSFSLVMNVDSKN---NKIEYELSYI-NKIVIRND---GRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKEL--LCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLN-------KKISDHELQKNSKFHYIFIIEQSKCIESYRVLIENLAKMMGLKSENIFTLLSFNGKDVYKEVHFKTINNKMYV--------NYDEIMKLLQE----AFSPEQLTSKMTEKKITEPGQ-----AIYDVIKMSSVPGFTEKIVLLTCSACSEHQ-KYGYSLLAGLLNNAGISISYLTTETFTGGNS----DVVGIANKMVYTFEKDKIKKVQWKRNIQLPSD---ACSALARLKDGNIWSLKPLVDDMRN--RRLSEVIHEE--LIKPKINSQTCYCMAGN 11386
            LEKI Q  I+ Q  KYY+     D + D  +  + +      V   F+  N   N L+T +  R  K K  F   + ++ LE+ KL M+    +              F+ +  +     +Q+F+      I  KL             Y        +  LPP+   A ++D    +TFD   +       ++G+G    QCSYLLA DF K +F+L++   SK+     +  +LS+I N  +I  D     +S++G    ILP    D      I+R+ D++ I +     +    +F        G++ G   GLLG+ + E  ++ +  +G+I+++  + + SWSL +C  +      + ++S      C + F       L  C ++++P P++ +C       P  +     +   C+ +  Y+  C +  + +R+   CV C   N +        ++S  E+ K+S    +FI+E  +C  + +             S+NI T++S     + +++    I N  Y          YD+   ++ E       PEQL                   AI    K++  PG ++  +LL+CS C+    ++ Y+ +   L   G+++  L    F    +       G+ +K+VY+ ++      + +    +P      C+ LA    G+++S + L  + +   +R + +  +   L    I SQTC C A N
Sbjct: 3606 LEKIDQVQIMVQ--KYYEVMAKVDWVADELQLEHRLHQVYGLVRNKFR--NYAMNALETADMYREAKTKFVFDPEVGIIDLEQ-KLPMSWHAFN----------ETPRFEEIPEYQVLAKAQSFFSETNSSIVMKL-------------YNMRTHLDPKTWLPPYYSRALLIDSRHYMTFDQRYVGLNLNFDELGNGRSTSQCSYLLAHDFFKRNFTLLLEPASKSLAGQGLTRKLSFIANGQLIEIDLETDHISINGNPQPILPLKLGD----VNIHRDLDVLSITSDTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSGVISNETQLFTDSWSLKQC--RQNKLAQTQEVSQEVSDACTSFFR---TGILATCSAVLDPTPFYEMCMDLGMKSPPIRKGHPAVKGACAAALAYIEACTALKVPMRVPSQCVFCQLSNGSYVPEGTFMELSGPEIPKSSDV--VFIVEAKECNANLKT------------SKNIMTVVS----SIEEQLQAAKITNNRYAVVAFGGVSPYDKARSVIYEHNEFTSKPEQLADYFGHINTGNGSSNDILMAISAAAKLNFRPGVSKTFILLSCSKCAARDMRFDYTSILQYLLEEGVNLHILADTEFDFERNKKLRHFFGLDSKLVYS-KRFPEGDAETRNTTHIPKSNLGICTTLAVETQGSVFSARKLQPERKYPIKRFATIFAKRVALSATPIQSQTCECSAHN 4290          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0345297)

HSP 1 Score: 114.39 bits (285), Expect = 2.065e-24
Identity = 211/903 (23.37%), Postives = 381/903 (42.19%), Query Frame = 3
Query:   51 IIYVIFIASSAYSLNLKPGESCASSC-RGKEKIFKYEEGKIYVYDFLSTHTIKN----PNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKR-SEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKE----------KIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIED-SNLQNFQDLGISFFENTTPTIIKLFSNKIGD---PKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGN----SGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTN---ILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPK--------------------------PHKNAHPDIVKMQKKSENKGEK----LSLGVYSRIMGREIFY---SPNVLSALTMSILNPNMKFYVDKSF------------------LLLDVIVSVSTITGFPIELTIE--SALSVDLSSNNMIKLGDINLSLQNNVA-----LQVIGKLQINAHC 2504
            I  +  +AS   ++ +    +C   C +    + KY  G  Y Y F S  TI      PN   +T  L++SG A+I     C + L+LS++ +  T  + S  KK    ++  ++ ++L  G  + +   IC D  D ++++N+K+A++S LQ  +++        E D+ G C T  ST  +  N  I+ K +++  C+ + +  S L   +  E        LL  +Y   IK  R    L E++ + T+ +K   + K  S I  K                +P T S +      ++ +F + E          K  + D+       +KK     E A+ FV+FIR L   D +T+ E+  +        PNK   + + +D L  T   E+ + +++  S     + L      N   ++ K   N+      P       + + +++  +C K       P+I     K    +++ C  +  ++ E+++Y L+ LGN    SGN       +  L  C S+  S N +++ A+ A  +  C   + +   ++  + +  SE+RI+AYLS I CP  E   +I + +N E   Q+G F+ S++  + +++D  + +     Q +      +T+ F +D+R YS N E +++     V   T+   I   +  +P S   NV+ + FG + N+ E  +R + + + L     PK                            ++   D+ K+ KK +  G K    L+L V  ++ G E+ +     N+ S+L   I+N     Y   SF                  L LD  ++  T  G P+EL  +  +A  VDL+    + L DIN  L+ N       L+ +  + INA+ 
Sbjct:    8 IALIGILASVLLTIAVNAENACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDT-SLKVSGSAKIFAKGNCGYTLQLSSVKVTNT--KESVEKKILNSIQKPVQ-FTLVSGILEPQ---ICSDSSDLDYSLNIKRAVVSLLQSGIEAEH------EVDVFGMCPTHTST-SKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANY---IKESRIVNHLIENV-QLTETYKFIGNTKRNSDISAKVVTILKLKNPSGTKANSPGTGSTV------RSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKK-----ETAKKFVEFIRLLRQSDSETLLELAAF------PHPNKVLARKVYLDGLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDKETLNQAASQLLPNAPKELYIAVGNLVAKYCLKN--YCQGPEIDAISKKFSDGLKH-CKPNTKREEERIVYILKGLGNAKSLSGN------TVAALSECASTGRS-NRIRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQ-----QKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLD-DIIN-----YFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLA----VSL-DINAILEQNWQKAKYRLKFVPSVDINANV 849          

HSP 2 Score: 58.5362 bits (140), Expect = 1.597e-7
Identity = 66/299 (22.07%), Postives = 120/299 (40.13%), Query Frame = 2
Query: 9824 FSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNK----IEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQE-CENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQK--NSKFHYIFIIE 10699
            F     V+DG  I TFDG       G C Y+LA+D    +F+++  + +   K    I+ E SY     + ++  + ++G +V      +         +R    + + +  G+ I   ++ K   I   GF+    +GLLG+ + E  +D     G +  ++  L   + +GKC   T     + +  +S+ QE C   F  +S   L   F  ++  PY   C   L     ++ E +   C+ +  Y    K     + L   C+ C          D    K  N+K   +F+++
Sbjct: 2784 FELRGHVVDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFE---VADNLALKLNGNLVE-----YPQHLSGLHAWRRFYTIHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGNDYGVGKC---TAIEFDNNQFKSSKRQEMCSELFGIEST--LAFNFITLDSRPYRKACDIAL--AKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEFTVKLPNNKVDVVFVVD 3066          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0334627)

HSP 1 Score: 114.39 bits (285), Expect = 2.065e-24
Identity = 211/903 (23.37%), Postives = 381/903 (42.19%), Query Frame = 3
Query:   51 IIYVIFIASSAYSLNLKPGESCASSC-RGKEKIFKYEEGKIYVYDFLSTHTIKN----PNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKR-SEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKE----------KIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIED-SNLQNFQDLGISFFENTTPTIIKLFSNKIGD---PKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGN----SGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTN---ILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPK--------------------------PHKNAHPDIVKMQKKSENKGEK----LSLGVYSRIMGREIFY---SPNVLSALTMSILNPNMKFYVDKSF------------------LLLDVIVSVSTITGFPIELTIE--SALSVDLSSNNMIKLGDINLSLQNNVA-----LQVIGKLQINAHC 2504
            I  +  +AS   ++ +    +C   C +    + KY  G  Y Y F S  TI      PN   +T  L++SG A+I     C + L+LS++ +  T  + S  KK    ++  ++ ++L  G  + +   IC D  D ++++N+K+A++S LQ  +++        E D+ G C T  ST  +  N  I+ K +++  C+ + +  S L   +  E        LL  +Y   IK  R    L E++ + T+ +K   + K  S I  K                +P T S +      ++ +F + E          K  + D+       +KK     E A+ FV+FIR L   D +T+ E+  +        PNK   + + +D L  T   E+ + +++  S     + L      N   ++ K   N+      P       + + +++  +C K       P+I     K    +++ C  +  ++ E+++Y L+ LGN    SGN       +  L  C S+  S N +++ A+ A  +  C   + +   ++  + +  SE+RI+AYLS I CP  E   +I + +N E   Q+G F+ S++  + +++D  + +     Q +      +T+ F +D+R YS N E +++     V   T+   I   +  +P S   NV+ + FG + N+ E  +R + + + L     PK                            ++   D+ K+ KK +  G K    L+L V  ++ G E+ +     N+ S+L   I+N     Y   SF                  L LD  ++  T  G P+EL  +  +A  VDL+    + L DIN  L+ N       L+ +  + INA+ 
Sbjct:    8 IALIGILASVLLTIAVNAENACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDT-SLKVSGSAKIFAKGNCGYTLQLSSVKVTNT--KESVEKKILNSIQKPVQ-FTLVSGILEPQ---ICSDSSDLDYSLNIKRAVVSLLQSGIEAEH------EVDVFGMCPTHTST-SKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANY---IKESRIVNHLIENV-QLTETYKFIGNTKRNSDISAKVVTILKLKNPSGTKANSPGTGSTV------RSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKK-----ETAKKFVEFIRLLRQSDSETLLELAAF------PHPNKVLARKVYLDGLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDKETLNQAASQLLPNAPKELYIAVGNLVAKYCLKN--YCQGPEIDAISKKFSDGLKH-CKPNTKREEERIVYILKGLGNAKSLSGN------TVAALSECASTGRS-NRIRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQ-----QKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLD-DIIN-----YFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLA----VSL-DINAILEQNWQKAKYRLKFVPSVDINANV 849          

HSP 2 Score: 58.5362 bits (140), Expect = 1.597e-7
Identity = 66/299 (22.07%), Postives = 120/299 (40.13%), Query Frame = 2
Query: 9824 FSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNK----IEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQE-CENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQK--NSKFHYIFIIE 10699
            F     V+DG  I TFDG       G C Y+LA+D    +F+++  + +   K    I+ E SY     + ++  + ++G +V      +         +R    + + +  G+ I   ++ K   I   GF+    +GLLG+ + E  +D     G +  ++  L   + +GKC   T     + +  +S+ QE C   F  +S   L   F  ++  PY   C   L     ++ E +   C+ +  Y    K     + L   C+ C          D    K  N+K   +F+++
Sbjct: 2784 FELRGHVVDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFE---VADNLALKLNGNLVE-----YPQHLSGLHAWRRFYTIHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGNDYGVGKC---TAIEFDNNQFKSSKRQEMCSELFGIEST--LAFNFITLDSRPYRKACDIAL--AKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEFTVKLPNNKVDVVFVVD 3066          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0345296)

HSP 1 Score: 114.39 bits (285), Expect = 2.065e-24
Identity = 211/903 (23.37%), Postives = 381/903 (42.19%), Query Frame = 3
Query:   51 IIYVIFIASSAYSLNLKPGESCASSC-RGKEKIFKYEEGKIYVYDFLSTHTIKN----PNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKR-SEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKE----------KIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIED-SNLQNFQDLGISFFENTTPTIIKLFSNKIGD---PKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGN----SGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTN---ILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPK--------------------------PHKNAHPDIVKMQKKSENKGEK----LSLGVYSRIMGREIFY---SPNVLSALTMSILNPNMKFYVDKSF------------------LLLDVIVSVSTITGFPIELTIE--SALSVDLSSNNMIKLGDINLSLQNNVA-----LQVIGKLQINAHC 2504
            I  +  +AS   ++ +    +C   C +    + KY  G  Y Y F S  TI      PN   +T  L++SG A+I     C + L+LS++ +  T  + S  KK    ++  ++ ++L  G  + +   IC D  D ++++N+K+A++S LQ  +++        E D+ G C T  ST  +  N  I+ K +++  C+ + +  S L   +  E        LL  +Y   IK  R    L E++ + T+ +K   + K  S I  K                +P T S +      ++ +F + E          K  + D+       +KK     E A+ FV+FIR L   D +T+ E+  +        PNK   + + +D L  T   E+ + +++  S     + L      N   ++ K   N+      P       + + +++  +C K       P+I     K    +++ C  +  ++ E+++Y L+ LGN    SGN       +  L  C S+  S N +++ A+ A  +  C   + +   ++  + +  SE+RI+AYLS I CP  E   +I + +N E   Q+G F+ S++  + +++D  + +     Q +      +T+ F +D+R YS N E +++     V   T+   I   +  +P S   NV+ + FG + N+ E  +R + + + L     PK                            ++   D+ K+ KK +  G K    L+L V  ++ G E+ +     N+ S+L   I+N     Y   SF                  L LD  ++  T  G P+EL  +  +A  VDL+    + L DIN  L+ N       L+ +  + INA+ 
Sbjct:    8 IALIGILASVLLTIAVNAENACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDT-SLKVSGSAKIFAKGNCGYTLQLSSVKVTNT--KESVEKKILNSIQKPVQ-FTLVSGILEPQ---ICSDSSDLDYSLNIKRAVVSLLQSGIEAEH------EVDVFGMCPTHTST-SKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANY---IKESRIVNHLIENV-QLTETYKFIGNTKRNSDISAKVVTILKLKNPSGTKANSPGTGSTV------RSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKK-----ETAKKFVEFIRLLRQSDSETLLELAAF------PHPNKVLARKVYLDGLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDKETLNQAASQLLPNAPKELYIAVGNLVAKYCLKN--YCQGPEIDAISKKFSDGLKH-CKPNTKREEERIVYILKGLGNAKSLSGN------TVAALSECASTGRS-NRIRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQ-----QKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLD-DIIN-----YFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLA----VSL-DINAILEQNWQKAKYRLKFVPSVDINANV 849          

HSP 2 Score: 58.5362 bits (140), Expect = 1.597e-7
Identity = 66/299 (22.07%), Postives = 120/299 (40.13%), Query Frame = 2
Query: 9824 FSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNK----IEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQE-CENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQK--NSKFHYIFIIE 10699
            F     V+DG  I TFDG       G C Y+LA+D    +F+++  + +   K    I+ E SY     + ++  + ++G +V      +         +R    + + +  G+ I   ++ K   I   GF+    +GLLG+ + E  +D     G +  ++  L   + +GKC   T     + +  +S+ QE C   F  +S   L   F  ++  PY   C   L     ++ E +   C+ +  Y    K     + L   C+ C          D    K  N+K   +F+++
Sbjct: 2784 FELRGHVVDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFE---VADNLALKLNGNLVE-----YPQHLSGLHAWRRFYTIHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGNDYGVGKC---TAIEFDNNQFKSSKRQEMCSELFGIEST--LAFNFITLDSRPYRKACDIAL--AKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEFTVKLPNNKVDVVFVVD 3066          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0089188)

HSP 1 Score: 114.39 bits (285), Expect = 2.065e-24
Identity = 211/903 (23.37%), Postives = 381/903 (42.19%), Query Frame = 3
Query:   51 IIYVIFIASSAYSLNLKPGESCASSC-RGKEKIFKYEEGKIYVYDFLSTHTIKN----PNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKR-SEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKE----------KIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIED-SNLQNFQDLGISFFENTTPTIIKLFSNKIGD---PKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGN----SGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTN---ILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPK--------------------------PHKNAHPDIVKMQKKSENKGEK----LSLGVYSRIMGREIFY---SPNVLSALTMSILNPNMKFYVDKSF------------------LLLDVIVSVSTITGFPIELTIE--SALSVDLSSNNMIKLGDINLSLQNNVA-----LQVIGKLQINAHC 2504
            I  +  +AS   ++ +    +C   C +    + KY  G  Y Y F S  TI      PN   +T  L++SG A+I     C + L+LS++ +  T  + S  KK    ++  ++ ++L  G  + +   IC D  D ++++N+K+A++S LQ  +++        E D+ G C T  ST  +  N  I+ K +++  C+ + +  S L   +  E        LL  +Y   IK  R    L E++ + T+ +K   + K  S I  K                +P T S +      ++ +F + E          K  + D+       +KK     E A+ FV+FIR L   D +T+ E+  +        PNK   + + +D L  T   E+ + +++  S     + L      N   ++ K   N+      P       + + +++  +C K       P+I     K    +++ C  +  ++ E+++Y L+ LGN    SGN       +  L  C S+  S N +++ A+ A  +  C   + +   ++  + +  SE+RI+AYLS I CP  E   +I + +N E   Q+G F+ S++  + +++D  + +     Q +      +T+ F +D+R YS N E +++     V   T+   I   +  +P S   NV+ + FG + N+ E  +R + + + L     PK                            ++   D+ K+ KK +  G K    L+L V  ++ G E+ +     N+ S+L   I+N     Y   SF                  L LD  ++  T  G P+EL  +  +A  VDL+    + L DIN  L+ N       L+ +  + INA+ 
Sbjct:    8 IALIGILASVLLTIAVNAENACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDT-SLKVSGSAKIFAKGNCGYTLQLSSVKVTNT--KESVEKKILNSIQKPVQ-FTLVSGILEPQ---ICSDSSDLDYSLNIKRAVVSLLQSGIEAEH------EVDVFGMCPTHTST-SKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANY---IKESRIVNHLIENV-QLTETYKFIGNTKRNSDISAKVVTILKLKNPSGTKANSPGTGSTV------RSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKK-----ETAKKFVEFIRLLRQSDSETLLELAAF------PHPNKVLARKVYLDGLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDKETLNQAASQLLPNAPKELYIAVGNLVAKYCLKN--YCQGPEIDAISKKFSDGLKH-CKPNTKREEERIVYILKGLGNAKSLSGN------TVAALSECASTGRS-NRIRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQ-----QKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLD-DIIN-----YFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLA----VSL-DINAILEQNWQKAKYRLKFVPSVDINANV 849          

HSP 2 Score: 58.5362 bits (140), Expect = 1.597e-7
Identity = 66/299 (22.07%), Postives = 120/299 (40.13%), Query Frame = 2
Query: 9824 FSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNK----IEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQE-CENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQK--NSKFHYIFIIE 10699
            F     V+DG  I TFDG       G C Y+LA+D    +F+++  + +   K    I+ E SY     + ++  + ++G +V      +         +R    + + +  G+ I   ++ K   I   GF+    +GLLG+ + E  +D     G +  ++  L   + +GKC   T     + +  +S+ QE C   F  +S   L   F  ++  PY   C   L     ++ E +   C+ +  Y    K     + L   C+ C          D    K  N+K   +F+++
Sbjct: 2784 FELRGHVVDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFE---VADNLALKLNGNLVE-----YPQHLSGLHAWRRFYTIHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGNDYGVGKC---TAIEFDNNQFKSSKRQEMCSELFGIEST--LAFNFITLDSRPYRKACDIAL--AKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEFTVKLPNNKVDVVFVVD 3066          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-106c3.3 (si:dkeyp-106c3.3 [Source:ZFIN;Acc:ZDB-GENE-070705-528])

HSP 1 Score: 90.1225 bits (222), Expect = 6.923e-18
Identity = 65/206 (31.55%), Postives = 106/206 (51.46%), Query Frame = 3
Query: 1581 DVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKGEK 2195
            ++++ A+ A R+ PCH D    L +V+       EVRI AY  L+ CP +E F  +   L+ E + Q+GSFVWSH+ N+ +T D  K  L + L     P + ++R F  +   YS +++ T   G +A  ++  ++FS    +PS    N++V I GR+ N+LE  +R + +   L   F  +P  +A       Q  S  K E+
Sbjct:    8 ELQLAAIRAFRRIPCHQD-RKVLAQVFQRQQENVEVRIAAYQQLMHCPNQEIFTLVKTTLSNEKSSQVGSFVWSHLFNIQKTEDPLKKYLMESL-----PDDIISRDFEAEPWKYSSHMDYTVDTGVAAANVEGALVFSPQSFLPSYAMANLTVFILGRAFNLLEISLRMENLEPLLKTVFEQQPLASADHSGPSAQADSVKKKER 207          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: apoba (apolipoprotein Ba [Source:ZFIN;Acc:ZDB-GENE-070702-4])

HSP 1 Score: 78.5666 bits (192), Expect = 2.014e-13
Identity = 182/869 (20.94%), Postives = 352/869 (40.51%), Query Frame = 3
Query:  171 YVYDFLSTHTIKNPNSEKETLQLE----LSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTL------LENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKM-KRSEGLKESICKETQVFKPFSSD-KTGSKIEVKHEIRF-DTVK-NGKVSTETPNTRSDLTMNH-GDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIEDSNLQNFQD---------LGISFFENTTPTIIK-LFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNF-HNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYPK-------------PH-------------------KNAHPDIVKMQKKS----ENKGEKLSLG----VYSRIMGREIFY-----------------------SPNVLSALTMSILNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQI 2492
            YVY +    T ++ N    T  L+    +S + EI     C F L+ +   L E  + ++  +  Y+           +E  +L F  D    V I  ++ + E  +N+K+ IIS+L V +   +    ++   I G C TE +        + V  ++ ++ C+  + +  + S       +      L+  +  CN +   R + + E+ C E  +F PFS + + G   EVK  +   D+VK N +   +       L +    D+ P+   + K  VL   K+L +TL  +  + ++A LF K +  +  +  +T+          SE          L    L     +E    +++   L+ F +           +S    ++P  ++ + S  +   K     +  L++ +K            P+ +  + K ++ +   C    + D +    TLR +G  G +   +  L   + +C+    +   V+  A++A R     +D+ + L + Y ++   ++ RI AYL L+R P  E    +++ L  E N+Q+ SFV SHI+N++E+ +   +  +D   I      D++    +DF   S+N +       S   +++N++F ++  +P  +    ++D F  +  ILE G+ G+G+    E LFG   F+P              PH                   +    DI+K  ++     +N+ E++        Y R+ G E+ Y                       S N +  L  S+ N   +F+V   ++ LD   ++ T  GFP++LT+   L+        I      LS   +V ++ I ++ +
Sbjct:   45 YVYQY----TAESKNGVTGTANLKNGPKISCQVEIEVPQTCSFVLRTTECVLSEVSVIDAQGQPVYRQAAGAEAFQAAMEKNTLNFVVDQVTSVSIYPEEDEPENILNIKRGIISALLVPVLEEEHNERMST--IHGICKTEVTVNSRKDIDIDVSVVRDLSDCSHFSPHSLSTSPLSLMPGLNGLFSKLIRSTQTCNYQFDNRRKHMTEAQCTEKHLFIPFSHEGQYGISSEVKQSLTLQDSVKINNRYFNKDDTLEKKLFIEEVEDKHPV---QSKDDVLATMKEL-ITLSSSGKSQQRASLFHKLVSEVRGLKNETLSGAADEMMKFSEW---------LTWQTLFQCGTDECTSAIMQI--LRTFDEADREVDAIVYALSLLPQSSPQRLRDMLS--MAQSKPSKPIMYALANTVKQLPQDQ--ATSTPE-VKEVAKFMEFMLGDC----SGDEDSTFLTLRVIGVMGKYMEGFPSLKSSVLNCMKQAYAPLPVQKAAIQAFRLMEMDSDVRSALIQQYQNVEAPAQKRIAAYLMLMRNP--EVAENVLRTLKSEQNEQVKSFVSSHIANILESENPNLSIAKDY--ILKAVQGDVSFP-PMDFTKLSRNYKTEVPLVGS---VESNVIFDSANYMPREVMLATTLDNF--NPEILEIGLEGEGLEPVIEVLFGENGFFPDTISKAMYWVNDKIPHPVKRVLEKWISPLNGERMKRQVPQDIMKSMEEYISEFKNRLEQVEDAPKGLAYLRLFGTELGYLKTSDLKHVTQYINLCAETFKSTSLNFMGKLISSLEN---EFFV--HYMFLDKAFTLPTSAGFPLKLTLSGVLAPGAKGGLTIDRMMQQLSFMPSVGVEFITQMGV 868          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-106c3.1 (si:dkeyp-106c3.1 [Source:ZFIN;Acc:ZDB-GENE-050411-73])

HSP 1 Score: 68.5514 bits (166), Expect = 2.240e-10
Identity = 70/317 (22.08%), Postives = 139/317 (43.85%), Query Frame = 2
Query: 9686 LPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFE----SLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDS-KNNKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVL--SKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEF-KELLCSLSRNYVMRCKSKGILIRLDKTCV 10612
            LP   +  V    +++ LLE F     +  N  S   E      R +  P +  A+++    +++FDG+  ++ +  C ++LA D  K +FS+ +     K   +  ++       I  +G V V+  + ++ P    +     A+ ++ + +++    G+ +   +  +   ++  G+ HG   GLLG+ND E SN+   P G  +H +G+L  + SW +       K  +   + +T+    C   F   + S L  CF +++P  +   C   L+     +++  K   CSL+  Y+  C    + + L   CV
Sbjct: 1798 LPEGPWLMVKDAGMTEVLLEEFVLKPLLALNSMSPTAELYRLKRRIMDSPANYQAFLVADVYLVSFDGHLFQLPAA-CDFILAADVTKNTFSIALKSGRFKRRSLVMQMQNTT-TAIHANGEVEVNCHVTHV-PYTNPE----VAVRKDVNFIEVSNGRGLWVSCDHHLEVCSVILDGWLHGVSSGLLGTNDNEGSNEQLLPDG--SHTSGLLQFAHSWQVDSECVSRKADV--CQNATADSLSCTFLF-SSTNSPLSPCFRVVDPVQFAMEC-EILECVRDERADVPKPAYCSLASAYIHVCHRNYVPLELPVQCV 2101          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: vtg3 (vitellogenin 3, phosvitinless [Source:ZFIN;Acc:ZDB-GENE-991019-2])

HSP 1 Score: 64.3142 bits (155), Expect = 3.722e-9
Identity = 153/659 (23.22%), Postives = 270/659 (40.97%), Query Frame = 3
Query:  396 FGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNF--VIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEG--LKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNG--KVSTETPNTRSDL---TMNHGDQAPLFMKKEKIPV---LDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIEDSNLQNF------QDLGISFFE-NTTPTIIKLFSNKI------GDPKFDNSALLTLSSMIKSFC---DKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILE--SCVSSKVSQNDVKIFAVEALRQFPCHAD--IDNFLWKVYDDISYLSEVRIQAYLSLIRC-PFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKF-NLDFRSYSKNIE-----KTFQRGYSAVKLDTNILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKN-AHPDIVKMQKKSEN----KGEKLSLGVYSRIMGREIF 2240
            F +  G++  I      +   VN+ + I+  LQV++ +  S   L E  I G C + Y T+ E  N   +IV +I  I  C +    +  ++    ++  + R  +++            ++G  + ++  +E Q F PF+      ++    +I    V +   KV T    +R +L   T       P+ M     PV   LD+ K+L       +  SE +   +  I+ +       ++ + K  + N E        +   +D +    +E   KFL       +       Q L ++F   +  P  + L    +        P   N+ +L   S++  +C   D  P  V+ P +  A + L K          N ++E VL  L++LGN+ +  ++K L+K L   S  + K+S   V+  AV+A R     A   + + +  ++      +E+R+ A + L+   P       + + L +E + Q+ SF +S +    ++       L     I    M  LTRK  +L +R YSKN+        F  G SA   D  +L + SPIP+ +         GR +  LEFGIR  G+ + LF    P+  K+    D+  + K   N      +K  L  Y+R+ G+E F
Sbjct:  116 FEYSKGQITDIRTAPGVSNTVVNIVRGILGFLQVTVKTTQSFYELIELGIHGLCQSSY-TVDEDSNAKELIVTRIVDITNCQQPASLYRGMALAPEDKLSKQRGESVVSTVKHTYTVKSTADGGQITKAFAQERQYFSPFNVKGGNFRMLALRDIELLKVSDTTDKVVTGQVQSRGNLMYKTNKDLKPIPVVMLNLNDPVPKILDLIKRLAQA-NIYHVDSETSTEILDLIQLMRVTTLDNLEHLWKQVSGNDEH-------RRWFLDLVVEVTDERILKFLEARYKAGDITANEAGQALVVAFNHLSAEPVSVALAQEFLTIPFSKSHPLLWNTVVLAYGSLVHRYCVYTDPCPITVVQPLLNMAASSLSK----------NSEDEMVL-ALKSLGNAAHLSSFKTLLKFLPGYSNGAEKLSTR-VQGAAVQAFRLLASRASHSVQDIVLNLFVQKHLPAEIRMLACIVLLETKPSTALISVVSEVLLEEADLQVASFSYSLLKGFAKSRTPDNQHLSIACNI---AMKILTRKLGHLSYR-YSKNLHFDWFHDDFLFGTSA---DVYMLQNESPIPTKLMLKGKFHFIGRILQFLEFGIRADGLKD-LFAGKIPELTKDLGISDLASILKILSNWQSLPKDKPLLTAYARVFGQEAF 745          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: vtg3 (vitellogenin 3, phosvitinless [Source:ZFIN;Acc:ZDB-GENE-991019-2])

HSP 1 Score: 63.929 bits (154), Expect = 4.587e-9
Identity = 153/659 (23.22%), Postives = 270/659 (40.97%), Query Frame = 3
Query:  396 FGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNF--VIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEG--LKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNG--KVSTETPNTRSDL---TMNHGDQAPLFMKKEKIPV---LDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIEDSNLQNF------QDLGISFFE-NTTPTIIKLFSNKI------GDPKFDNSALLTLSSMIKSFC---DKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILE--SCVSSKVSQNDVKIFAVEALRQFPCHAD--IDNFLWKVYDDISYLSEVRIQAYLSLIRC-PFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKF-NLDFRSYSKNIE-----KTFQRGYSAVKLDTNILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKN-AHPDIVKMQKKSEN----KGEKLSLGVYSRIMGREIF 2240
            F +  G++  I      +   VN+ + I+  LQV++ +  S   L E  I G C + Y T+ E  N   +IV +I  I  C +    +  ++    ++  + R  +++            ++G  + ++  +E Q F PF+      ++    +I    V +   KV T    +R +L   T       P+ M     PV   LD+ K+L       +  SE +   +  I+ +       ++ + K  + N E        +   +D +    +E   KFL       +       Q L ++F   +  P  + L    +        P   N+ +L   S++  +C   D  P  V+ P +  A + L K          N ++E VL  L++LGN+ +  ++K L+K L   S  + K+S   V+  AV+A R     A   + + +  ++      +E+R+ A + L+   P       + + L +E + Q+ SF +S +    ++       L     I    M  LTRK  +L +R YSKN+        F  G SA   D  +L + SPIP+ +         GR +  LEFGIR  G+ + LF    P+  K+    D+  + K   N      +K  L  Y+R+ G+E F
Sbjct:  109 FEYSKGQITDIRTAPGVSNTVVNIVRGILGFLQVTVKTTQSFYELIELGIHGLCQSSY-TVDEDSNAKELIVTRIVDITNCQQPASLYRGMALAPEDKLSKQRGESVVSTVKHTYTVKSTADGGQITKAFAQERQYFSPFNVKGGNFRMLALRDIELLKVSDTTDKVVTGQVQSRGNLMYKTNKDLKPIPVVMLNLNDPVPKILDLIKRLAQA-NIYHVDSETSTEILDLIQLMRVTTLDNLEHLWKQVSGNDEH-------RRWFLDLVVEVTDERILKFLEARYKAGDITANEAGQALVVAFNHLSAEPVSVALAQEFLTIPFSKSHPLLWNTVVLAYGSLVHRYCVYTDPCPITVVQPLLNMAASSLSK----------NSEDEMVL-ALKSLGNAAHLSSFKTLLKFLPGYSNGAEKLSTR-VQGAAVQAFRLLASRASHSVQDIVLNLFVQKHLPAEIRMLACIVLLETKPSTALISVVSEVLLEEADLQVASFSYSLLKGFAKSRTPDNQHLSIACNI---AMKILTRKLGHLSYR-YSKNLHFDWFHDDFLFGTSA---DVYMLQNESPIPTKLMLKGKFHFIGRILQFLEFGIRADGLKD-LFAGKIPELTKDLGISDLASILKILSNWQSLPKDKPLLTAYARVFGQEAF 738          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: fosb (FBJ murine osteosarcoma viral oncogene homolog B [Source:Xenbase;Acc:XB-GENE-6258697])

HSP 1 Score: 118.242 bits (295), Expect = 2.986e-25
Identity = 79/261 (30.27%), Postives = 142/261 (54.41%), Query Frame = 3
Query: 1410 MNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKG 2189
            M  L + + ++C    ++   K+   L+A+GN+G     + LI +L SC   + + + +++ AVEA R+ PC A+    L ++Y  +    E+RI +Y + ++CP +E    + Q L  E + Q+GSFVWSH+S L+E+ D  K ++ D L     P + L++ F  +F  YS   + T     +   ++ +++F+ S  IP S   N+++   GR++NILEFGIR +  +E L  R +  P   ++   V+  +++ N G
Sbjct:    1 MGILQEQLGDNCTAQEDEQIHKMQLILKAIGNAG--LAAESLIPVLTSCAFLRSNPDSIRLAAVEAFRRIPCSAN-RTILAELYQSVHKNEEIRIASYYTAMKCPTQEFLHIVRQMLKHEKSMQVGSFVWSHLSQLLESDDPLKQDIADSL-----PDDILSKDFEGEFWKYSSYSDATVLSESAGANVEASMIFTPSSFIPRSAMANLTIHAMGRAMNILEFGIRLEN-AEDLLKRMFGHPSFTSNKAFVRKDEENTNSG 252          

HSP 2 Score: 82.4185 bits (202), Expect = 2.172e-14
Identity = 78/330 (23.64%), Postives = 141/330 (42.73%), Query Frame = 2
Query: 9665 LKTFTNWLPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNK-IEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDE---KRNFAIYRNDDLVK-------IKTSEGIVIK--YFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKI-STSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCV 10612
            L   T+++  +   K  K   S  L+  +YR++              R +  PF   A ++    ++TFDG  + + S +CS LLA+DF    F+L++N      + +  ++++++                V+I P +  +E   + +  +Y+N   +K       +   EGI ++   +++  S  +   G++HG   GL G+ND E  ND   P    T+     S  W   + D +  +G   IK   TS  Q+        S S L+ CF +I P+P++  C   +       +E K  +C+L+  YV  C    + I +   C 
Sbjct: 3094 LANITHYIIEEKLMKPIKDMYSINLMAEYYRFKR-------------RMMESPFEYHAVLIGNKHVVTFDGILLNVAS-KCSLLLAKDFMYNKFTLILNQGGGTMRSLHVDMNHVS----------------VDIYPGLKIEENCQRLDLPVYKNGIFIKKDANHIEVANQEGITVQCDIYHDICSFTLE--GWYHGISAGLFGTNDNESGNDFLLPDHSHTNSTQDFSLKW---QVDTQCSSGRKKIKACPTSPHQKLCKALFQGSNSVLRNCFRVIYPQPFYNACVEDI----CDSNEIKP-ICNLAAAYVHLCNRNFVPIEIPLQCA 3383          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: fosb (FBJ murine osteosarcoma viral oncogene homolog B [Source:Xenbase;Acc:XB-GENE-6258697])

HSP 1 Score: 118.242 bits (295), Expect = 3.096e-25
Identity = 79/261 (30.27%), Postives = 142/261 (54.41%), Query Frame = 3
Query: 1410 MNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKG 2189
            M  L + + ++C    ++   K+   L+A+GN+G     + LI +L SC   + + + +++ AVEA R+ PC A+    L ++Y  +    E+RI +Y + ++CP +E    + Q L  E + Q+GSFVWSH+S L+E+ D  K ++ D L     P + L++ F  +F  YS   + T     +   ++ +++F+ S  IP S   N+++   GR++NILEFGIR +  +E L  R +  P   ++   V+  +++ N G
Sbjct:    1 MGILQEQLGDNCTAQEDEQIHKMQLILKAIGNAG--LAAESLIPVLTSCAFLRSNPDSIRLAAVEAFRRIPCSAN-RTILAELYQSVHKNEEIRIASYYTAMKCPTQEFLHIVRQMLKHEKSMQVGSFVWSHLSQLLESDDPLKQDIADSL-----PDDILSKDFEGEFWKYSSYSDATVLSESAGANVEASMIFTPSSFIPRSAMANLTIHAMGRAMNILEFGIRLEN-AEDLLKRMFGHPSFTSNKAFVRKDEENTNSG 252          

HSP 2 Score: 82.4185 bits (202), Expect = 2.231e-14
Identity = 78/330 (23.64%), Postives = 141/330 (42.73%), Query Frame = 2
Query: 9665 LKTFTNWLPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNK-IEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDE---KRNFAIYRNDDLVK-------IKTSEGIVIK--YFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKI-STSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCV 10612
            L   T+++  +   K  K   S  L+  +YR++              R +  PF   A ++    ++TFDG  + + S +CS LLA+DF    F+L++N      + +  ++++++                V+I P +  +E   + +  +Y+N   +K       +   EGI ++   +++  S  +   G++HG   GL G+ND E  ND   P    T+     S  W   + D +  +G   IK   TS  Q+        S S L+ CF +I P+P++  C   +       +E K  +C+L+  YV  C    + I +   C 
Sbjct: 3139 LANITHYIIEEKLMKPIKDMYSINLMAEYYRFKR-------------RMMESPFEYHAVLIGNKHVVTFDGILLNVAS-KCSLLLAKDFMYNKFTLILNQGGGTMRSLHVDMNHVS----------------VDIYPGLKIEENCQRLDLPVYKNGIFIKKDANHIEVANQEGITVQCDIYHDICSFTLE--GWYHGISAGLFGTNDNESGNDFLLPDHSHTNSTQDFSLKW---QVDTQCSSGRKKIKACPTSPHQKLCKALFQGSNSVLRNCFRVIYPQPFYNACVEDI----CDSNEIKP-ICNLAAAYVHLCNRNFVPIEIPLQCA 3428          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-922227])

HSP 1 Score: 105.531 bits (262), Expect = 2.431e-21
Identity = 159/710 (22.39%), Postives = 303/710 (42.68%), Query Frame = 3
Query:  138 EKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVK------KDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETD----ISGDCITEYSTLPE---PPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPME-----NRHLA-LLDGSYECNIKM-KRSEGLKESICKETQVFKPFS-SDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNL----LIDALPHTKNEEAFKFLIE-------DSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFH---NYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNI----EKTFQRGYSAVKLD--TNILF-XXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            E   K++  + YVY++ +  T     +       + + K E+    +C+F L++    L+E +  +S  K      K+ +     +  Y ++    DG+ V +  DK +    +N+K+ I+S+L V            ETD    + G C +E          P  V VK+  ++  C R    F+ +  R +  P+      NR L+ L+  S  C   +  +   + E+ C ET +F PFS  D+ G   +V   ++ + V         P+T   L      +A   + K +   L+  ++L   L  +    ++A  F K + AL  ++             N    P   +L  L     + AL      E F  +++          + +    G+    +     ++   N +   +   ++   LS  +  F ++     +  ++    + ++  I N C      + +K   TL+A+G  G+     N ++   +L+ C   + S  D++  A++A R+     D+   L +V+ D +   + R+ AYL L++ P +   RK+++ L ++DN+Q+ +FV SHI N++      KT+L++ L+  ++P+N      + DF   S+N     + T    Y A   D   NI+F S   +P       ++++FG+SV++ E G+ GKG     + LFG   F+P
Sbjct:   53 EAALKFKHLRKYVYNYEAATTSGVSGTADSQSGTKFNCKVELEVPQSCNFILRVKQCTLREVYGVSSEGKALLKKSKNSEDFSNAMTKYEVKVTVQDGKNVVLYPDKDEPLNVLNMKRGILSALLVDETQ--------ETDYMDTVYGKCTSEIKVTGRKGNTPTDVTVKR--NLKTCDR----FTPI--RDYVNPLAIIKGMNRPLSTLISSSQVCQYSLDPKRRHITEASCAETHLFLPFSYRDQYGINGKVTQTLKLEDVAKTNSRDFDPDT--SLARGFALEATKTVSKNEDAALENLQEL-QKLSTSEQNQQRASRFYKLVTALRGLN-------------NDSLGPLVPRLMQLSSPIALQALTQCGTPECFGGILQVLRSGDISPVISDTVTFGLGLLPSPCTKRVRELLN-MAQYQSSRASFYALSHAVSKFYEEQQ--TVTDELRDVADFMLSLIGNEC----TGNEDKTFQTLKAIGIMGSAMEATNPEIKSSLLK-CARGQASSPDIQKAAIQAFRRMTMTDDVRGVLVQVFQDSNAPEQKRLAAYLMLMKNPSQSDLRKVVKVLLRDDNKQVKNFVSSHIRNIL-----LKTKLQEALK-SSQPLN-----VDTDFTKLSQNYHFSRDVTIPGLYDAAGADMVANIIFDSEGYMPKEAMLEATLNVFGKSVDMFEIGVEGKGFEPTLDSLFGNGGFFP 711          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-922227])

HSP 1 Score: 105.145 bits (261), Expect = 2.700e-21
Identity = 159/710 (22.39%), Postives = 302/710 (42.54%), Query Frame = 3
Query:  138 EKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVK------KDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETD----ISGDCITEYSTLPE---PPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPME-----NRHLA-LLDGSYECNIKM-KRSEGLKESICKETQVFKPFS-SDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNL----LIDALPHTKNEEAFKFLIE-------DSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFH---NYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNI----EKTFQRGYSAVKLD--TNILFXXXXXX-XXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            E   K++  + YVY++ +  T     +       + + K E+    +C+F L++    L+E +  +S  K      K+ +     +  Y ++    DG+ V +  DK +    +N+K+ I+S+L V            ETD    + G C +E          P  V VK+  ++  C R    F+ +  R +  P+      NR L+ L+  S  C   +  +   + E+ C ET +F PFS  D+ G   +V   ++ + V         P+T   L      +A   + K +   L+  ++L   L  +    ++A  F K + AL  ++             N    P   +L  L     + AL      E F  +++          + +    G+    +     ++   N +   +   ++   LS  +  F ++     +  ++    + ++  I N C    N+D  K   TL+A+G  G+     N ++   +L+ C   + S  D++  A++A R+     D+   L +V+ D +   + R+ AYL L++ P +   RK+++ L ++DN+Q+ +FV SHI N++      KT+L++ L+  ++P+N      + DF   S+N     + T    Y A   D   NI+F +            ++++FG+SV++ E G+ GKG     + LFG   F+P
Sbjct:   53 EAALKFKHLRKYVYNYEAATTSGVSGTADSQSGTKFNCKVELEVPQSCNFILRVKQCTLREVYGVSSEGKALLKKSKNSEDFSNAMTKYEVKVTVQDGKNVVLYPDKDEPLNVLNMKRGILSALLVDETQ--------ETDYMDTVYGKCTSEIKVTGRKGNTPTDVTVKR--NLKTCDR----FTPI--RDYVNPLAIIKGMNRPLSTLISSSQVCQYSLDPKRRHITEASCAETHLFLPFSYRDQYGINGKVTQTLKLEDVAKTNSRDFDPDT--SLARGFALEATKTVSKNEDAALENLQEL-QKLSTSEQNQQRASRFYKLVTALRGLN-------------NDSLGPLVPRLMQLSSPIALQALTQCGTPECFGGILQVLRSGDISPVISDTVTFGLGLLPSPCTKRVRELLN-MAQYQSSRASFYALSHAVSKFYEEQQ--TVTDELRDVADFMLSLIGNEC--TGNED--KTFQTLKAIGIMGSAMEATNPEIKSSLLK-CARGQASSPDIQKAAIQAFRRMTMTDDVRGVLVQVFQDSNAPEQKRLAAYLMLMKNPSQSDLRKVVKVLLRDDNKQVKNFVSSHIRNIL-----LKTKLQEALK-SSQPLN-----VDTDFTKLSQNYHFSRDVTIPGLYDAAGADMVANIIFDSEGYMPKEAMLEATLNVFGKSVDMFEIGVEGKGFEPTLDSLFGNGGFFP 711          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-922227])

HSP 1 Score: 102.834 bits (255), Expect = 7.038e-21
Identity = 158/714 (22.13%), Postives = 305/714 (42.72%), Query Frame = 3
Query:  138 EKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVK------KDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETD----ISGDCITEYSTLPE---PPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPME-----NRHLA-LLDGSYECNIKM-KRSEGLKESICKETQVFKPFS-SDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNL----LIDALPHTKNEEAFKFLIE-------DSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFH---NYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMET----SDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNI----EKTFQRGYSAVKLD--TNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            E   K++  + YVY++ +  T     +       + + K E+    +C+F L++    L+E +  +S  K      K+ +     +  Y ++    DG+ V +  DK +    +N+K+ I+S+L V        +   ETD    + G C +E          P  V VK+  ++  C R    F+ +  R +  P+      NR L+ L+  S  C   +  +   + E+ C ET +F PFS  D+ G   +V   ++ + V         P+T   L      +A   + K +   L+  ++L   L  +    ++A  F K + AL  ++             N    P   +L  L     + AL      E F  +++          + +    G+    +     ++   N +   +   ++   LS  +K          +  ++    + ++  I N C      + +K   TL+A+G  G+     N ++   +L+ C   + S  D++  A++A R+     D+   L +V+ D +   + R+ AYL L++ P +   RK+++ L ++DN+Q+ +FV SHI N+++     ++  KT+L++ L+  ++P+N      + DF   S+N     + T    Y A   D   NI+F +   +P       ++++FG+SV++ E G+ GKG     + LFG   F+P
Sbjct:   33 EAALKFKHLRKYVYNYEAATTSGVSGTADSQSGTKFNCKVELEVPQSCNFILRVKQCTLREVYGVSSEGKALLKKSKNSEDFSNAMTKYEVKVTVQDGKNVVLYPDKDEPLNVLNMKRGILSALLV--------DETQETDYMDTVYGKCTSEIKVTGRKGNTPTDVTVKR--NLKTCDR----FTPI--RDYVNPLAIIKGMNRPLSTLISSSQVCQYSLDPKRRHITEASCAETHLFLPFSYRDQYGINGKVTQTLKLEDVAKTNSRDFDPDT--SLARGFALEATKTVSKNEDAALENLQEL-QKLSTSEQNQQRASRFYKLVTALRGLN-------------NDSLGPLVPRLMQLSSPIALQALTQCGTPECFGGILQVLRSGDISPVISDTVTFGLGLLPSPCTKRVRELLN-MAQYQSSRASFYALSHAVKQ-------QTVTDELRDVADFMLSLIGNEC----TGNEDKTFQTLKAIGIMGSAMEATNPEIKSSLLK-CARGQASSPDIQKAAIQAFRRMTMTDDV-RVLVQVFQDSNAPEQKRLAAYLMLMKNPSQSDLRKVVKVLLRDDNKQVKNFVSSHIRNILQMDAPEAEGLKTKLQEALK-SSQPLN-----VDTDFTKLSQNYHFSRDVTIPGLYDAAGADMVANIIFDSEGYMPKEAMLEATLNVFGKSVDMFEIGVEGKGFEPTLDSLFGNGGFFP 694          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Match: Apob (apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052])

HSP 1 Score: 93.9745 bits (232), Expect = 4.973e-18
Identity = 158/714 (22.13%), Postives = 311/714 (43.56%), Query Frame = 3
Query:  108 ESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVK------KDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYS------TLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKM-KRSEGLKESICKETQVFKPFS-SDKTGSKIEVKHEIRF-DTVK-NGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLC-MTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLK----NLLIDALPHTKNEEAFKFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSF--CDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKL--LIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSA---------VKLDTNILF-XXXXXXXXXXXXXXXDIFG-RSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            E+ + SC      FK+    +Y Y+  S+  ++     +   ++    + E+ +I  C F ++ +   LKE +  N   K      K+ +     +  Y L+    +G+ + +  DK + ++ +N+K+ IIS+L V  ++ +    L    + G+C T+ +      T+P       +   +++  C       +++S     + + +    L+  S  C   +  + + + E++C E  +F PFS  +K G    V  ++   DT K N +  +E  N R  L             K+   VL   ++L  +++ + NA  ++A LF K +  L  +  + I  +     + S     ++ ++          L   K E+A   L++           ++   N +   ++   N   + +   + L  LS  + S+   D +   VL     Y    L+K I+N C    N+D+  ++  LR +GN G      +  L   + SCV S      ++  A++ALR+     ++   L+  + +     E R+ AYL L++ P      KI Q L  E ++Q+ +FV SHI+N++ + + +  +L+ L++     + +      +DFR +S+N    +Q   SA         VK++ N++F  +S +P       ++ +FG  S+++ E G+ GKG     E LFG+  F+P
Sbjct:   33 ENLSFSCPKDATRFKHLRKYVYNYEAESSSGVQGTADSRSATKINCKVELEVPQI--CGFIMRTNQCTLKEVYGFNPEGKALMKKTKNSEEFAAAMSRYELKLAIPEGKQIVLYPDKDEPKYILNIKRGIISALLVPPETEEDQQELFLDTVYGNCSTQVTVNSRKGTVPTE-----MSTERNLQQCDGFQPISTSVSPLALIKGLVHPLSTLISSSQTCQYTLDPKRKHVSEAVCDEQHLFLPFSYKNKYGIMTRVTQKLSLEDTPKINSRFFSEGTN-RMGLAFESTKSTS--SPKQADAVLKTLQELKKLSISEQNA--QRANLFNKLVTELRGLTGEAITSLLPQLIEVSSPITLQALVQCGQPQCYTHILQWLKTEKAHPLLVD------IVTYLMALIPNPSTQRLQEIFNTAKEQQ-SRATLYALSHAVNSYFDVDHSRSPVLQDIAGY----LLKQIDNEC--TGNEDHTFLI--LRVIGNMGRTMEQVMPALKSSVLSCVRSTKPSLLIQKAALQALRKMELEDEVRTILFDTFVNGVAPVEKRLAAYLLLMKNPSSSDINKIAQLLQWEQSEQVKNFVASHIANILNSEELYVQDLKVLIK---NALENSQFPTIMDFRKFSRN----YQISKSASLPMFDPVSVKIEGNLIFDPSSYLPRESLLKTTLTVFGLASLDLFEIGLEGKGFEPTLEALFGKQGFFP 712          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Match: Apob (apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052])

HSP 1 Score: 73.9442 bits (180), Expect = 5.797e-12
Identity = 79/288 (27.43%), Postives = 140/288 (48.61%), Query Frame = 3
Query: 1323 SALLTLSSMIKSF--CDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKL--LIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSA---------VKLDTNILF-XXXXXXXXXXXXXXXDIFG-RSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            + L  LS  + S+   D +   VL     Y    L+K I+N C    N+D+  ++  LR +GN G      +  L   + SCV S      ++  A++ALR+     ++   L+  + +     E R+ AYL L++ P      KI Q L  E ++Q+ +FV SHI+N++ + + +  +L+ L++     + +      +DFR +S+N    +Q   SA         VK++ N++F  +S +P       ++ +FG  S+++ E G+ GKG     E LFG+  F+P
Sbjct:  427 ATLYALSHAVNSYFDVDHSRSPVLQDIAGY----LLKQIDNEC--TGNEDHTFLI--LRVIGNMGRTMEQVMPALKSSVLSCVRSTKPSLLIQKAALQALRKMELEDEVRTILFDTFVNGVAPVEKRLAAYLLLMKNPSSSDINKIAQLLQWEQSEQVKNFVASHIANILNSEELYVQDLKVLIK---NALENSQFPTIMDFRKFSRN----YQISKSASLPMFDPVSVKIEGNLIFDPSSYLPRESLLKTTLTVFGLASLDLFEIGLEGKGFEPTLEALFGKQGFFP 699          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Match: Muc6 (mucin 6, gastric [Source:MGI Symbol;Acc:MGI:2663233])

HSP 1 Score: 61.6178 bits (148), Expect = 3.396e-8
Identity = 62/261 (23.75%), Postives = 114/261 (43.68%), Query Frame = 2
Query: 9851 GNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYI--------NKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDL-VKIKTSEGIVIKYFNEFKSLKIMAIG-FWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSL----SYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILI 10591
            G+ + TFD    +   G C+Y L +  +  +   +M V  K+     E S +        +KIVI  D  ++ +G    +LP     +  N  I+R     +++ T+ G+ + +  +      + +G  + G  +GL G+ + + ++D +T  G+    A +   SW  G C A  +  +     S SQL +     H   L    S  ++C S++NP+P++  C     Y   +  E    +CS    Y   C ++GIL+
Sbjct:  444 GSFVTTFDARPYRF-HGTCTYTLLQSPQLPNEGTLMAVYDKSGYSHSETSLVAIMYLSKKDKIVISEDEVITNNGD-TKLLPY----KTHNITIFRQTSTHLQMATTFGLELVFQMQPVFQVYITVGPQFKGQTRGLCGNFNGDTTDDFTTSMGIDEGTASLFVDSWRAGNCPAALEREMDP--CSMSQLNKVCAETHCSMLLKKGSVFEKCHSVVNPQPFYKRC----VYQACNYEETFPHICSALGAYAHACSARGILL 692          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Match: Muc6 (mucin 6, gastric [Source:MGI Symbol;Acc:MGI:2663233])

HSP 1 Score: 61.6178 bits (148), Expect = 3.403e-8
Identity = 62/261 (23.75%), Postives = 114/261 (43.68%), Query Frame = 2
Query: 9851 GNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYI--------NKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDL-VKIKTSEGIVIKYFNEFKSLKIMAIG-FWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSL----SYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILI 10591
            G+ + TFD    +   G C+Y L +  +  +   +M V  K+     E S +        +KIVI  D  ++ +G    +LP     +  N  I+R     +++ T+ G+ + +  +      + +G  + G  +GL G+ + + ++D +T  G+    A +   SW  G C A  +  +     S SQL +     H   L    S  ++C S++NP+P++  C     Y   +  E    +CS    Y   C ++GIL+
Sbjct:  444 GSFVTTFDARPYRF-HGTCTYTLLQSPQLPNEGTLMAVYDKSGYSHSETSLVAIMYLSKKDKIVISEDEVITNNGD-TKLLPY----KTHNITIFRQTSTHLQMATTFGLELVFQMQPVFQVYITVGPQFKGQTRGLCGNFNGDTTDDFTTSMGIDEGTASLFVDSWRAGNCPAALEREMDP--CSMSQLNKVCAETHCSMLLKKGSVFEKCHSVVNPQPFYKRC----VYQACNYEETFPHICSALGAYAHACSARGILL 692          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Match: Tecta (tectorin alpha [Source:MGI Symbol;Acc:MGI:109575])

HSP 1 Score: 59.6918 bits (143), Expect = 1.129e-7
Identity = 70/272 (25.74%), Postives = 121/272 (44.49%), Query Frame = 2
Query: 9827 SKTAWVL--DGNSILTFDGNAIKIGSGQCSYLLARDFKKG---SFSLVMNVDSKNNK----IEYELSYIN--KIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWS---LGKCDAKTKTGLYSIKISTSQLQECENTFH----PDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGIL 10588
            +KT++ L   G    TFDG  ++     C+++L+   +K    SF L++N D  ++     I     YIN  +I+I +   V V+G  VN+ P +     +   IY ++  + I TS  I I Y+N F  +KI         + GL G+ + + ++D  T  G     + VL++SW    + K   + +   Y+       +Q  +   +     D   + + C+ L++P P++  C+    Y  K     K  LC     Y   C+S GIL
Sbjct: 1482 TKTSYCLAAGGGVFRTFDGAFLRF-PANCAFVLSTICQKLPDISFQLIINFDKWSSPNLTIISPVYFYINEEQILINDRNTVKVNGTQVNV-PFITGLATK---IYSSEGFLVIDTSPDIQI-YYNGFNVIKISISERLQNKVCGLCGNFNGDMTDDYVTLRGKPVVSSVVLAQSWKTNGMQKSCNELQFSQYAATCDNVHIQAMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYNHK-----KFQLCGSLAAYGEACRSFGIL 1742          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6RG02|VIT_PENME (Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 3.436e-36
Identity = 164/688 (23.84%), Postives = 300/688 (43.60%), Query Frame = 3
Query:  114 CASSC--RGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPN---YLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESI-CKETQVFKPFSSDKTGSKIEVKHEIRF-----DTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKI-PVLD-IAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIEDSNLQNFQDLG-------ISFFENTTPTI--IKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNN-KDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQR---GYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGI 2096
            C++ C   G  K+  Y+  K Y Y +    T++    +    + E +   +++ IS CD  +   N  +        +  +     +TL E Y L     DGRV  +C   +D  +A+N+KK + S+ Q S+ SL + +    +TETD+ G C T+Y    E    ++VK+ K+   C  +    + L     + P     L + +   +C  + + + G+  +I C++  + +P        +      +RF     DT     + +   N  S L  NH       MK  ++ P LD + K++C    K+   +E   L  K +  L  I    + E  +       CS + ++L+++ +DA+       A K ++ +  ++N +  G        + +    P I  +K  +     P+   S LL  ++M+  +C  TP C     +      L   ++  C      +DNE  L   + +GN G       + +    C+  +  +  V++ A EA RQ  C       L  +    ++ +EVRI +YL+ +RC  +E    II+K+++E+N Q+  FV  H+ N+ E++   K  LR LL       N +   F  DFR +S+NI+  +     G  A  L++NI+++    +P +++  +  D+    ++I E G R  GI
Sbjct:   28 CSTECPVTGSPKL-AYQPDKTYAYAYSGKSTVQLKGVDNGDTETEWTAGVDLTWISPCDMAISFRNTKM--------DGARGPTAARTL-ERYPLVVAVVDGRVQHVCAHPEDEAWAINLKKGVASAFQNSIPSLSAVSSGITVTETDVVGKCPTKYEIETEGEKVIVVKE-KNHRHCQERYPTPAALPAPWLKAP-----LPIEESKSQC--RQEIANGIYTAITCQDKNIVRPAIGIYKYVEASQYSTLRFISESSDTSAISGIPSGELNIES-LLYNHET-----MKDPQLAPELDELMKEIC-DKTKDTVEAEAGALVAKALHVLRRIPDTVVVETAQKVRQGHYCS-DSARLESIFLDAVAFIHESGAVKVMVNE--IENGRATGGRLALYTAALYLIPRPNIEAVKALTPLFESPRPMPSLLLAAATMVNHYCRHTPACYEKAPVARIAEILANRVQTHCSPSAGVEDNEVALAIFKTIGNMGV--ATPAVTRAAVHCIEVEGLETSVRVAAAEAFRQANCFRPAVEKLVDIAVRPAFETEVRIASYLAAVRCAEQEHLETIIEKISKEENTQVRGFVLGHLINIQESTCPAKENLRYLLA------NVIPTDFERDFRKFSRNIDVAYHAPAFGMGA-GLESNIIYAPGSFVPRAVNLKMKADVDETHMDIAEIGARFVGI 678          

HSP 2 Score: 64.6994 bits (156), Expect = 2.725e-8
Identity = 57/228 (25.00%), Postives = 109/228 (47.81%), Query Frame = 2
Query: 9812 LLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYEL-SYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTS-EGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKT-GLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCH 10486
            +LPP+ +TA V+ G+ ILTF G  ++     C  +LA     GS  L+M+    +   ++EL +    ++I+ D  V V+G+ +    A  +    N  I    + +++      +V+    E  ++ + A G+  G + GLLG N+ E ++D   P+G    +   L  +W   + D +  T  +   + + ++L +CE       L    RC  +++P+P+  +CH
Sbjct: 2347 VLPPYPRTATVVGGSEILTFSGLVVRAPRSPCKVVLA---AHGSHRLMMSHPQASAPAQFELKTPAATVMIKPDFEVVVNGQPL----AGSQQTIGNVRIVNTAEHIEVGCPLMKVVVAKAGE--AVAVEASGWVFGRVAGLLGPNNGEIAHDRLMPSGAAASNPRDLVAAW---QEDRQCSTPEVPRAETTVARLIQCEAL-----LGIRSRCNPVVHPQPFIKMCH 2557          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9U943|APLP_LOCMI (Apolipophorins OS=Locusta migratoria OX=7004 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 3.118e-33
Identity = 182/753 (24.17%), Postives = 332/753 (44.09%), Query Frame = 3
Query:   51 IIYVIFIASSAYSLNLKPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRV-VGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCA-RKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIP----VLDIAKQLCMTLKKNNA---ASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECS--PNKSKLKNLLIDALPHTKNEEAF----KFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQ--------NDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGY--SAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGR 2231
            I +++ +A S+  L+   G  C   C  +  +F+Y++G+ Y Y F  T     P ++ E ++L+L   A++S    C+  L+L  + +      +    K+Y  +K  LE + +   F    +   +C +  DN+ ++N+K+AI+S LQ       +    +E D+ G C T      +  +  ++ K +++   A R+N    TLS R F    +      LD       ++K    +  +  +E+ +F+PFS+   G+K  V+ ++   T+ +       P     +  +   +AP  +    +P     +  A     +  K+     A+EK +  V  +R  S  D      + K +ND    +   NK   +NLL+DAL  T   +A     + L       N   L ++F ++ +   +   S+ +        A L + S I  +C +   C    +    +NK  KH+  S    +     + +  L+ALGN          I+ L + +  KV Q          V++ A+E ++  PC  +I     ++  D    SE+RI+AYL+++ CP     + I   L  E   Q+GSFV SH+ NL  ++D  K E ++ L    KP     + F+ D R YS+N E ++      +   +++N++FS S  +P S+S N++ D+FG S N+ E   R + +   +     PK +     D      K  ++ E+ +  +Y+RI  R
Sbjct:    7 IWFLLILAISSGGLSAAVG-GCNHQCTPQSSVFQYQKGQTYTYSFEGTTLTSLPGTQGEPVRLKLKATADLSVADDCNKVLRLRGVTV------SGPDSKNYANLKD-LEAHPVLANFKGSSINKQLCSEDGDNQSSLNIKRAILSLLQTPNTKSSTA---SEVDVFGICPTNVRH-SQRGDVTVISKTRNLNRYASRENLIQETLSTR-FTGQSDLHATPFLDADLHVEQQIKGGL-IVSATSRESYLFRPFSNQGNGAKTIVETKL---TLTSQNAQPAPPLASFTVPKSIVFEAPHALA--SVPGGSSAITAALHAAESSTKDGVTVDAAEKFRTLVSVLRQSSTTD------ILKVYNDVKAGAGFSNKHSARNLLLDALFRTSTGDAVEVIARLLKTKEITANHWYLSLAFIQHASLKSVVSISSLLDQKNLPTEAFLGIGSFIGRYC-REHNCENVAEFDEVLNKFSKHLSGSTT--SKAGENRAIAALKALGN----------IRHLNNALGEKVKQLALDKSLPPRVRVAALEVIQSDPCRKNIKQAALQILRDQVEDSELRIKAYLAVVECPCDNVVKTISNLLENEPIIQVGSFVVSHLKNLQASTDPSKAEAKEKLGQL-KP----KKIFSSDIRKYSQNYELSYAIDAINAGASVESNVIFSQSSYLPRSVSLNLTADVFGHSYNVFEIAARTENLDHIIESFLGPKGYIETEDD-----DKFVDEVEEKTKSLYNRITER 711          

HSP 2 Score: 102.834 bits (255), Expect = 6.812e-20
Identity = 73/281 (25.98%), Postives = 129/281 (45.91%), Query Frame = 2
Query: 9800 SLR--KLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKT--GL----YSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNC 10618
            SLR   ++PP+  TA +L+ +   TFD   +    G CSY+LA+D + G+F+++ N++  + K            + +D  + V+G+     P  +  ++  F  +R  + V I+T  G+ +      +       GF+ G  +GLLG+ + E  +D + P G +   A     +W   K DA+     G+    +SIK+     +ECE  F   SL  L  C   ++P PY   C   + +   +K E +   C  +  YV  C  + + + +   CV+C
Sbjct: 2803 SLRFDNIIPPYDATAILLNSHHFFTFDRRHLTF-KGICSYILAQDVQDGNFTIIANIEGGSLKSIIVSDQATTFELASDKSLLVNGR-----PTEYPADEGEFHAWREYNRVGIQTKAGVKVTCETSIELCTFEINGFYFGKTRGLLGTINNEPWDDFTKPDGQVASKANEFGNAW---KVDAQCANVDGVDHHEHSIKV-----EECEEVFSKASL--LSPCSLFLDPAPYLEACSH-IAHEATTKEEKQLAACRTAAAYVQACSVENVFVSVPPHCVHC 3066          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9V496|APLP_DROME (Apolipophorins OS=Drosophila melanogaster OX=7227 GN=apolpp PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 2.070e-23
Identity = 211/903 (23.37%), Postives = 381/903 (42.19%), Query Frame = 3
Query:   51 IIYVIFIASSAYSLNLKPGESCASSC-RGKEKIFKYEEGKIYVYDFLSTHTIKN----PNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKR-SEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKE----------KIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIED-SNLQNFQDLGISFFENTTPTIIKLFSNKIGD---PKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGN----SGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTN---ILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPK--------------------------PHKNAHPDIVKMQKKSENKGEK----LSLGVYSRIMGREIFY---SPNVLSALTMSILNPNMKFYVDKSF------------------LLLDVIVSVSTITGFPIELTIE--SALSVDLSSNNMIKLGDINLSLQNNVA-----LQVIGKLQINAHC 2504
            I  +  +AS   ++ +    +C   C +    + KY  G  Y Y F S  TI      PN   +T  L++SG A+I     C + L+LS++ +  T  + S  KK    ++  ++ ++L  G  + +   IC D  D ++++N+K+A++S LQ  +++        E D+ G C T  ST  +  N  I+ K +++  C+ + +  S L   +  E        LL  +Y   IK  R    L E++ + T+ +K   + K  S I  K                +P T S +      ++ +F + E          K  + D+       +KK     E A+ FV+FIR L   D +T+ E+  +        PNK   + + +D L  T   E+ + +++  S     + L      N   ++ K   N+      P       + + +++  +C K       P+I     K    +++ C  +  ++ E+++Y L+ LGN    SGN       +  L  C S+  S N +++ A+ A  +  C   + +   ++  + +  SE+RI+AYLS I CP  E   +I + +N E   Q+G F+ S++  + +++D  + +     Q +      +T+ F +D+R YS N E +++     V   T+   I   +  +P S   NV+ + FG + N+ E  +R + + + L     PK                            ++   D+ K+ KK +  G K    L+L V  ++ G E+ +     N+ S+L   I+N     Y   SF                  L LD  ++  T  G P+EL  +  +A  VDL+    + L DIN  L+ N       L+ +  + INA+ 
Sbjct:    8 IALIGILASVLLTIAVNAENACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDT-SLKVSGSAKIFAKGNCGYTLQLSSVKVTNT--KESVEKKILNSIQKPVQ-FTLVSGILEPQ---ICSDSSDLDYSLNIKRAVVSLLQSGIEAEH------EVDVFGMCPTHTST-SKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANY---IKESRIVNHLIENV-QLTETYKFIGNTKRNSDISAKVVTILKLKNPSGTKANSPGTGSTV------RSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKK-----ETAKKFVEFIRLLRQSDSETLLELAAF------PHPNKVLARKVYLDGLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDKETLNQAASQLLPNAPKELYIAVGNLVAKYCLKN--YCQGPEIDAISKKFSDGLKH-CKPNTKREEERIVYILKGLGNAKSLSGN------TVAALSECASTGRS-NRIRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQ-----QKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLD-DIIN-----YFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLA----VSL-DINAILEQNWQKAKYRLKFVPSVDINANV 849          

HSP 2 Score: 58.5362 bits (140), Expect = 1.601e-6
Identity = 66/299 (22.07%), Postives = 120/299 (40.13%), Query Frame = 2
Query: 9824 FSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNK----IEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQE-CENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQK--NSKFHYIFIIE 10699
            F     V+DG  I TFDG       G C Y+LA+D    +F+++  + +   K    I+ E SY     + ++  + ++G +V      +         +R    + + +  G+ I   ++ K   I   GF+    +GLLG+ + E  +D     G +  ++  L   + +GKC   T     + +  +S+ QE C   F  +S   L   F  ++  PY   C   L     ++ E +   C+ +  Y    K     + L   C+ C          D    K  N+K   +F+++
Sbjct: 2784 FELRGHVVDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFE---VADNLALKLNGNLVE-----YPQHLSGLHAWRRFYTIHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGNDYGVGKC---TAIEFDNNQFKSSKRQEMCSELFGIEST--LAFNFITLDSRPYRKACDIAL--AKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEFTVKLPNNKVDVVFVVD 3066          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q25490|APLP_MANSE (Apolipophorins OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.525e-23
Identity = 161/706 (22.80%), Postives = 314/706 (44.48%), Query Frame = 3
Query:   24 ISSSYKLACIIYVIFIASSAYSLNLKPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRV-VGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQ-FEEPMENRHLALLDGSY---ECNIKMKRSEGLKESICK-ETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKV-STETPNTRSDL-TMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKF---LIEDSNLQNFQD----LGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAM-NKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGY--SAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIR 2084
            +  S +L  +++VI +   A   N K    C  +C+G      +  G+ Y Y    T ++    ++ +   L++ G+A +S IS C+  L + N+      L   + KK Y   + + +   +RF + DGRV   IC  + D+  ++N+K+AIIS LQ             + D+ G C TE S+  E    V++ + + ++ CA + +      GR  F   + N    + D        N++ K + G+ E +   E  ++KPFS  + G++ +V  ++           +     +RS +  + HG  +          V+   K+   T+  N+A+S+ A  F + +R +       +  +       S+   ++ + K + +DAL      E+ +    +++  +L   +     L +    +     +K  +  +  P       L   ++  ++C +     + P+ I A+ NKL   ++N C   N  D + V+  L+ + N  +  +  L+ K++   V + V    V+  A+EA    PC A I      +  +    SE+RI+AYL++I CP   +  +I   L+ E   Q+G+F+ S + ++  +S+  K   +        P      KF +D R YS   E +++     +   +D  +++S +  +P S++ N++VD+FG+S N++E G R
Sbjct:    1 MGKSNRLLSVLFVISVLWKAAYGNGK----CQIACKGSSSP-SFAAGQKYNYGVEGTVSVYLTGADNQETSLKMLGQASVSAISNCELELSVHNM-----VLSGPDGKK-YPCPQGIEK--PVRFSYQDGRVGPEICAAEDDSRRSLNIKRAIISLLQAEQKPS------VQVDVFGVCPTEVSSSQEG-GAVLLHRSRDLSRCAHREQ------GRNDFVNSIANPDAGIKDLQVLQSMLNVESKVNNGVPEKVSAIEEYLYKPFSVGENGARAKVHTKLTLSGKGGAGGGNAHCTESRSIIFDVPHGTSS---ASGNLNSVISAVKETARTVA-NDASSKSAGQFAQLVRIMRTSSKDDLMRIY------SQVKAHQLE-KRVYLDALLRAGTGESIEASIQILKSKDLSQLEQHLVFLSLGNARHVNNPALKAAAGLLDMPNLPKEVYLGAGALGGAYCREHDCHNVKPEGIVALSNKLGSKLQN-CRPKNKPDEDVVVAILKGIRNIRHLED-SLIDKLVHCAVDNNVKAR-VRAVALEAFHADPCSAKIHKTAMDIMKNRQLDSEIRIKAYLAVIECPCSHSASEIKNLLDSEPVHQVGNFITSSLRHIRSSSNPDKQLAKKHYGQIRTP-----NKFKVDERKYSFYREMSYKLDALGAGGSVDQTVIYSQTSFLPRSVNFNLTVDLFGQSYNVMELGGR 661          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|P04114|APOB_HUMAN (Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 9.821e-20
Identity = 155/690 (22.46%), Postives = 298/690 (43.19%), Query Frame = 3
Query:  150 KYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVK------KDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVI-VKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKM-KRSEGLKESICKETQVFKPFS-SDKTGSKIEVKHEIRF-DTVK-NGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLC-MTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNE--EAFKFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILES----CVSSKVSQNDVKIFAVEALRQF-PCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIE-----KTFQRGYSAVKLDTNILFX-XXXXXXXXXXXXXXDIFG-RSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            +++  + Y Y++ +  +   P +        ++ K E+     C F LK S   LKE +  N   K      K+ +     +  Y L+    +G+ V +  +K +  + +N+K+ IIS+L V  ++ ++   L    + G+C T ++      N    +   + +  C R     + +S     + M      L+  S  C   +  + + + E+ICKE  +F PFS  +K G   +V   ++  DT K N +   E          +    +P    K+   VL   ++L  +T+ + N   ++A LF K +  L  +  + +  +     + S  SP    L+ L+    P       +  K +  +  L +     ++     +   ++   N   D +   + L  LS  + ++    P      +++   N L++ I++ C      D +     LR +GN G     + L   L+S    CV S      ++  A++ALR+  P   D +  L    DD S   + R+ AYL L+R P +    KI+Q L  E N+Q+ +FV SHI+N++ + +    +++DL ++  + + +      +DFR +S+N +            ++ K++ N++F  N+ +P       ++  FG  S +++E G+ GKG     E LFG+  F+P
Sbjct:   45 RFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSP---PKQAEAVLKTLQELKKLTISEQNI--QRANLFNKLVTELRGLSDEAVTSLLPQLIEVS--SP--ITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQR-SRATLYALSHAVNNYHKTNPTGT--QELLDIANYLMEQIQDDC----TGDEDYTYLILRVIGNMG--QTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDAS-PGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEE---LDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFP 712          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: K1QKD6 (Vitellogenin domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10002658 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 6.446e-83
Identity = 259/946 (27.38%), Postives = 463/946 (48.94%), Query Frame = 3
Query:  111 SCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKL-------SNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSD---LTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIE-------DSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTF--QRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPH---KNAHPD--------IVKMQKKSEN---KGEKLSLGVYSRIMGREIFYSPNVLSALTMSILNPN-MKFYVD----------KSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGD------INLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKDDGTSLTDYQFEINKIPDDKKLLAISNELSLIHNLKIEEAKPKYSALLNK--CTSDAFLELRGFKLCA 2789
            SCA  C  K K F Y+ G+ Y + +            KE   L+ +  A +  +S C+  LK+       S+ N  ++ L ++   +     KT LE + LRF F DG +  +C   +++ + +N+KK I+SSLQ ++D+  +   L ETD++G C T+Y+   E    V + K K I+ C  ++ + +++    +E P   + L +++ S+EC  K+     ++  +C E  +FKPFS   +G+  EV  ++ F +   G  +     +R D    T  HG++A    KK+   V D  K+LC+T  +N    E   LF + +  +  +D  ++ E+ +     S C  N  + K   +DA+P      A + + +          L     + +SF ++ T  ++   + K+ +       LL +S+++ ++C K   C  + DI   +NK+  ++ N C   N  + EKV+ TLRA+   GN    + +I +LE C S K +   +++ AVEA R+ PC AD +N +  ++ +    SE+R+ AYL +++CP     ++I + L  E+  Q+GSFVW+H+ NL E+S  +K  ++ +L+      +DL +KF+LD R +S+N E +   Q       LD+N+++S    +P S+S N+SV++FG SVN+LE G R +G+   L   F P  +      +PD        + K++K + N   K ++L   +Y+R+ G E+ Y+    SA   S  + N +K Y +          KS + LD  + V TI G P+ LT+   +SVDL     I L        I+  ++ + A++    + ++A+ TK GI+   T+ S      K++           +  +Y F  +      +++   +EL L+   + ++  P    +  +  C+    ++L G +LC 
Sbjct:   30 SCAKQCTDKSK-FGYKIGETYRFTYEGETKTSINGGNKEQSGLKFTATALVEVLSKCELSLKIEDAVLSGSDPNYPKSLLTDTQSNE----FKTALEEHPLRFSFQDGIMEELCPLPEESAWVLNIKKGILSSLQNTMDTFKTEQNLVETDVAGKCRTKYNLKQEGWRSVSIVKSKDISTCLNRHGFDTSMGYILYEVPSSLQSLPIMNSSHECEQKISTDGHMESVLCHEVHLFKPFSQGDSGAMTEVTQKLAFVSKSTGTTTRMAEVSRRDTLLFTQVHGEKAITTSKKQ---VQDKLKELCLT-TENGIRPETPDLFAQLVMLMKKLDATSMAEIFEDVKATSYCPNNMQRTKKFYMDAIPMVGTGAAVRQITQLIMNNDVTGALTESWLVSLSFIQHPTKDMLTEIA-KMMNTVHGTKILLPMSTLMHTYCQKQ-SCEQDSDISDILNKMTANLGNDC---NGANEEKVILTLRAI---GNIEQTQTMIPVLEKCFSRKNNAMGIRVAAVEAYRRMPCAADRNNLI-ALFRNTDEDSELRLAAYLQVMKCPTDNILQQIKETLMSEEVNQVGSFVWTHLMNLRESSSPYKETVKTMLE-----SDDLPKKFDLDQRKFSRNYEWSHYSQELNMGGMLDSNLIWSPESFVPRSVSANLSVELFGHSVNLLEIGGRAEGLDYLLESYFGPSGYFKDGTINPDEKDCSDIKMKKLEKVNRNFDKKVQELKGAMYARVFGNEVLYNQLGQSAPKASGSSFNFLKMYQELAKGNEISYTKSNMFLDSSLIVPTIIGLPLNLTVNGTVSVDLKGRATIDLTKPHKKILIDGIIEPSGAVEFASMMSVDAYFTKSGIKMTSTLHSSTGVSTKIEI---------KNKQEYVFNFDVPKTKSEIVTARSELFLVFKDQEKKQVPASEDITTRKFCSGHTIVQLTGLELCG 943          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A3G3CBA4 (Apolipophorin 2B OS=Sepioteuthis lessoniana OX=34570 GN=apolp2b PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 1.344e-81
Identity = 228/841 (27.11%), Postives = 424/841 (50.42%), Query Frame = 3
Query:   48 CIIYVIFIASSAYSLNLKPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMK-RSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRF-DTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKF---LIEDSNLQNFQD----LGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKT--FQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDI-VKMQKKSENKGEKLSLGVYSRIMGREI-FYSPNVLSALTMSI--LNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQ 2522
              + V+  A   Y L      +CA +C    K F Y+ G +Y + + +  T K   + +++  ++++   EI  ++ CD  +++     K+  L +S   ++ Q  K  +    L+F F DGR+  +C    ++ + +N+K+ I+S+ Q S+DS D    LTETD+ G C++EY    + P    V+K K++ GC+ +  Y   +    +  P   + L L+   Y+C   +   S  L+ S C E  VF+PFS +K G+    +  + F +  K G+ S E  + RS L  +H   +P   +KE+  +    ++LC    ++    E  ++  + I  +  +D   +  V    +  + C+P   ++K    DA+P      +      LI   ++   +     L +SF  + T  ++      + +P    + LL +SS+  S+C+  P C  + +I   + KL+  + + C   N  D  K+++ LRALGN G+ H     +  L  CV+ +    +++I A++A R+ PC A + + L  V+ D S  SE+R+ AY++L++CP ++   ++ Q L +E + Q+GSFVWSH++NLMETSD    ++R+++        +L ++FNLD R +S+N E +  F    +  K+D+N++FS    IP S + N+++D+FG ++N LEFG R +G+ E++   F+  P     P +  ++    + K ++     Y R+ G E+ ++    L     S+  L         K+ +LLD  + + T  G P+ LT+ S  S+ L +    +  ++ L    + ++QV G++ ++AH +K G++
Sbjct:   24 AALLVLANAGPVYKLAATEESTCAVTCSDTNK-FDYQPGTVYQFSYDAKTTTKMNGASEDSANIDMTAMVEIEPLTKCDLVMRI-----KDASLRDSEDDQNSQAFKEAMMKQPLKFSFQDGRIDHVCAMDGESTWTLNIKRGILSAFQNSMDSFDRNQNLTETDVVGTCLSEYKVTDKDPKTKFVEKTKNLLGCSDREGYRMAIQSIGYNVPSFVKSLPLMKSEYKCTQTLDLGSNILQSSTCSEEHVFRPFSYEKNGAMTSSEQTLTFTNKKKAGRSSNEHFSERSTLLFHHQHNSPSKQEKEE-KIEAKLQELCQKAAED-IRPEVPEMVNQLIEHMRQVDRDVLSRVYDKISQKTICAPKADRIKQYFHDAIPMVGTAASVGMIQDLISKKHVTGSEAEMWLLSLSFVHHPTKEMVAATMPLLDEPDVSGNVLLAVSSLTSSYCNVRPECGKDSEISALIRKLMA-LTHDCNAQNG-DVRKIVFALRALGNIGHSHE---AVSHLSRCVTRQDVHEEIRIAAMDAFRRIPCDA-VRSDLMGVFRDESEDSELRLNAYIALMKCPSQKVLYEVRQVLEKEKSNQVGSFVWSHLTNLMETSDPHMQDIRNIVHD-----EELKKEFNLDQRKFSRNYEGSFFFDSINTGAKVDSNVIFSQKSFIPRSANLNLTIDLFGHAINFLEFGGRVQGM-ERILENFF-GPIGTETPALKTRVPINFDKKMDEFYASAYLRVFGNELRYWDDQALREFHTSLKRLMDLQTVSFSKTMVLLDSRMIIPTCVGLPLNLTMSSTGSISLDAKASFEKSNLALHFTPSASVQVKGEMSVDAHVSKAGLK 843          

HSP 2 Score: 95.5153 bits (236), Expect = 3.447e-15
Identity = 64/271 (23.62%), Postives = 125/271 (46.13%), Query Frame = 2
Query: 9815 LPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKN-----NKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGK-CDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTC 10609
            +PPF   A +  G  I TFDG  +    G CSYLLARDF  G+F++V N D+         +    ++  ++ I +D +VS +G +   LP    D      + R  +L+ +++  G  +   +  +   +   G++   + GL G+ + E  +D+       T+D    ++SWS+ + C +      ++      + ++C + F   + S  + CF  +NP+ ++  C   L     +  +    LC ++  Y+ +C+ KG+ + +   C
Sbjct: 3650 IPPFKAEASLFAGQHITTFDGRHLDY-KGTCSYLLARDFVDGNFTIVANFDANRKAKTLKSLSLTTAHNERLEIFSDNKVSFNGGMAK-LPLQLTDA----TVTRQGNLIVVESKRGYKVMCDHSIQLYTVQVNGWYFNKMAGLFGNFNHEPVDDMLMSNNKYTNDLEQFAQSWSVSRECKSHRN---FAPSHMVPENRDCAH-FFLQTDSPFRYCFRQVNPDQFYKTCAMQLSSSKATSID----LCKVTSFYMSKCEQKGVYLPMPIMC 3906          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A1C9ZV19 (Apolipophorin long isoform OS=Uroteuthis edulis OX=55720 GN=apoLp PE=2 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.023e-79
Identity = 230/846 (27.19%), Postives = 419/846 (49.53%), Query Frame = 3
Query:   30 SSYKLACIIYVIFIASSAYSLNLKPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMK-RSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRF-DTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKF---LIEDSNLQNFQD----LGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKT--FQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALTMSILNPNMKFYV---DKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQ 2522
            S+      + V+  A   Y L      +CA +C    K F Y+ G +Y + + +  T K   + +++  + ++   EI  ++ CD  +++++ +L     ++S   ++ Q  K  +    L+F F DGR+  +C   ++  + +N+K+ I+S+ Q S+DS D    LTETD+ G CI+EY    + P    V+K K++ GC  +  Y   +    +  P   + L L+   Y+C   +   S  L+ S C E  VF+PFS  K G+    +  + F +  K G+ S E  + RS L  +H    P   + E+  +    ++LC    ++    E  ++  + I  +  +D   +  V    +  + C+P    +K    DA+P      +      LI   ++   +     L +SF  + T  ++      + +     + LL +SS+  S+C+  P C  + +I   + KL+  + + C   N  D +K+++ LRALGN G+ H     +  L  CV+ +    +++I A++A R+ PC A + + L  V+ D S  SE+RI AY++L++CP ++   ++ Q L +E   Q+GSFVWSH++NLMETSD    ++R+++Q       +L ++FNLD R +S+N E +  F    +  K+D+N++FS    IP S + N+++D+FG ++N LEFG R +G +E +   F+            ++    + + +      Y R+ G E+ Y  +       S L   MK       K+ +LLD  +++ T  G P+ LT+ S  S+ L +N   +   I+L    + ++QV G++ ++AH +K G++
Sbjct:    4 STVTFCAALLVLANAGPVYKLAATEESACALTCSDTNK-FDYQPGTVYQFSYDAKTTTKMNGASEDSANIHMTAMVEIEPLTKCDLVMRINDASL-----QDSEDDQNSQAFKEAMMKQPLKFSFQDGRIDHVCAMDEEQPWTLNIKRGILSAFQNSMDSFDRNQNLTETDVVGTCISEYQVTDKDPKTKFVEKTKNLLGCTDREGYRLAVQSIGYNVPSFVKSLPLMKSEYKCTQTLDLDSNILQSSTCSEEHVFRPFSYGKNGAMSHNEQTLTFTNKKKAGRPSKEHFSQRSTLLFHHEHNTPSKQENEE-KIEAKLQELCQKAVED-IRPEVPEMVNQLIEHMRQVDRDVLSRVYDKISQKTICAPKADHIKQYFHDAIPMVGTAASVGMIQDLISKKHVTGAEAEMWLLSLSFVHHPTKEMVAATMPLLDESDVSGNVLLAVSSLASSYCNVRPECGKDAEISALIRKLMV-LTHDCNAQNG-DIKKIVFALRALGNIGHSHE---AVSHLSRCVTRRDVPEEIRIAAMDAFRRIPCDA-VRSDLMGVFRDESEDSELRINAYIALMKCPSQKVLSEVRQVLEKEKTNQVGSFVWSHLTNLMETSDPHMQDIRNIVQD-----EELKKEFNLDQRKFSRNYEGSFFFDSINTGAKVDSNVIFSQKSFIPRSANLNLTIDLFGHAINFLEFGGRVQG-TETILENFFGASGTKTPAMKTRVPIDFDKQLDTFEASAYLRVFGNELRYWDDSSLIEFQSALEKLMKMQTVSFSKTMVLLDSRMTIPTCIGLPLSLTMSSTGSMSLDANASFQ-KSISLHFTPSASVQVTGEMSVDAHVSKAGLK 828          

HSP 2 Score: 91.6633 bits (226), Expect = 5.232e-14
Identity = 67/275 (24.36%), Postives = 121/275 (44.00%), Query Frame = 2
Query: 9803 LRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKN-----NKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLG-KCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTC 10609
            L   +PPF   A +  G  I TFDG       G CSYLLARDF  G F++V N DS         +    ++  ++ I  D +V  +G     LP    D      +    +L+ +++  G  +   +E +   +   G++   + GL G+ + E  +D+       T+D    ++SWS+  +C +   T    +     + ++C + F   + S  + CF  +NP+ ++  C   L     +  +    LC ++  Y+M+C  KG+ + +   C
Sbjct: 3551 LDDYIPPFKAEASLFAGQHITTFDGRHFNY-KGTCSYLLARDFVDGDFTVVANFDSDRKAKTLKSLSITTAHNEQVEIFADNKVFFNGGEAK-LPLQLTDA----TVTGQGNLIVLESKRGYKVMCDHEIQLYTVKISGWYFNKMAGLFGNFNHEPVDDMLMSNSKYTNDLEQFAQSWSVSQQCKSHRNTAPSHM---VPENRDCAH-FFLQTDSPFRYCFRQVNPDQFYKTCAMQLSSSKATSMD----LCKVTSFYMMKCVQKGVYLPMPIMC 3811          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A3G3CBA2 (Apolipophorin 2A OS=Sepioteuthis lessoniana OX=34570 GN=apolp2a PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.237e-77
Identity = 249/961 (25.91%), Postives = 468/961 (48.70%), Query Frame = 3
Query:   42 LACIIYVIFIASSAYSLNL-KPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKE-SICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNG-KVSTETPNTRSDLTMNH---GDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNE---EAFKFLIEDSNLQNFQ-DLGIS---FFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHA-DIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTF--QRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLG-----VYSRIMGREI----FYSPNV--LSALTMSILNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINL----------SLQNNVALQVIGKLQINAHCTKVGIQ--SYGTVSSDAEFGGKLKTISGLKKDDGTSLTDYQFEINKIPDDKKLLAISNELSLIHNLKIEEAK--PKYSALLNKCTSDAFLELRGFKLCA 2789
            L   + V F  +   ++ L K   +CA  C    K F Y +G IYVY++ +        + +++  + +    EI  +S+CDF ++L + +L + + ++ + K        +L  + LRF F DGR+  +C +  D  +++N+K+ I+S+ Q S+  LD+   L ETDI+G C T YS +   P    V K K +  C  +    S +    ++     + LA++  SY CN ++ +   + E S C E  +F+PFS+ + G+       + F   K+G + S +    R+DL  +H      +P    K K+ +    K+LC  + K +   E+ Q+F + IR +   D   +  + K   +   C  N  K+K +  DA+P        E  + LI    + + + D+ ++   F ++    ++      + +   + + +L +SS++  +C   P C    ++   M+ L + I   C   +   +EK+LY LRA+GN G+    K ++  L  C + + +   +++ A++A R+ PC    +D  L  +++DIS  SE+RI AYL+L++CP +    ++ + L  E   Q+GSFVW+H++NL ETSD    ++R++L+       +L ++FN D R +S+N E +F  +      K+D+N++FS    +P S + N+++D+FGR++N  E G R +G+    E+ FG       K  H    K   +  +   K+ +       Y R+ G E+    F  PN+       +  +  N K    K+  L+D  + V TI G P+ L++ +  SVD+ +     +G++NL          S++ + A++V+ ++ ++A  TK G++  S    S++A+   ++K          + + + + E  K     +++   ++ ++I    +++ K         NKCT + F ++ G KLC 
Sbjct:    8 LFLALLVAFATAGPINIELFKDSRTCAKRCISNRK-FDYTDGTIYVYNYEAESKTSIVGASEDSASVRIRAMVEIEAVSSCDFEMRLKSASLVDPY-QSQHGKFSPAEFGQVLTQWPLRFSFQDGRIEDLCPNADDPSWSLNIKRGILSAFQNSMTRLDADQSLVETDITGSCDTYYSGMN--PRDGTVTKTKDLVTCKHRQGVHSAVQSIGYDADSNIQCLAIMKSSYTCNQRINKERNILEMSTCTEKHIFRPFSNGENGAATINTQSLSFIQAKSGGQGSQDEIRHRTDLLFSHQFGARSSPNAEDKIKMKL----KELCQ-ISKEDVRPEQPQIFSELIREMKMADSAALNAIYKQLKNRKICPNNPEKIKKMFHDAIPMVGTSGSLEVIRDLIWKREVVDLEKDMWLASLPFIQHPEKEMLSAIKPLLEEKNVEGNTILLISSLVSGYCSVNPKCGEVAEVAEIMDVLQRMI-GKC--SSKGPSEKILYALRAIGNIGH---SKTIVPRLTQCFTRRENPVQIRLAAIDAFRRIPCDVMRVD--LLDLFNDISEDSELRINAYLALMKCPHKNILMRVKESLRNEKTNQVGSFVWTHLTNLRETSDPHLQDVREILED-----QELKKEFNKDKRKFSRNYEGSFFLEDLNVGGKVDSNVIFSPKSFVPRSANLNLTIDLFGRAINFFEIGTRMEGVEYFLERYFGNNGYFKAKKDHATSQKFPMRPFDDKYKVDIDALKGFAYVRMFGNELGFWQFDDPNLSFFKNFDIKKMVKNEKIAFSKNMGLMDTQLIVPTIIGLPLNLSVAATASVDVEA-----MGNMNLASFKNIEFGGSIKPSAAVKVVSEITVDAFATKAGLRMNSMAHSSTEAKMSFQMKN---------SRVIESKLEFPK--KRMEIVTFKSDFAIIQGDMVKDQKMIEDNRVSKNKCTGENFNKITGMKLCT 930          

HSP 2 Score: 142.895 bits (359), Expect = 1.535e-29
Identity = 136/571 (23.82%), Postives = 258/571 (45.18%), Query Frame = 2
Query: 9815 LPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVD--SKNNKI--------EYELSYINKIVIR-NDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCG-----------KINLNKKISDHELQKNSKFHYIFIIEQSKCIE----SYRVLIENLAKMMGLKSE----NIFTLLSFNGKDVYKEVHFKTINNKMYVNYDEIMKLLQEAFSPEQLTSKMTEKKITEPGQAIYDVIKMSSVPGFTEKIVLLTCSACSEHQKYGYSLLAGLLNNAGISISYLTTETF-TGGN-----SDVVGIANKMVYTFEKDKIKKVQWKRNIQLPSDACSALARLKDGNIWSLKPLVD---DMRNRRLSEVIHEELIKPKINSQTCYCMAGNYENGKTEC 11410
            +PPF   A +     I TFDG  +    G CSY+L RDF   +F+++ N     ++ KI          +L   +   IR ND +V +  K+  I            ++ R  + ++I+++    I +     S+ +   G++ G + GL G+ ++E+ +D++      T +    + SW++ +C ++     Y  K     L  CE  F  +S S  + CF  + P+ Y+  C+    + P+        +C+++R YV RC  KG+ + L + C+ C            ++  + ++   EL+ ++    +F++EQSKC +        +I+ L +   L+SE    N + L+ F G ++  E +F TI +++  +   IM  +++    +  +       +T+P +AI    +    P   + I+L+TC+     +K  Y  +   L +  I++  L    F   GN     +D+ GI ++ V+T + D   K +    I+LPSD C+ LA   +G+++    ++     M   R ++ I + L    +N   C C  G  E GK + 
Sbjct: 3052 IPPFKAQASIFRDQHITTFDGMHLDF-KGACSYILTRDFVDNNFTVIANFGKFDRDTKILSVLFHAGSEKLEMFHDYQIRHNDNKVDLPIKLNEI------------SVNRIGNKMEIRSNSWFSIIFDPTQGSVIVDISGWYFGKVAGLFGTYNYEQFDDMTMSESRWTTNVDEFAFSWAMPQCRSRQNFAQYERK-----LYRCEKWFL-NSYSPFRNCFRQVEPDSYYHACNTA--HNPQLD------ICTVARFYVDRCAEKGVPLDLPEQCLMCKTKHGHMFMPNEELVFSNEVRKEELEPSADI--VFVVEQSKCNQRIAGDLNTIIQRLEQ--ALQSEGLNNNRYGLVGFGGDNIRHE-YFITIRSELMASAGLIMNKIRQLDFHDGYS-------MTDPLKAISLATQYPFRPAVRKTIILVTCNMFCYEKKIPYQQVLRQLKDHDIALHLLQKYDFEMSGNKSPKTTDLYGIDSRQVFT-KTDGDAKEKMFETIKLPSDNCAELALASNGSVFDAHKIIQGDKSMFAHRFTQRIADSL--EMVNCYECQC--GQNEMGKAQS 3578          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A0L8H7W1 (Vitellogenin domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22020506mg PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 1.569e-76
Identity = 218/779 (27.98%), Postives = 393/779 (50.45%), Query Frame = 3
Query:  237 LELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEG-LKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVST-ETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPH---TKNEEAFKFLIEDSNLQNFQD----LGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKT--FQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALTMSILNPNMKFYVDKSFL-----LLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQ 2522
            + +    +I  +S C   L++++ +L     +NS      Q+    +  Y L+F   +GRV  IC   +++ + +N+K+ I+S+ Q S+D+LD    +TETD+ G C+T+Y+          + K K +  C  +  Y   +   ++  P   + L L+  S EC+  +  S   + +S+C E  +F+PFS+  +G+    +  + F   +   V T E    R++L   H    P     E+  +L   ++LC  +K ++   E  ++    I ++  +D   +K++    +  S C  N    K   +DA+P    T + +  + LI   ++         L +SF  + +  +I   S  + D     + +L +SS+  S+C   P C  + +I   + KLV+ I N      ++ N K ++ LRALGN G  H  + + + L  C S K +  DV++ A++A R+ PC A + + L  V+ D++  SE+RI AYL+L++CP       +   L +E + Q+GSFVWSH++NLMETSD     +R +L+       +L ++FNLD R +S+N E +  F+   +  K+D+N++FS+   IP S + N++VD+FG ++NILE G R +G+ EK   ++             K+ K ++ + +K+   +Y R+ G E++Y  NV S       NP   F   +S L     LLD  + + T  G P+ LT+ +   ++  S +    G  N  ++ + A++V G++ ++A+ TK G++
Sbjct:   11 MTIDANVQIEPVSTCSLLLRVTDASL-----QNSGDTSQRQVFNDAITRYPLKFTLQNGRVEDICPMSEESVWILNIKRGILSAFQNSMDTLDRDVNITETDVVGSCLTKYNVKDSNGQTKTIMKSKDLLNCNDRESYRVAIQSVKYNVPSNVKSLPLMKSSSECSQTLDMSSNIMMKSVCVEEHIFRPFSNGNSGAMTHQRQVLTFVDRQRPIVQTYERYGYRTNLLFQHEHGMPNQRDAEQT-ILSKLQELCQVMK-DDVRPELPKMVNNLIDSMRHVDSGILKKIHNKISRTSFCQQNIEVPKKYFLDAIPMVGTTASVQMIQDLISRKHVTGADAQLWLLSLSFIHHPSKEMIAAISPLLDDSDISGNTILAVSSLASSYCSVRPNCGADIEINDLVGKLVRMIGNC-----DQSNSKTIHALRALGNIG--HTAQAVSR-LSRCFSKKSNPMDVRVSAIDAFRRIPCDA-MRSDLMGVFSDVTEDSEIRINAYLALMKCPNEMILIDLRDMLQKETSNQVGSFVWSHLTNLMETSDPHLQHIRSILED-----ENLKKEFNLDSRKFSRNYEGSFFFESINTGAKMDSNVIFSSKSFIPRSANLNLTVDLFGHAINILEVGGRIEGV-EKFLEKYLAS---------YKVSKDADAEMDKIKAAIYMRMFGNELYYHSNVFS-------NPMSLFKKGESSLLKNMQLLDSRMVIPTCMGLPLNLTVTTTGGINYDSKHAFTKGKFNAEIKLSAAIEVKGEMCVDAYVTKTGLK 751          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 80.8777 bits (198), Expect = 3.906e-14
Identity = 68/232 (29.31%), Postives = 112/232 (48.28%), Query Frame = 3
Query: 1452 DNNKDNEKVLYTLRALGNSGNF-HNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            D + D ++   TLR +G  G +   +  L   L  C+    +   V+  AV++ R      D+   L   Y D    +E RI AYL L+R P  E   ++++ L  E N Q+ SFV SHISNLM+ +D    +L+ +    T+ + +       DF  +S+N +    R  S   + +N++F +   +P  +    ++D F  S  ILE G+ G+G+    + LFG   F+P
Sbjct:  451 DCSGDQDQTFLTLRVIGVMGKYMEGFPSLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNP--ELVDEVLKTLRDESNLQVKSFVISHISNLMDLTD---PDLQTIKDYITRALENDENLSAADFTKFSRNYKVVVPRAGS---VQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFFP 672          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 80.8777 bits (198), Expect = 3.974e-14
Identity = 68/232 (29.31%), Postives = 112/232 (48.28%), Query Frame = 3
Query: 1452 DNNKDNEKVLYTLRALGNSGNF-HNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            D + D ++   TLR +G  G +   +  L   L  C+    +   V+  AV++ R      D+   L   Y D    +E RI AYL L+R P  E   ++++ L  E N Q+ SFV SHISNLM+ +D    +L+ +    T+ + +       DF  +S+N +    R  S   + +N++F +   +P  +    ++D F  S  ILE G+ G+G+    + LFG   F+P
Sbjct:  468 DCSGDQDQTFLTLRVIGVMGKYMEGFPSLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNP--ELVDEVLKTLRDESNLQVKSFVISHISNLMDLTD---PDLQTIKDYITRALENDENLSAADFTKFSRNYKVVVPRAGS---VQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFFP 689          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 80.8777 bits (198), Expect = 4.007e-14
Identity = 68/232 (29.31%), Postives = 112/232 (48.28%), Query Frame = 3
Query: 1452 DNNKDNEKVLYTLRALGNSGNF-HNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            D + D ++   TLR +G  G +   +  L   L  C+    +   V+  AV++ R      D+   L   Y D    +E RI AYL L+R P  E   ++++ L  E N Q+ SFV SHISNLM+ +D    +L+ +    T+ + +       DF  +S+N +    R  S   + +N++F +   +P  +    ++D F  S  ILE G+ G+G+    + LFG   F+P
Sbjct:  468 DCSGDQDQTFLTLRVIGVMGKYMEGFPSLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNP--ELVDEVLKTLRDESNLQVKSFVISHISNLMDLTD---PDLQTIKDYITRALENDENLSAADFTKFSRNYKVVVPRAGS---VQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFFP 689          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 80.8777 bits (198), Expect = 4.140e-14
Identity = 68/232 (29.31%), Postives = 112/232 (48.28%), Query Frame = 3
Query: 1452 DNNKDNEKVLYTLRALGNSGNF-HNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            D + D ++   TLR +G  G +   +  L   L  C+    +   V+  AV++ R      D+   L   Y D    +E RI AYL L+R P  E   ++++ L  E N Q+ SFV SHISNLM+ +D    +L+ +    T+ + +       DF  +S+N +    R  S   + +N++F +   +P  +    ++D F  S  ILE G+ G+G+    + LFG   F+P
Sbjct:  468 DCSGDQDQTFLTLRVIGVMGKYMEGFPSLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNP--ELVDEVLKTLRDESNLQVKSFVISHISNLMDLTD---PDLQTIKDYITRALENDENLSAADFTKFSRNYKVVVPRAGS---VQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFFP 689          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000019204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001825.1:10421:34530:-1 gene:ENSAMXG00000018303.2 transcript:ENSAMXT00000019204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.481e-10
Identity = 83/360 (23.06%), Postives = 151/360 (41.94%), Query Frame = 2
Query: 9767 IMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFS----LVMNVDSKNNKIEYELSYI------NKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDL-VKIKTSEGIVIK-YFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSW-SLGKCDAKTKT----GLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIR--LDKTCVNCGKINLNKKISDH---------ELQKNSKFHYIFIIEQSKCIESYRVLIENLAKMMGL 10762
             + ++GS+  ESL     P      V +G+   TFDG       G+C Y+L++D ++  F+    L+  VD + +     +  +      N +VI++DG V  +G +   LP        N  ++R     + ++TS G+ ++        L I     +     GL G+ +   S++L TP GL+   A   + SW +   C  ++++      Y+I   +     C      +      +C S +NPE Y+  C    +Y   +  + +  LC +  +YV  C +KGI ++   D  C         KK ++H         +LQ   +      +E+  CI +Y + ++  A   GL
Sbjct:  313 CVCHHGSWTCESL-----PTPGLCAVEEGSHFTTFDGKEFTF-HGECYYILSQDCEESKFTVLGQLIPCVDHETDTCLKSVVLLPNNDKNNALVIKDDGTVKQNGDLT--LPYA----SANIIVFRPSSFHIIVQTSFGLRMQVQLVPVMQLYITLDRSYQTKTCGLCGNFNMVLSDELKTPQGLVEGTASSFANSWKAQSNCRDRSESLDDPCSYNIDSESYAEHWCSKLLEKEGP--FAKCHSSVNPESYYKRC----KYSTCTCEKTENCLCGVFSSYVRACTAKGIFLQGWRDTVC---------KKYTEHCPATQTFSYKLQGCQRTCDSLSLERPACINTY-LPVDGCACPDGL 644          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008773.1 (pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1 gene:ENSPMAG00000007891.1 transcript:ENSPMAT00000008773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.549e-9
Identity = 69/271 (25.46%), Postives = 119/271 (43.91%), Query Frame = 2
Query: 9821 PFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNV---DSKNNKIEYELSYIN-----KIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGI-VIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSW-SLGKCDAKTKTGLYSIKISTSQLQ----ECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILI 10591
            P ++T  +  G+ I TFD N      G C Y +A D +   F+L++ +   ++KN  ++  L+ I      KI+I + G VSV+   VN LP    D       Y++   + + TS G+ ++   +    L +     +H +  GL G  +  +S+D  T  GLI   A   + SW +   C   T++      +S +  Q     C N   PD       C   ++PE ++  C     Y   S  + +  LC+   +Y + C SK +++
Sbjct:  348 PCTRTCALEGGSHIKTFDQNQFTF-HGDCYYFMAMDCRTHLFNLMVKLKPCETKNTCLK-SLALILGRNVLKIMISDSGEVSVNDVEVN-LPY---DSNAITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCPPPTESTEEPCMLSLNHKQYAEDMCSNMKTPDGP--FSACHGTVSPEAFYKRC----LYDTCSCQDSEACLCAALSSYALACASKHVVL 606          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Nematostella
Match: EDO48127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK90])

HSP 1 Score: 81.2629 bits (199), Expect = 4.000e-17
Identity = 40/124 (32.26%), Postives = 75/124 (60.48%), Query Frame = 3
Query: 1581 DVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPM-NDLTRKFNLDFRSYSKNIEKTF 1949
            ++ I A+E+LR+ PC  +    L+ +Y       E+R+ +YL+L++CP +E  R+I +    E N Q+GSFVWSH++N ME+++        + ++  K +  ++ R+FNL+   +S+ +E +F
Sbjct:   12 NMTIAALESLRRMPCRQETTEQLFNIYASHHNDVEIRVASYLALLKCPNKELLRRIAKVQRTEVNNQVGSFVWSHLTNAMESTE--PVHGLPMARMLQKALGGNVLREFNLNRLRFSRAVEGSF 133          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: apobb.2 (apolipoprotein B-100-like [Source:NCBI gene;Acc:101158990])

HSP 1 Score: 77.411 bits (189), Expect = 4.300e-13
Identity = 117/511 (22.90%), Postives = 196/511 (38.36%), Query Frame = 3
Query: 1407 AMNKLVKHIENSCYF------DNNKDNEKVLYTLRALGNSGN--FHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXXXXXXXXXX-XXXDIFGRSVNILEFGIRGKGISE---KLFGR--FYPKPHKNA-------HPDIV-----------KMQKKSEN-----------------KGEKLSLGVYSRIMGREIFYSPNVLSALTMSILNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKDDGTSLTDYQFEINKIPDDKKLLAISNELSLIHNLKIEEAKPKYS--ALLNKCTSDAFLELRGFKLC 2786
            A  KL+  I +   F      D   D +    TLR +GN     F     L K +  CV+   +   V+  A++A RQ P   +    L +V  +     + RI AYL L++ P      ++      EDN QL +FV SHI N++ ++D    E R ++  +  PM                    T    Y    L++N+++ +           +++  FG  ++++E G+ GKG       LFG   F+P     A        PD V           K +KK EN                   E     VY R++G E+ Y  +   A +  +++P   F+    ++ +D    + T+TG P+ +++    +           G I    QN+V+      L+     T+VG      V S  E    L   SG+K +        +  I       KLL ++N L  +   +++   P  +    ++KC+      L G K+C
Sbjct:  323 AEKKLIPEIHSVAEFMADELGDCTGDQDHAFLTLRVIGNMAPAVFPASPALRKAVLQCVNQPAAGQQVQQAAIQAYRQIPVPQEARKVLMEVLLNKGNPVQQRIAAYLVLMKDPETSELAQLDDAFLNEDNDQLLNFVMSHIINILSSTD---PETRHVVAPYFDPM--------------------TLSSNYKLGSLESNMIYESGSYLPKEVMLDMTLKAFGFEIDMMEIGMEGKGFEPAIVALFGEDGFFPDTTLKAMYFVTENMPDAVSEMLQNIIPALKNRKKRENLIKEIGQNIEKLLREMKAAESPEAMVYLRLLGNELGYLKSSEIASSAQMIDPVTNFFAH--YIFMDNEFFLPTVTGVPLRVSLSGTFAPGFR-------GGIQ---QNSVSFMPSAGLEF---VTQVGSHIPEFVDSGLEMHTNLFHESGIKVEFPKVKAAVKLTIPAPTSPTKLLKVTNTLVAVVGSEVKTIPPLVTDKVDISKCSR----ALAGMKIC 791          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000015835.2 (pep primary_assembly:ASM223467v1:24:6559546:6567281:-1 gene:ENSORLG00000012638.2 transcript:ENSORLT00000015835.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 6.805e-10
Identity = 63/251 (25.10%), Postives = 114/251 (45.42%), Query Frame = 3
Query: 1398 IIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGN-FHNYKLLIKI-LESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILF-XXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFGR--FYP 2126
            I+  +N + + + +    D   + E    TLR +GN G+   +    IK  L  C+    +   V++ A++A R+   + ++ + L +V        + R+ AYL L+R P       + + L QE N Q+ +FV SHI N++ ++D    + +   +     M D     + D+   S+N +           +  N++F  +S +P  +    ++  FG S +I E G+ GKG     E LFG   F+P
Sbjct:  443 ILTKINDVYEFVTSILGADCPGEKELTFLTLRVVGNMGDAMESVDPKIKTTLVKCMRQPATTLSVQLAAIQAFRRMSVNDEVRSNLQRVSQYPKGAVQKRLAAYLILMRNPQDSDIEAVTKILTQEQNPQVKAFVSSHIYNIISSND---PDTKSFGKKILDAMEDTDVATHYDYTIKSRNYKLGMAHESLQASVQGNVIFDPSSRLPREVLLETTLKAFGYSSDIWEVGMEGKGFEPTIEALFGENGFFP 690          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 64.3142 bits (155), Expect = 3.444e-9
Identity = 66/290 (22.76%), Postives = 120/290 (41.38%), Query Frame = 2
Query: 9812 LLPPFSK--TAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKN-NKIEYELSYINKIVIR-----------NDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWS--------------LGKCDAKTKTGL--YSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILI 10591
            L  P SK  T W +      TFDG       G C+Y++A++  + S      V ++N N+  + +SY+  + ++             GRV VD  + + LP +  + K    I+++   V I+   G++++Y +   +L +     + G   GL G+ +    +D +TP+G     A     SW               +G C + T++ L  +   +S   +   EN          K C ++I+P+ Y   C   L  G       ++ LC+    Y   C++ G+ I
Sbjct:   37 LCVPQSKMGTCWAMGDPHYRTFDGQRFDF-MGTCTYVIAKNCGEDSRLTAFEVHAQNENRGSHRVSYVGLVTVQVYDTTITAVRSETGRVRVDNSLWS-LPIILNNGK--LKIFQSGRSVVIEADFGLMVRY-DWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKEN-------GPFKNCHAIIDPKAYLENCKYDLCMG----KGLRQFLCNALETYAEACQAAGVQI 310          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: apoba (apolipoprotein B-100 [Source:NCBI gene;Acc:101156458])

HSP 1 Score: 62.7734 bits (151), Expect = 1.011e-8
Identity = 51/181 (28.18%), Postives = 90/181 (49.72%), Query Frame = 3
Query: 1596 AVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSD----RFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILF-XXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGIS---EKLFG 2114
            A+  L+Q   + +I + L ++Y D     E RI AYL L++ P R   R ++  L +E ++QL SFV S+++N++ + D    + K ++  +LQ    P N++       F   S+N +     G     + +NI+F   + +P  +    ++  FG S +I E G+ G G     + LFG
Sbjct:  518 ALRTLQQMDMNDEIRSTLMELYRDTQSPLEKRIAAYLVLMKKPDRSLLRDLVNSLMKERDKQLRSFVVSYLNNILRSEDPQMLQIKADIEKVLQGELPPQNNV-------FHGLSRNYKMESPLG----SVHSNIIFDGRNTLPKEVILEATMKAFGSSYDIFEVGVEGAGFEPTVDALFG 687          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: zanl (zonadhesin [Source:NCBI gene;Acc:101162078])

HSP 1 Score: 62.003 bits (149), Expect = 1.997e-8
Identity = 59/254 (23.23%), Postives = 103/254 (40.55%), Query Frame = 2
Query: 9899 GQCSYLLARDFKKGSFSLV-MNVDSKNNKIEYELSYIN---------KIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKY-FNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILI---RLDKTCVNC 10618
            G CSY+++      S     ++ D++N      +SY+          KI I   G V V+G  VN LP    +     +++++     +  + G+ ++Y  N F  +K++    +   + GL G  +    +D   P G +T+DA     SW+   C+ +    +   +    +L E       D  S    C   +NP  YF  C   L     +K     +LC     YV  C+ +G+ I   R +  C+ C
Sbjct: 1435 GNCSYVMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVN-LPV---NPTPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKVIK---YQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLCELEGAKP----ILCEAIEAYVNECQDRGVDIGPWRNETFCLKC 1677          

HSP 2 Score: 60.8474 bits (146), Expect = 4.138e-8
Identity = 59/254 (23.23%), Postives = 102/254 (40.16%), Query Frame = 2
Query: 9899 GQCSYLLARDFKKGSFSLV-MNVDSKNNKIEYELSYIN---------KIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKY-FNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILI---RLDKTCVNC 10618
            G CSYL++      S     ++ D++N      +SY+          KI I   G V V+G  VN LP    +     +++++     +  + G+ ++Y  N F  +K++    +   + GL G  +    +D   P G +T+DA     SW+   C+ +    +   +    +L E       D       C   +NP  YF  C   L     +K     +LC     YV  C+ +G+ I   R +  C+ C
Sbjct:  455 GNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVN-LPL---NPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKVIK---YQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKP----ILCEAIEAYVNECQDRGVDIGPWRNETFCLKC 697          

HSP 3 Score: 59.6918 bits (143), Expect = 9.807e-8
Identity = 58/254 (22.83%), Postives = 102/254 (40.16%), Query Frame = 2
Query: 9899 GQCSYLLARDFKKGSFSLV-MNVDSKNNKIEYELSYIN---------KIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKY-FNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILI---RLDKTCVNC 10618
            G CSY+++      S     ++ D++N      +SY+          KI I   G V V+G  VN LP    +     +++++     +  + G+ ++Y  N F  +K++    +   + GL G  +    +D   P G +T+DA     SW+   C+ +    +   +    +L E       D       C   +NP  YF  C   L     +K     +LC     YV  C+ +G+ I   R +  C+ C
Sbjct: 2253 GNCSYVMSGICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVN-LPL---NPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKVIK---YQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKP----ILCEAIEAYVNECQDRGVDIGPWRNETFCLKC 2495          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000073666.1 (SMESG000073666.1)

HSP 1 Score: 5071.91 bits (13155), Expect = 0.000e+0
Identity = 2622/2622 (100.00%), Postives = 2622/2622 (100.00%), Query Frame = 2
Query: 3584 KKYDVNHDVNFFISNKFLSFENKPLLMNFKVETFDKLKKQYVRQINTKLFVDLNPKNGRFVFRNFINHQIWKISHNLNSKAIWKKNSLDMYDVEVELTESDXXXXXXXXXXXXXQNGISSMEIIYKKTIFKINSELNLPKNHFLTVSWLENSFTINSKVDTKSISPFNSVITHDLNMNGKLLATITNTAELDYEKVLYSFKSTGRTPQTDLYSINLGMQLNSYFAFNKIKYDFASKIQMKIPPKKIDFTVEMKQFANIKLDGEINIKDKTFESKIVYKNQNKDTFGYEIIVEEIKADETLNQIKTTIYRGTAEDXXXXXXXXXXXXXLYGFSVDSEKLINYEVLWKMNNENGKITSSFLMSLDIKRXXXXXXXXXXXMEILVKLQNTFSLTWNGKYGKASNANLIPFQGSIKYFGTGVKDFDINFDVSHPVLSMFKLSKVILGFNFKMNSGANNKGTMTSNAITKWQFENERTAKYYELKLNGNYELKSRNNVFDMEAVIVXXXXXXXXXXXXXXXXXXXXXVESSFKLKYSDKYITMAANANFMDIKNISFLLSIKTSNSLLKELTISSELKTLGTTFQGKSNFFLKSAKSYNIQITQVRKLDLTNGEDLVSNVKWESNIPYLNSGSYVFGYLMSKNRNAQINFSLIYKNSKKINVKFSFDSKSNEFQILGESFIVFPLKVSLIVSRISKNTYTVNSEFGFKEKFLKISDSKVSWIFENGKNYVDFAMSLQSSNEVFSDMTFAMDSYYETGRFFQSYKSNLHSKYKGKTIQLYKIDLPSGEIKIDSQLGXXXXXXXXXXXXXDMKYKFNSIRDMSMKYKMLLNPAFDEIQFEFIYFRNLEGEKPKNFETFGEAKWFCKMDFKCKDNLLKAVGFVDKNFAKGVFNFQANIPKISLKFNEVLFNVEIQKESDSSYKGTAKYKELEYKFRYKPLGLSKQSLEVEAVSKNTQPKIITLSYDFNDNLILKVSIDKLLKFDVNLKSESGEKKAGTVELVFXXXXXXXXXXXXXXXYPSDVKTINDAVISLFKFKKGIYFKYQINGKIFEKNVKRTTEMYHMKSEKFPGGTKSFYSSETTIESARSMSSKILISLDGNSPMYEWEDACFLKVDNELIFDVSHLVKFISYNDIMVRTSSIIKNKYKSNILAIYNSQIIQFNGKFEFPEKDILLGFGFRVARSNDLDLSLAYCNNNYTFSTNLGNLISLDKRENYFPVGKEYYIVISKTYEIRIARKKSMEYEAVLNCNWPKPLKVNVMXXXXXXXXXXXXXGSSPFEQMKSFNLKFTNVYLQNPYEFIVSIRLNKKQISDLNLKIYLAYQNTPYSIKLNYKGNKNVNGEISLDVKNYKFSHSIVVKDGAYKTELWSCFSKCQIMPTFDCYITHKNSAREIVVGMNLEKNVKRLELTWHKSKRQSLILTIKEKSGEKIILFENPMNKIRLMRAQVIQQDEKVGKLYLDVESIGKSTEKNNFINVNYVMKGSLKSDYKLEVKLNTSLMHKEVKVVIKRDVSLDIGDLYALEVNASFVNEKSAFFTVKGYLRQLSTRSYEVKLHSTNYDRFATLTITTIFASEEISLEYKLIQSDLPAKEFLFQYIPLRKFHLTNKKDLNILMNRVMYQYGYRSDYALKLGKDGLDISAFSTFSRSPIKYYLEINRKDEKIVIHLRPVGNFIIGELYRKTSDKKMLDASLKLNIDDRNVLNSKLYWNPELLERIKKLLDLIFNPKNIRNLMTQTYQNSENQLSKYLSSVKMDIIKNVNVPVSLDFAKSIVNDWEEFPKTMSLSYENDNYYIKTALKKMSDGFAQMDFSLSFNRFQNSCSELKNVLSSSLYEWFVEAKLYSIFYEPIKNKLNSFTYDHIKSGIQMIVNCGKRGFQVYKVIVGKIADVMGIISEKAKKTLFLSNSLKNALKNVYSNSLIMDLFSIMADLKTEVLNILEKIMQTDIIKQRIKYYQDAIKDSEETINLILSFKNKVLEYFKTSNAVTNILKTIEFIRSLKYKEAFLNLVKLEETKLQMNLDEASIEFKMYVPPVSMTYFKILKTFTNWLPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQKNSKFHYIFIIEQSKCIESYRVLIENLAKMMGLKSENIFTLLSFNGKDVYKEVHFKTINNKMYVNYDEIMKLLQEAFSPEQLTSKMTEKKITEPGQAIYDVIKMSSVPGFTEKIVLLTCSACSEHQKYGYSLLAGLLNNAGISISYLTTETFTGGNSDVVGIANKMVYTFEKDKIKKVQWKRNIQLPSDACSALARLKDGNIWSLKPLVDDMRNRRLSEVIHEELIKPKINSQTCYCMAGNYENGKTECKISKFRQTYSMLF 11449
            KKYDVNHDVNFFISNKFLSFENKPLLMNFKVETFDKLKKQYVRQINTKLFVDLNPKNGRFVFRNFINHQIWKISHNLNSKAIWKKNSLDMYDVEVELTESDLLKFLLKHKFTTTQNGISSMEIIYKKTIFKINSELNLPKNHFLTVSWLENSFTINSKVDTKSISPFNSVITHDLNMNGKLLATITNTAELDYEKVLYSFKSTGRTPQTDLYSINLGMQLNSYFAFNKIKYDFASKIQMKIPPKKIDFTVEMKQFANIKLDGEINIKDKTFESKIVYKNQNKDTFGYEIIVEEIKADETLNQIKTTIYRGTAEDKYIIKTNKKKDKILYGFSVDSEKLINYEVLWKMNNENGKITSSFLMSLDIKRNNNYNFYYKNNMEILVKLQNTFSLTWNGKYGKASNANLIPFQGSIKYFGTGVKDFDINFDVSHPVLSMFKLSKVILGFNFKMNSGANNKGTMTSNAITKWQFENERTAKYYELKLNGNYELKSRNNVFDMEAVIVKDSSLNKLLELNSKLKLGSNNVESSFKLKYSDKYITMAANANFMDIKNISFLLSIKTSNSLLKELTISSELKTLGTTFQGKSNFFLKSAKSYNIQITQVRKLDLTNGEDLVSNVKWESNIPYLNSGSYVFGYLMSKNRNAQINFSLIYKNSKKINVKFSFDSKSNEFQILGESFIVFPLKVSLIVSRISKNTYTVNSEFGFKEKFLKISDSKVSWIFENGKNYVDFAMSLQSSNEVFSDMTFAMDSYYETGRFFQSYKSNLHSKYKGKTIQLYKIDLPSGEIKIDSQLGYYIKYSSLSSIKLDMKYKFNSIRDMSMKYKMLLNPAFDEIQFEFIYFRNLEGEKPKNFETFGEAKWFCKMDFKCKDNLLKAVGFVDKNFAKGVFNFQANIPKISLKFNEVLFNVEIQKESDSSYKGTAKYKELEYKFRYKPLGLSKQSLEVEAVSKNTQPKIITLSYDFNDNLILKVSIDKLLKFDVNLKSESGEKKAGTVELVFKDKNILKVNLNVNVKYPSDVKTINDAVISLFKFKKGIYFKYQINGKIFEKNVKRTTEMYHMKSEKFPGGTKSFYSSETTIESARSMSSKILISLDGNSPMYEWEDACFLKVDNELIFDVSHLVKFISYNDIMVRTSSIIKNKYKSNILAIYNSQIIQFNGKFEFPEKDILLGFGFRVARSNDLDLSLAYCNNNYTFSTNLGNLISLDKRENYFPVGKEYYIVISKTYEIRIARKKSMEYEAVLNCNWPKPLKVNVMIEIKKEKWWLELKGSSPFEQMKSFNLKFTNVYLQNPYEFIVSIRLNKKQISDLNLKIYLAYQNTPYSIKLNYKGNKNVNGEISLDVKNYKFSHSIVVKDGAYKTELWSCFSKCQIMPTFDCYITHKNSAREIVVGMNLEKNVKRLELTWHKSKRQSLILTIKEKSGEKIILFENPMNKIRLMRAQVIQQDEKVGKLYLDVESIGKSTEKNNFINVNYVMKGSLKSDYKLEVKLNTSLMHKEVKVVIKRDVSLDIGDLYALEVNASFVNEKSAFFTVKGYLRQLSTRSYEVKLHSTNYDRFATLTITTIFASEEISLEYKLIQSDLPAKEFLFQYIPLRKFHLTNKKDLNILMNRVMYQYGYRSDYALKLGKDGLDISAFSTFSRSPIKYYLEINRKDEKIVIHLRPVGNFIIGELYRKTSDKKMLDASLKLNIDDRNVLNSKLYWNPELLERIKKLLDLIFNPKNIRNLMTQTYQNSENQLSKYLSSVKMDIIKNVNVPVSLDFAKSIVNDWEEFPKTMSLSYENDNYYIKTALKKMSDGFAQMDFSLSFNRFQNSCSELKNVLSSSLYEWFVEAKLYSIFYEPIKNKLNSFTYDHIKSGIQMIVNCGKRGFQVYKVIVGKIADVMGIISEKAKKTLFLSNSLKNALKNVYSNSLIMDLFSIMADLKTEVLNILEKIMQTDIIKQRIKYYQDAIKDSEETINLILSFKNKVLEYFKTSNAVTNILKTIEFIRSLKYKEAFLNLVKLEETKLQMNLDEASIEFKMYVPPVSMTYFKILKTFTNWLPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQKNSKFHYIFIIEQSKCIESYRVLIENLAKMMGLKSENIFTLLSFNGKDVYKEVHFKTINNKMYVNYDEIMKLLQEAFSPEQLTSKMTEKKITEPGQAIYDVIKMSSVPGFTEKIVLLTCSACSEHQKYGYSLLAGLLNNAGISISYLTTETFTGGNSDVVGIANKMVYTFEKDKIKKVQWKRNIQLPSDACSALARLKDGNIWSLKPLVDDMRNRRLSEVIHEELIKPKINSQTCYCMAGNYENGKTECKISKFRQTYSMLF
Sbjct: 1191 KKYDVNHDVNFFISNKFLSFENKPLLMNFKVETFDKLKKQYVRQINTKLFVDLNPKNGRFVFRNFINHQIWKISHNLNSKAIWKKNSLDMYDVEVELTESDLLKFLLKHKFTTTQNGISSMEIIYKKTIFKINSELNLPKNHFLTVSWLENSFTINSKVDTKSISPFNSVITHDLNMNGKLLATITNTAELDYEKVLYSFKSTGRTPQTDLYSINLGMQLNSYFAFNKIKYDFASKIQMKIPPKKIDFTVEMKQFANIKLDGEINIKDKTFESKIVYKNQNKDTFGYEIIVEEIKADETLNQIKTTIYRGTAEDKYIIKTNKKKDKILYGFSVDSEKLINYEVLWKMNNENGKITSSFLMSLDIKRNNNYNFYYKNNMEILVKLQNTFSLTWNGKYGKASNANLIPFQGSIKYFGTGVKDFDINFDVSHPVLSMFKLSKVILGFNFKMNSGANNKGTMTSNAITKWQFENERTAKYYELKLNGNYELKSRNNVFDMEAVIVKDSSLNKLLELNSKLKLGSNNVESSFKLKYSDKYITMAANANFMDIKNISFLLSIKTSNSLLKELTISSELKTLGTTFQGKSNFFLKSAKSYNIQITQVRKLDLTNGEDLVSNVKWESNIPYLNSGSYVFGYLMSKNRNAQINFSLIYKNSKKINVKFSFDSKSNEFQILGESFIVFPLKVSLIVSRISKNTYTVNSEFGFKEKFLKISDSKVSWIFENGKNYVDFAMSLQSSNEVFSDMTFAMDSYYETGRFFQSYKSNLHSKYKGKTIQLYKIDLPSGEIKIDSQLGYYIKYSSLSSIKLDMKYKFNSIRDMSMKYKMLLNPAFDEIQFEFIYFRNLEGEKPKNFETFGEAKWFCKMDFKCKDNLLKAVGFVDKNFAKGVFNFQANIPKISLKFNEVLFNVEIQKESDSSYKGTAKYKELEYKFRYKPLGLSKQSLEVEAVSKNTQPKIITLSYDFNDNLILKVSIDKLLKFDVNLKSESGEKKAGTVELVFKDKNILKVNLNVNVKYPSDVKTINDAVISLFKFKKGIYFKYQINGKIFEKNVKRTTEMYHMKSEKFPGGTKSFYSSETTIESARSMSSKILISLDGNSPMYEWEDACFLKVDNELIFDVSHLVKFISYNDIMVRTSSIIKNKYKSNILAIYNSQIIQFNGKFEFPEKDILLGFGFRVARSNDLDLSLAYCNNNYTFSTNLGNLISLDKRENYFPVGKEYYIVISKTYEIRIARKKSMEYEAVLNCNWPKPLKVNVMIEIKKEKWWLELKGSSPFEQMKSFNLKFTNVYLQNPYEFIVSIRLNKKQISDLNLKIYLAYQNTPYSIKLNYKGNKNVNGEISLDVKNYKFSHSIVVKDGAYKTELWSCFSKCQIMPTFDCYITHKNSAREIVVGMNLEKNVKRLELTWHKSKRQSLILTIKEKSGEKIILFENPMNKIRLMRAQVIQQDEKVGKLYLDVESIGKSTEKNNFINVNYVMKGSLKSDYKLEVKLNTSLMHKEVKVVIKRDVSLDIGDLYALEVNASFVNEKSAFFTVKGYLRQLSTRSYEVKLHSTNYDRFATLTITTIFASEEISLEYKLIQSDLPAKEFLFQYIPLRKFHLTNKKDLNILMNRVMYQYGYRSDYALKLGKDGLDISAFSTFSRSPIKYYLEINRKDEKIVIHLRPVGNFIIGELYRKTSDKKMLDASLKLNIDDRNVLNSKLYWNPELLERIKKLLDLIFNPKNIRNLMTQTYQNSENQLSKYLSSVKMDIIKNVNVPVSLDFAKSIVNDWEEFPKTMSLSYENDNYYIKTALKKMSDGFAQMDFSLSFNRFQNSCSELKNVLSSSLYEWFVEAKLYSIFYEPIKNKLNSFTYDHIKSGIQMIVNCGKRGFQVYKVIVGKIADVMGIISEKAKKTLFLSNSLKNALKNVYSNSLIMDLFSIMADLKTEVLNILEKIMQTDIIKQRIKYYQDAIKDSEETINLILSFKNKVLEYFKTSNAVTNILKTIEFIRSLKYKEAFLNLVKLEETKLQMNLDEASIEFKMYVPPVSMTYFKILKTFTNWLPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQKNSKFHYIFIIEQSKCIESYRVLIENLAKMMGLKSENIFTLLSFNGKDVYKEVHFKTINNKMYVNYDEIMKLLQEAFSPEQLTSKMTEKKITEPGQAIYDVIKMSSVPGFTEKIVLLTCSACSEHQKYGYSLLAGLLNNAGISISYLTTETFTGGNSDVVGIANKMVYTFEKDKIKKVQWKRNIQLPSDACSALARLKDGNIWSLKPLVDDMRNRRLSEVIHEELIKPKINSQTCYCMAGNYENGKTECKISKFRQTYSMLF 3812          

HSP 2 Score: 2274.59 bits (5893), Expect = 0.000e+0
Identity = 1191/1191 (100.00%), Postives = 1191/1191 (100.00%), Query Frame = 3
Query:   15 MNQISSSYKLACIIYVIFIASSAYSLNLKPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXXXXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALTMSILNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKDDGTSLTDYQFEINKIPDDKKLLAISNELSLIHNLKIEEAKPKYSALLNKCTSDAFLELRGFKLCALVSVAPKYETFLPNIKAELNIXXXXXXXXXXXXXNTLKPIKKLINFILSLSFKGEEKDTFKFQFQRNIEKKTSMYEISLFNKDIYAKLEVDEXXXXXXXXXXXXEADLSGSIETKGIVSRIINVNIKMGKDEFGVTYNQKFDKGLLISVKAEKKNDKEXXXXXXXXXXXXNHKVFNYFERFRHSTTLKLSGENELGLTLSNDKGNNPIKENKASFETFWKTKSKYNFNIKQKYFWSKYLVVDNSELPTQGTNYTISLEQLFEVGGK 3587
            MNQISSSYKLACIIYVIFIASSAYSLNLKPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIISSLQVSLDSLDSPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFSNSPIPSSISTNVSVDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALTMSILNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKDDGTSLTDYQFEINKIPDDKKLLAISNELSLIHNLKIEEAKPKYSALLNKCTSDAFLELRGFKLCALVSVAPKYETFLPNIKAELNIKKFSGFKFQFKKQNTLKPIKKLINFILSLSFKGEEKDTFKFQFQRNIEKKTSMYEISLFNKDIYAKLEVDEKKVTGKVKYGKVEADLSGSIETKGIVSRIINVNIKMGKDEFGVTYNQKFDKGLLISVKAEKKNDKEFSFSSLTSMTLTNHKVFNYFERFRHSTTLKLSGENELGLTLSNDKGNNPIKENKASFETFWKTKSKYNFNIKQKYFWSKYLVVDNSELPTQGTNYTISLEQLFEVGGK
Sbjct:    1 MNQISSSYKLACIIYVIFIASSAYSLNLKPGESCASSCRGKEKIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIISSLQVSLDSLDSPNYLTETDISGDCITEYSTLPEPPNFVIVKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKFLIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFSNSPIPSSISTNVSVDIFGRSVNILEFGIRGKGISEKLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALTMSILNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKDDGTSLTDYQFEINKIPDDKKLLAISNELSLIHNLKIEEAKPKYSALLNKCTSDAFLELRGFKLCALVSVAPKYETFLPNIKAELNIKKFSGFKFQFKKQNTLKPIKKLINFILSLSFKGEEKDTFKFQFQRNIEKKTSMYEISLFNKDIYAKLEVDEKKVTGKVKYGKVEADLSGSIETKGIVSRIINVNIKMGKDEFGVTYNQKFDKGLLISVKAEKKNDKEFSFSSLTSMTLTNHKVFNYFERFRHSTTLKLSGENELGLTLSNDKGNNPIKENKASFETFWKTKSKYNFNIKQKYFWSKYLVVDNSELPTQGTNYTISLEQLFEVGGK 1191          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000037977.1 (SMESG000037977.1)

HSP 1 Score: 152.91 bits (385), Expect = 3.082e-36
Identity = 217/944 (22.99%), Postives = 412/944 (43.64%), Query Frame = 3
Query:  114 CASSCRGKE-KIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKD----YQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDC-ITEYSTLPEP---PNFVIVKKIKSIAGCARK---NKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIP---VLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKF---LIEDSNL----QNFQDLGISFFENTTPTI--IKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTP-GCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNY-KLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXX-XXXXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYP----KPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALT----MSILNPNMKFYVDKS------FLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKL-GDINLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKD-DGTSLTDYQFEINKIPDDKK----LLAISNELSLIHNLK-IEEAKPKYSALLNKCTSDAFLELRGFKLCALVSV 2801
            C+  C  +E +IFK   G+ YVY +     IK      ET  +++  K  I+ +S C+  L LS++ + +    + N  K+    Y+  K+ LE   + F  +   V  +C D ++  ++ N+KKAI+ SL          +Y   +   G C IT     P+    PN V  +    +  C  K   N  F  ++          R +        C    K    L    C+E        +++    +E+   I     +N   S +   T  ++     +QA   ++ E+ P        K +C+  K ++ +S+  +LF++ +  L  ++ K  KE+      +  C    +++K++  DA        +      LI+ S +    QN     +SF +   P+I  +K     I          L+L S+   +C + P  C  +P I   ++  + ++   C    +  ++ V     +L   GN   Y   +I  L  C++   ++  ++I A+E ++   C  D  + L  + ++ +  SE+RI AYL+++ C    T  K+ + L++E   Q+GSF+W+H++N+ E++D+ K  +RDLL        DL ++F++    +S+NIEKTF      V  D+N++FS    +P S+S N +  IF +S N LE   R +G+ + LF  F P    K  K A  ++  +   +E  G      V  ++ G ++ +   +   L+     +I+   M +  DKS        L+D  V + T+ GFP++  ++ + ++++   +   + G ++  +  N+   +   +    H T++  Q+  T      +G ++K  SG   +   T  T+   E++   D  K    + ++     +IH  K I + + K    +  CTS+  + + G ++C    V
Sbjct:   29 CSMKCSFEEDRIFK--PGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKF-KSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTS--HGKCFITSSEKSPKEETNPNSVNFQY--DLQTCDNKMISNSLFGDIT----------RSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIY---KENQLPSPDRTFTNKNMFETGIEQAEDEIEAEESPYSAAKTTLKDICVQYK-SSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEV-PSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNEND-SELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDV-----DLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSG-----SVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISMNIDNYISPNINAELH-TEIVYQTPFT-----NYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKE-IKMCTSEMTVRILGIRVCGEAKV 932          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000037977.1 (SMESG000037977.1)

HSP 1 Score: 151.369 bits (381), Expect = 1.338e-35
Identity = 216/944 (22.88%), Postives = 410/944 (43.43%), Query Frame = 3
Query:  114 CASSCRGKE-KIFKYEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLSNINLKETFLENSNVKKD----YQMMKTLLENYSLRFGFDDGRVVGICQDKKDNEFAVNVKKAIIXXXXXXXXXXXXPNYLTETDISGDC-ITEYSTLPEP---PNFVIVKKIKSIAGCARK---NKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRSEGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTRSDLTMNHGDQAPLFMKKEKIP---VLDIAKQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKF---LIEDSNL----QNFQDLGISFFENTTPTI--IKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTP-GCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNY-KLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFXXXXXX-XXXXXXXXXDIFGRSVNILEFGIRGKGISEKLFGRFYP----KPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALT----MSILNPNMKFYVDKS------FLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKL-GDINLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKD-DGTSLTDYQFEINKIPDDKK----LLAISNELSLIHNLK-IEEAKPKYSALLNKCTSDAFLELRGFKLCALVSV 2801
            C+  C  +E +IFK   G+ YVY +     IK      ET  +++  K  I+ +S C+  L LS++ + +    + N  K+    Y+  K+ LE   + F  +   V  +C D ++  ++ N+KKAI+ SL          +Y   +   G C IT     P+    PN V  +    +  C  K   N  F  ++          R +        C    K    L    C+E        +++    +E+   I     +N   S +   T  ++     +QA   ++ E+ P        K +C+  K ++ +S+  +LF++ +  L  ++ K  KE+      +  C    +++K++  DA        +      LI+ S +    QN     +SF +   P+I  +K     I          L+L S+   +C + P  C  +P I   ++  + ++   C    +  ++ V     +L   GN   Y   +I  L  C++   ++  ++I A+E ++   C  D  + L  + ++ +  SE+RI AYL+++ C    T  K+ + L++E   Q+GSF+W+H++N+ E++D+ K  +RDLL        DL ++F++    +S+NIEKTF      V  D+N++FS       S+S N +  IF +S N LE   R +G+ + LF  F P    K  K A  ++  +   +E  G      V  ++ G ++ +   +   L+     +I+   M +  DKS        L+D  V + T+ GFP++  ++ + ++++   +   + G ++  +  N+   +   +    H T++  Q+  T      +G ++K  SG   +   T  T+   E++   D  K    + ++     +IH  K I + + K    +  CTS+  + + G ++C    V
Sbjct:   29 CSMKCSFEEDRIFK--PGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKF-KSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSH--GKCFITSSEKSPKEETNPNSVNFQY--DLQTCDNKMISNSLFGDIT----------RSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIY---KENQLPSPDRTFTNKNMFETGIEQAEDEIEAEESPYSAAKTTLKDICVQYK-SSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEV-PSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNEND-SELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDV-----DLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSG-----SVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISMNIDNYISPNINAELH-TEIVYQTPFT-----NYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKE-IKMCTSEMTVRILGIRVCGEAKV 932          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000037978.1 (SMESG000037978.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.578e-15
Identity = 162/707 (22.91%), Postives = 303/707 (42.86%), Query Frame = 2
Query: 9227 EKAKKTL--FLSNSL-----KNALKNVYSNSLIMDLFSIMADLKTEVLNILEKIM-QTD-------------IIKQRIK----YYQDAIKDSEETINLILSFKNKVLEYFKTSNAVTNILKTIEFIRSLKYKEAFLNLVKLEETKLQMNLDEASIEFKMYVPPVSMTYFKILKTF----TNWLPSQTFYKVAKLRISDKLL---ELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYINKI--VIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSE---GIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLS----KSWSLGKCDAKTKTGLYSIK-ISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALC-HRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQ----KNSKFHYIFIIEQSKCIES----YRVLIENLAKMMGLKSENI----FTLLSFNGKDVYKEVHFKTINNKMYVNYDEIMKLLQEAFSPEQLTSKMTEKKITEPGQAIYDVIKMSSVPGFTEKIVLLTCSACSEHQKYGYSLLAGLLNNAGISISYLTTETFTGGNSD----VVGIANKMVYT 11170
            E AK TL   +S SL     +N LKN+Y N     L S +      +LN ++ +M Q D             II + +     Y  D +KD EE   +I SF      Y+  ++ + + +  I+ I ++     +  ++   + K  +N +E SI  +M   P+    FK L  F          Q    + K  I ++L      F    +    +    F S+   LP F   A  +   S++TFD  +  +    C  LL++D K   + ++MN   +NNK  + ++  +    +  ++ +V+++GK     P+    +  + ++     ++K+K  +    I I   NE  ++ I   G++HG ++GL G++D E  ND     G I  +   +     KS S      + +T +  IK     +   C+  F     S L  CF+ +NP+ +  LC H T +   K        +C  +R Y  +C+  G+ I++   C  C   N +K +S +E +    K      +FI+++  C+ S      +L+  L K  G+K++ I    + L+++   D   + +F T+  K+  +  E++  L+        T K +  K  +   AI            +  +++++C++  E+    ++L+  L   A I +S LT  +F   +S+    + G+ ++  YT
Sbjct: 1983 EIAKSTLQIIMSGSLDFLKHENELKNLYKN-----LISCLEKFSKAILNKIDNLMNQVDSNLNNVIGAKFFYIITKSVSTVSSYVIDQMKD-EENQKIITSF-----VYYSIASPLNDWMHKIQ-IFTMDSINPYSFVIYERKNKQLLNENEFSITVRM-TSPIPFNDFKSLPDFGYVRRKIHKIQAAINLIKQTIKNQLANGCRYFELRSWFTLYFPQTPFTSI---LPEFETYA-TISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMN--QQNNKQMFTINIGSNTFELSASNYKVNLNGK-----PSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGIS--GWYHGKVRGLFGNSDNEPFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKC-PFSPLAACFNKVNPKKFHKLCVHSTEEVLTK----LDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPN-DKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDK--GMKTKGINSVHYGLVTY-VDDNNNQANFHTVGQKLLGSSQEMITSLK--------TLKSSNGKFKDFTGAITTAANYPFREHASRHLIIISCTSTKEYPNVLHNLVDKLTKKA-IQVSLLTDFSFKLKDSNKQSIIFGVDSQNTYT 2645          
The following BLAST results are available for this feature:
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC099489.17.418e-3924.46novel lipoprotein amino terminal region containing... [more]
APOB1.952e-2122.32apolipoprotein B [Source:HGNC Symbol;Acc:HGNC:603][more]
APOB1.961e-2022.46apolipoprotein B [Source:HGNC Symbol;Acc:HGNC:603][more]
AC099489.11.064e-1327.80novel lipoprotein amino terminal region containing... [more]
KCP1.165e-924.52kielin cysteine rich BMP regulator [Source:HGNC Sy... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Apoltp5.563e-3924.07gene:FBgn0032136 transcript:FBtr0303874[more]
apolpp2.065e-2423.37gene:FBgn0087002 transcript:FBtr0345297[more]
apolpp2.065e-2423.37gene:FBgn0087002 transcript:FBtr0334627[more]
apolpp2.065e-2423.37gene:FBgn0087002 transcript:FBtr0345296[more]
apolpp2.065e-2423.37gene:FBgn0087002 transcript:FBtr0089188[more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-106c3.36.923e-1831.55si:dkeyp-106c3.3 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
apoba2.014e-1320.94apolipoprotein Ba [Source:ZFIN;Acc:ZDB-GENE-070702... [more]
si:dkeyp-106c3.12.240e-1022.08si:dkeyp-106c3.1 [Source:ZFIN;Acc:ZDB-GENE-050411-... [more]
vtg33.722e-923.22vitellogenin 3, phosvitinless [Source:ZFIN;Acc:ZDB... [more]
vtg34.587e-923.22vitellogenin 3, phosvitinless [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fosb2.986e-2530.27FBJ murine osteosarcoma viral oncogene homolog B [... [more]
fosb3.096e-2530.27FBJ murine osteosarcoma viral oncogene homolog B [... [more]
ddx62.431e-2122.39DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-92... [more]
ddx62.700e-2122.39DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-92... [more]
ddx67.038e-2122.13DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-92... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Apob4.973e-1822.13apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052][more]
Apob5.797e-1227.43apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052][more]
Muc63.396e-823.75mucin 6, gastric [Source:MGI Symbol;Acc:MGI:266323... [more]
Muc63.403e-823.75mucin 6, gastric [Source:MGI Symbol;Acc:MGI:266323... [more]
Tecta1.129e-725.74tectorin alpha [Source:MGI Symbol;Acc:MGI:109575][more]
back to top
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6RG02|VIT_PENME3.436e-3623.84Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 ... [more]
sp|Q9U943|APLP_LOCMI3.118e-3324.17Apolipophorins OS=Locusta migratoria OX=7004 PE=1 ... [more]
sp|Q9V496|APLP_DROME2.070e-2323.37Apolipophorins OS=Drosophila melanogaster OX=7227 ... [more]
sp|Q25490|APLP_MANSE2.525e-2322.80Apolipophorins OS=Manduca sexta OX=7130 PE=2 SV=1[more]
sp|P04114|APOB_HUMAN9.821e-2022.46Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=AP... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QKD66.446e-8327.38Vitellogenin domain-containing protein OS=Crassost... [more]
A0A3G3CBA41.344e-8127.11Apolipophorin 2B OS=Sepioteuthis lessoniana OX=345... [more]
A0A1C9ZV191.023e-7927.19Apolipophorin long isoform OS=Uroteuthis edulis OX... [more]
A0A3G3CBA22.237e-7725.91Apolipophorin 2A OS=Sepioteuthis lessoniana OX=345... [more]
A0A0L8H7W11.569e-7627.98Vitellogenin domain-containing protein OS=Octopus ... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apoba3.906e-1429.31apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
apoba3.974e-1429.31apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
apoba4.007e-1429.31apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
apoba4.140e-1429.31apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
ENSAMXT00000019204.22.481e-1023.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008773.11.549e-925.46pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481274.000e-1732.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apobb.24.300e-1322.90apolipoprotein B-100-like [Source:NCBI gene;Acc:10... [more]
ENSORLT00000015835.26.805e-1025.10pep primary_assembly:ASM223467v1:24:6559546:656728... [more]
FCGBP3.444e-922.76Fc fragment of IgG binding protein [Source:NCBI ge... [more]
apoba1.011e-828.18apolipoprotein B-100 [Source:NCBI gene;Acc:1011564... [more]
zanl1.997e-823.23zonadhesin [Source:NCBI gene;Acc:101162078][more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000073666.10.000e+0100.00SMESG000073666.1[more]
SMESG000037977.13.082e-3622.99SMESG000037977.1[more]
SMESG000037977.11.338e-3522.88SMESG000037977.1[more]
SMESG000037978.12.578e-1522.91SMESG000037978.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003809 ID=SMED30003809|Name=Vitellogenin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=11527bp
TCTGCTTTTTAAACATGAATCAGATTAGCAGTTCGTACAAATTGGCCTGT
ATAATTTATGTCATTTTTATTGCCTCAAGCGCTTATTCCTTAAATCTCAA
ACCAGGCGAATCGTGTGCTAGTAGCTGTAGAGGAAAGGAAAAGATTTTTA
AATACGAAGAAGGCAAAATCTATGTTTATGACTTTCTCTCGACACATACA
ATAAAGAATCCAAACTCAGAAAAAGAAACTTTACAGCTTGAATTAAGCGG
TAAAGCAGAAATATCAAAAATATCAGCTTGTGATTTTGGATTAAAACTTT
CAAACATAAACTTAAAAGAGACTTTCTTGGAAAATAGTAACGTGAAAAAA
GACTACCAAATGATGAAGACTCTACTTGAAAATTACTCTCTGAGATTTGG
ATTTGATGATGGACGAGTTGTTGGTATATGCCAAGATAAAAAGGATAATG
AATTTGCGGTAAATGTAAAGAAAGCCATTATTTCCAGCCTGCAAGTGTCA
CTCGATAGTCTAGACTCACCAAATTATTTAACAGAAACTGATATTTCGGG
TGATTGTATAACAGAATATTCCACTTTACCTGAACCACCAAACTTTGTTA
TTGTCAAAAAAATTAAATCTATTGCTGGATGCGCAAGAAAAAATAAATAT
TTCTCCACTTTGTCAGGAAGACAGTTTGAAGAACCTATGGAAAACAGACA
TCTAGCTTTATTAGACGGTTCGTATGAATGTAATATTAAAATGAAAAGAT
CCGAGGGCTTAAAAGAATCAATCTGCAAAGAAACTCAAGTATTTAAACCT
TTTTCTAGTGATAAAACTGGATCAAAAATAGAAGTAAAACATGAAATACG
ATTTGATACTGTAAAAAACGGAAAAGTTTCAACTGAAACTCCAAATACAA
GATCCGATTTGACAATGAATCATGGAGATCAAGCACCTTTATTCATGAAG
AAAGAAAAGATTCCAGTATTAGACATTGCGAAACAATTGTGCATGACTCT
AAAAAAGAATAATGCTGCCTCAGAAAAGGCACAGTTATTTGTGAAATTTA
TTAGAGCTCTAAGTGATATTGACTACAAAACAATAAAAGAGGTTGAAAAA
TATTTCAATGACAATTCCGAATGCTCTCCGAATAAATCAAAGTTAAAAAA
TTTACTGATCGATGCTTTGCCTCATACTAAAAATGAAGAAGCTTTCAAAT
TTTTAATAGAAGATTCTAATTTACAAAATTTTCAAGATCTTGGAATCTCT
TTTTTCGAAAATACAACACCAACAATAATAAAATTATTTTCAAATAAAAT
TGGGGATCCAAAATTTGATAATTCTGCACTACTGACTTTGTCCTCTATGA
TTAAGTCTTTTTGCGACAAAACTCCCGGATGCGTTCTAAATCCAGATATT
ATATATGCGATGAACAAATTAGTGAAACATATTGAAAATAGTTGTTATTT
TGATAATAATAAAGATAATGAAAAAGTTTTATATACGCTACGAGCTCTTG
GAAATTCTGGAAATTTTCACAACTATAAACTTTTAATAAAAATACTTGAA
TCATGTGTGTCTTCAAAAGTAAGCCAAAACGATGTCAAGATATTTGCTGT
GGAAGCACTGCGACAATTTCCTTGTCACGCAGATATTGATAACTTTCTAT
GGAAAGTTTATGATGATATTAGTTATTTGTCTGAAGTTAGAATCCAAGCA
TATCTTTCATTAATAAGATGTCCATTTCGGGAAACGTTTAGGAAAATTAT
TCAGAAATTGAACCAAGAAGACAACCAACAGTTGGGATCATTTGTTTGGA
GTCATATTTCAAATCTTATGGAAACCTCTGATCGCTTTAAAACTGAACTT
AGAGATTTGTTACAAATATTTACAAAGCCAATGAATGATTTGACTCGAAA
GTTTAACCTAGATTTTCGATCGTATTCCAAAAATATAGAGAAAACCTTTC
AAAGAGGATATTCAGCCGTCAAGTTAGATACAAATATTTTATTTTCTAAT
TCGCCCATTCCATCTTCGATTTCAACAAATGTATCTGTCGATATTTTCGG
CAGATCTGTTAATATTTTGGAATTCGGAATTCGAGGAAAAGGAATTTCAG
AAAAGTTATTTGGCCGTTTTTATCCTAAGCCTCATAAAAATGCACATCCC
GATATCGTAAAAATGCAAAAAAAGAGTGAAAATAAAGGAGAGAAACTAAG
TTTAGGAGTATATTCAAGAATTATGGGACGGGAAATATTTTATTCTCCAA
ATGTTTTATCAGCTTTGACAATGAGTATTCTTAATCCAAACATGAAGTTC
TACGTTGACAAATCCTTTTTACTTTTGGATGTTATAGTATCTGTTTCCAC
AATAACTGGTTTTCCTATTGAATTGACCATAGAGTCGGCATTGTCAGTAG
ACTTGAGCTCTAATAACATGATCAAACTTGGAGATATAAATTTATCTTTG
CAAAATAACGTTGCATTGCAAGTAATCGGGAAATTACAAATTAATGCTCA
TTGCACAAAGGTTGGTATTCAATCATATGGCACCGTGTCGTCGGATGCAG
AATTTGGAGGCAAATTGAAAACAATTAGTGGACTTAAGAAAGATGATGGA
ACCAGTTTAACAGATTATCAGTTTGAAATTAACAAAATTCCAGATGATAA
AAAGCTCTTAGCCATTTCGAATGAACTGAGTTTGATCCATAATTTGAAGA
TTGAGGAAGCTAAACCTAAATATTCCGCTTTATTGAATAAATGCACATCA
GATGCTTTCCTAGAGTTACGAGGCTTTAAACTTTGTGCTTTGGTTTCTGT
AGCACCTAAATATGAAACCTTCTTGCCAAATATAAAAGCTGAACTGAACA
TAAAAAAATTCAGTGGATTTAAATTTCAATTTAAGAAACAAAATACTTTA
AAACCAATCAAAAAATTAATTAATTTTATTTTATCACTATCTTTTAAAGG
AGAAGAAAAAGACACATTTAAATTTCAATTTCAAAGAAATATTGAAAAGA
AAACTTCAATGTACGAAATATCCCTATTCAATAAAGACATTTATGCTAAG
TTAGAAGTTGATGAGAAAAAAGTAACTGGCAAAGTAAAATATGGAAAAGT
AGAAGCAGATCTAAGTGGATCTATTGAAACAAAAGGAATAGTTTCACGAA
TCATTAATGTGAATATTAAAATGGGAAAAGACGAATTTGGTGTTACCTAC
AATCAGAAATTCGATAAAGGTTTACTAATTTCTGTAAAGGCAGAAAAAAA
GAATGATAAAGAATTTAGTTTCTCATCTTTAACGTCAATGACTTTAACGA
ATCATAAAGTATTCAACTATTTTGAAAGATTTCGACATTCTACAACATTA
AAACTTTCGGGAGAAAATGAATTAGGACTTACATTATCAAATGACAAAGG
GAACAATCCTATAAAAGAAAATAAAGCTTCTTTTGAAACATTTTGGAAAA
CAAAATCCAAATACAACTTTAATATTAAACAGAAATATTTTTGGTCAAAG
TATTTAGTGGTGGACAACAGTGAATTGCCGACACAAGGAACAAATTACAC
AATTTCATTGGAACAACTTTTTGAAGTTGGAGGAAAAAATATGATGTAAA
TCACGATGTCAATTTTTTCATTTCAAACAAATTTTTGAGTTTCGAAAATA
AGCCTTTATTAATGAATTTTAAAGTCGAAACTTTTGATAAACTAAAGAAA
CAATATGTCCGTCAAATAAACACAAAATTGTTTGTTGATTTAAATCCAAA
AAATGGAAGATTTGTGTTTCGCAATTTCATTAACCATCAAATCTGGAAAA
TTTCTCACAATTTAAATTCGAAAGCTATTTGGAAAAAGAACAGTTTGGAT
ATGTATGATGTAGAAGTTGAATTAACGGAAAGTGATTTATTGAAGTTTTT
ACTAAAGCATAAATTTACCACCACCCAAAACGGAATTTCATCTATGGAAA
TTATTTACAAAAAAACTATTTTTAAAATAAACAGTGAGCTAAATTTACCA
AAAAATCATTTCCTAACTGTTTCCTGGCTGGAGAACTCTTTTACAATTAA
TTCCAAAGTTGATACGAAAAGTATTTCTCCGTTTAATTCCGTAATAACTC
ACGATCTAAATATGAACGGAAAATTATTAGCAACAATAACCAACACAGCA
GAATTAGATTACGAAAAGGTTCTTTACTCATTCAAAAGTACCGGAAGGAC
TCCACAAACCGACTTATATTCAATAAATTTAGGAATGCAATTAAATTCTT
ATTTTGCATTTAATAAAATCAAATATGATTTTGCATCGAAAATCCAAATG
AAAATTCCTCCAAAAAAAATCGACTTCACTGTAGAAATGAAACAATTTGC
TAACATTAAATTGGATGGGGAAATAAATATCAAAGATAAAACATTTGAAA
GTAAAATTGTTTATAAAAATCAAAATAAAGACACTTTTGGTTATGAAATT
ATTGTTGAAGAAATTAAAGCAGACGAAACTTTAAATCAAATTAAAACAAC
AATTTATAGAGGAACAGCAGAGGATAAATATATCATTAAAACAAATAAAA
AGAAAGACAAAATTCTTTATGGATTTTCAGTAGACTCTGAAAAACTCATT
AATTATGAAGTTTTGTGGAAAATGAACAATGAAAATGGAAAAATTACCAG
TTCATTTCTGATGTCATTAGATATAAAGAGAAATAATAATTATAATTTCT
ATTATAAAAACAACATGGAGATTTTGGTGAAATTACAAAATACGTTTTCT
CTGACATGGAATGGTAAATATGGCAAAGCTTCAAACGCTAATTTGATCCC
ATTCCAAGGATCTATAAAATATTTTGGTACTGGAGTAAAAGATTTTGACA
TAAATTTTGATGTAAGCCATCCAGTATTATCCATGTTTAAATTGTCAAAG
GTTATTTTGGGATTTAACTTTAAAATGAACTCTGGCGCCAATAATAAAGG
AACAATGACTTCCAATGCTATTACTAAATGGCAGTTTGAAAACGAAAGAA
CTGCCAAATATTACGAGTTAAAATTAAATGGAAATTACGAGCTAAAGAGT
CGGAATAATGTATTCGATATGGAAGCTGTTATTGTAAAAGACTCTTCGTT
AAATAAGTTATTGGAACTTAATTCTAAATTAAAATTAGGTTCGAATAATG
TTGAATCCAGTTTTAAGCTAAAATATAGTGATAAATATATAACAATGGCT
GCCAATGCCAATTTCATGGATATTAAAAACATATCATTCCTGTTATCAAT
CAAGACATCCAATAGTTTATTAAAAGAATTAACTATTTCGTCAGAACTGA
AAACACTCGGTACGACATTCCAAGGAAAGAGTAACTTCTTTTTGAAATCA
GCCAAGTCCTACAACATTCAAATTACTCAGGTGCGAAAATTAGACTTGAC
TAATGGAGAGGATTTGGTGAGTAATGTCAAATGGGAGTCAAACATTCCTT
ATTTAAACTCCGGATCTTATGTGTTTGGATATCTAATGTCTAAAAACCGG
AATGCTCAAATAAATTTCAGTTTAATTTACAAAAATTCCAAAAAGATTAA
CGTAAAATTTTCATTTGACAGTAAATCAAATGAATTTCAAATTCTCGGAG
AGTCGTTCATTGTTTTTCCTCTTAAAGTTTCGTTAATTGTTTCAAGAATC
TCAAAAAACACCTATACAGTCAATTCGGAATTCGGGTTTAAGGAAAAGTT
TTTAAAAATTTCAGACTCAAAAGTATCCTGGATCTTTGAAAATGGAAAGA
ACTATGTCGATTTCGCAATGAGTTTACAGTCGAGCAATGAAGTTTTCAGT
GATATGACTTTTGCGATGGATAGCTATTATGAAACTGGAAGGTTTTTTCA
GTCTTACAAATCAAATTTGCATTCAAAATACAAAGGAAAAACCATTCAGT
TATATAAAATCGACTTGCCTTCAGGAGAAATAAAAATCGACAGTCAACTG
GGCTACTACATAAAATATTCGTCACTTTCAAGTATAAAATTGGACATGAA
GTATAAATTTAATTCCATCAGAGACATGAGTATGAAATATAAGATGCTGT
TAAATCCGGCCTTTGATGAAATTCAATTTGAATTCATTTACTTTCGAAAT
CTCGAAGGTGAAAAACCTAAGAATTTTGAAACCTTCGGCGAAGCAAAATG
GTTTTGTAAAATGGATTTCAAGTGTAAAGACAATTTGCTTAAAGCAGTTG
GTTTTGTTGATAAAAACTTTGCCAAAGGAGTTTTCAATTTCCAGGCAAAC
ATTCCAAAAATCTCTCTGAAATTTAATGAGGTTTTATTCAATGTAGAAAT
TCAAAAAGAGTCGGATAGCAGTTATAAAGGAACTGCCAAATATAAAGAAC
TGGAGTATAAGTTTAGATACAAACCCTTAGGACTGAGTAAACAGAGTCTT
GAAGTTGAAGCCGTTTCAAAAAATACTCAACCAAAAATTATAACTTTGTC
TTATGATTTCAATGACAATTTAATTTTGAAAGTCTCTATAGATAAACTTC
TGAAATTTGATGTTAATTTAAAGTCTGAATCCGGAGAAAAGAAAGCAGGT
ACCGTAGAACTCGTTTTTAAAGATAAAAATATTCTGAAAGTAAATTTAAA
CGTAAATGTTAAATATCCATCTGACGTTAAAACAATCAACGATGCTGTTA
TATCTTTGTTTAAATTTAAGAAAGGTATTTATTTTAAATATCAAATAAAT
GGTAAAATATTTGAAAAAAATGTTAAAAGAACCACAGAAATGTATCATAT
GAAGAGTGAAAAATTTCCTGGAGGTACTAAAAGCTTTTATAGTTCTGAGA
CTACTATTGAGTCGGCTCGCTCAATGAGTAGTAAAATTTTGATTTCTTTA
GATGGAAACAGTCCAATGTATGAATGGGAGGATGCCTGTTTTTTAAAAGT
TGATAATGAGCTTATATTTGATGTTTCTCATTTAGTCAAATTCATTAGCT
ACAATGACATCATGGTTAGGACGTCGTCGATTATTAAAAATAAATACAAA
TCAAATATTCTAGCGATTTATAATTCGCAAATCATTCAATTCAATGGGAA
ATTTGAGTTTCCTGAAAAAGATATCTTGCTTGGATTTGGATTTAGAGTCG
CAAGATCAAACGACTTAGATCTGAGCCTGGCATATTGCAATAATAATTAT
ACGTTTAGCACAAATCTGGGCAACTTAATATCACTGGATAAAAGGGAAAA
TTACTTTCCAGTCGGTAAAGAATATTATATTGTAATTTCTAAAACATACG
AAATTAGAATTGCTAGAAAAAAGTCTATGGAATATGAAGCTGTTTTAAAT
TGCAATTGGCCTAAACCATTAAAAGTAAATGTAATGATTGAAATTAAAAA
GGAAAAATGGTGGTTGGAATTAAAAGGTAGTTCTCCATTTGAACAAATGA
AAAGCTTCAATTTAAAATTTACCAATGTATATTTACAAAACCCTTACGAG
TTCATTGTCTCTATACGATTAAACAAAAAACAAATATCTGATTTAAATTT
AAAGATATATCTTGCATATCAAAACACTCCTTATAGCATAAAATTGAATT
ATAAAGGAAATAAAAATGTAAATGGTGAAATTAGTTTAGATGTGAAAAAT
TATAAATTCTCTCATTCAATTGTTGTAAAAGACGGAGCTTACAAAACTGA
ATTATGGAGTTGCTTTTCAAAGTGTCAAATAATGCCCACATTCGACTGTT
ACATAACTCATAAAAACAGTGCTAGAGAAATCGTGGTCGGTATGAATTTG
GAGAAAAACGTGAAGAGACTTGAGTTGACATGGCACAAATCAAAACGCCA
GAGTTTGATATTGACTATAAAAGAAAAGAGTGGGGAAAAAATTATTTTAT
TTGAAAATCCAATGAACAAGATTCGTTTAATGCGCGCTCAAGTAATACAA
CAGGATGAAAAGGTCGGGAAATTATATTTGGATGTGGAAAGTATAGGAAA
ATCAACTGAGAAAAACAATTTTATAAATGTAAATTATGTCATGAAAGGAT
CGTTGAAGTCAGATTATAAATTGGAAGTCAAACTTAATACATCACTAATG
CATAAAGAAGTCAAAGTAGTAATTAAAAGAGACGTAAGCCTCGATATTGG
TGACTTGTATGCCTTAGAGGTCAATGCTTCGTTTGTCAATGAAAAATCTG
CATTTTTTACAGTGAAAGGATATCTACGACAACTCTCTACAAGAAGCTAT
GAAGTTAAACTTCACAGCACAAATTACGATAGATTTGCTACTCTTACGAT
AACGACAATATTCGCTTCAGAAGAAATATCTTTAGAATACAAACTAATCC
AAAGTGATTTGCCTGCTAAAGAATTTCTCTTTCAATATATTCCCCTTAGA
AAGTTCCACTTAACAAATAAAAAAGACCTCAATATATTAATGAATCGGGT
CATGTATCAATATGGATATAGAAGTGACTATGCATTAAAATTAGGTAAAG
ACGGGCTAGATATTTCAGCCTTCTCGACCTTTTCTCGAAGTCCTATAAAA
TATTACTTAGAGATAAACAGAAAAGATGAAAAAATTGTTATTCACTTAAG
ACCCGTTGGAAATTTTATTATTGGAGAATTATATCGAAAGACATCTGATA
AAAAAATGCTAGATGCTTCTTTGAAATTGAACATTGATGATCGTAATGTT
CTAAATTCAAAACTTTACTGGAATCCTGAATTACTTGAACGAATAAAGAA
ACTATTAGATTTGATTTTCAATCCGAAAAACATTCGAAATCTTATGACAC
AAACCTATCAAAATAGTGAAAATCAACTTTCAAAATATTTATCCTCTGTA
AAGATGGATATTATAAAAAATGTTAACGTTCCCGTTAGTCTAGATTTTGC
CAAGAGTATAGTAAATGATTGGGAAGAGTTTCCGAAAACTATGAGTTTGA
GTTATGAAAACGATAATTATTATATAAAAACAGCATTAAAAAAAATGTCA
GATGGTTTTGCACAAATGGATTTTTCATTAAGTTTCAATCGCTTTCAAAA
TTCTTGCTCTGAATTGAAAAATGTTCTTTCAAGCTCTTTGTATGAGTGGT
TCGTAGAAGCTAAACTCTACTCGATTTTTTATGAACCAATTAAGAATAAA
TTAAATTCATTTACTTATGACCATATAAAAAGCGGAATTCAAATGATTGT
AAATTGCGGTAAAAGAGGTTTTCAAGTTTATAAAGTCATAGTAGGTAAAA
TCGCCGATGTGATGGGGATTATAAGCGAAAAAGCAAAAAAGACATTATTT
TTATCTAACAGTCTGAAAAATGCTTTGAAAAATGTGTACAGCAATTCATT
GATAATGGATCTTTTCTCAATAATGGCTGATTTAAAAACTGAAGTTCTAA
ATATTCTAGAAAAAATAATGCAAACTGATATAATAAAACAAAGAATAAAA
TATTATCAAGATGCAATTAAAGATTCAGAAGAAACTATTAATCTTATTCT
ATCATTCAAAAATAAAGTATTAGAATATTTTAAAACATCAAATGCGGTGA
CAAATATTTTAAAAACAATTGAATTTATCAGATCCTTGAAATATAAAGAA
GCATTTTTAAATTTAGTTAAATTAGAAGAAACCAAATTACAAATGAATCT
TGATGAAGCCTCAATAGAATTTAAAATGTATGTTCCTCCAGTTTCAATGA
CTTATTTTAAAATATTAAAAACATTTACTAATTGGTTACCGTCACAAACA
TTCTATAAAGTTGCAAAACTTAGAATAAGTGATAAATTGCTCGAATTGTT
TTATCGGTACGAATATATAATGTTCAATTACGGATCATATAATTTTGAGT
CCTTGAGAAAACTTCTACCTCCATTTTCAAAAACTGCTTGGGTATTGGAT
GGAAATTCAATTTTAACCTTTGATGGTAATGCAATAAAAATTGGATCAGG
ACAGTGCTCATATTTGTTGGCTCGGGACTTCAAAAAAGGCAGTTTTAGTT
TAGTCATGAATGTTGATTCAAAAAATAATAAAATTGAATACGAATTATCA
TATATCAATAAAATAGTTATCCGAAACGATGGAAGGGTTTCGGTAGACGG
GAAAATCGTAAATATTCTTCCCGCGGTTTTTAAAGACGAAAAAAGAAATT
TTGCCATTTATCGAAATGATGATTTGGTAAAAATAAAAACATCTGAAGGA
ATAGTCATTAAATACTTTAATGAATTTAAAAGTTTGAAGATAATGGCAAT
AGGATTTTGGCATGGATCTATAAAAGGTCTGCTTGGTTCAAATGATTTTG
AGAAAAGCAACGATTTGTCTACCCCAACTGGCCTAATCACTCATGATGCT
GGAGTTTTATCAAAATCATGGAGTTTGGGAAAATGCGATGCAAAGACTAA
AACCGGATTATATTCAATAAAGATCAGTACAAGTCAACTTCAAGAATGTG
AGAACACATTTCATCCAGACTCTTTATCATATCTCAAACGATGCTTTTCT
TTGATAAATCCGGAACCATATTTTGCTTTATGTCATCGTACATTGCAATA
TGGTCCAAAATCTAAATCAGAATTTAAAGAATTATTGTGCAGCTTGTCAA
GAAACTATGTAATGCGTTGTAAATCCAAAGGAATTTTGATACGATTAGAC
AAAACATGCGTCAATTGTGGCAAAATCAACCTCAACAAAAAAATATCTGA
CCATGAGCTTCAAAAGAACTCCAAATTCCATTATATTTTTATAATTGAAC
AATCTAAGTGCATTGAATCCTACAGAGTCTTAATCGAAAATCTTGCAAAA
ATGATGGGATTAAAATCGGAAAATATTTTTACCCTTTTGTCTTTTAATGG
AAAAGACGTGTATAAAGAAGTTCATTTCAAAACTATTAATAATAAAATGT
ATGTAAACTATGACGAAATCATGAAATTGCTTCAAGAGGCATTTTCTCCA
GAGCAATTGACATCAAAAATGACAGAAAAGAAAATAACTGAACCGGGACA
AGCTATTTATGACGTTATAAAAATGTCAAGCGTGCCAGGATTTACTGAAA
AAATCGTTCTTCTAACATGTTCTGCTTGTTCTGAACATCAGAAATATGGA
TATTCTTTGCTTGCGGGCCTTCTCAACAATGCTGGAATATCAATTTCATA
TTTAACTACTGAAACCTTTACTGGTGGTAACTCAGATGTCGTGGGTATCG
CAAATAAAATGGTCTATACGTTTGAAAAAGATAAAATAAAAAAGGTCCAA
TGGAAAAGAAATATCCAGTTACCTTCTGATGCTTGTTCAGCACTTGCAAG
ATTAAAAGATGGAAATATTTGGTCATTAAAACCATTGGTTGACGATATGA
GAAATAGACGATTATCTGAAGTCATTCATGAAGAACTTATTAAACCAAAA
ATAAACTCCCAAACCTGTTATTGTATGGCTGGAAATTATGAAAATGGGAA
AACTGAATGTAAAATATCAAAATTTAGACAAACTTACTCAATGTTGTTTT
AACAAACTGAACATATTACATTTATGAAATCCCAAGTTCAAACTTTGTAA
TATAAATAAATAAAACCTATTCATTTC
back to top

protein sequence of SMED30003809-orf-1

>SMED30003809-orf-1 ID=SMED30003809-orf-1|Name=SMED30003809-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2597bp
MNFKVETFDKLKKQYVRQINTKLFVDLNPKNGRFVFRNFINHQIWKISHN
LNSKAIWKKNSLDMYDVEVELTESDLLKFLLKHKFTTTQNGISSMEIIYK
KTIFKINSELNLPKNHFLTVSWLENSFTINSKVDTKSISPFNSVITHDLN
MNGKLLATITNTAELDYEKVLYSFKSTGRTPQTDLYSINLGMQLNSYFAF
NKIKYDFASKIQMKIPPKKIDFTVEMKQFANIKLDGEINIKDKTFESKIV
YKNQNKDTFGYEIIVEEIKADETLNQIKTTIYRGTAEDKYIIKTNKKKDK
ILYGFSVDSEKLINYEVLWKMNNENGKITSSFLMSLDIKRNNNYNFYYKN
NMEILVKLQNTFSLTWNGKYGKASNANLIPFQGSIKYFGTGVKDFDINFD
VSHPVLSMFKLSKVILGFNFKMNSGANNKGTMTSNAITKWQFENERTAKY
YELKLNGNYELKSRNNVFDMEAVIVKDSSLNKLLELNSKLKLGSNNVESS
FKLKYSDKYITMAANANFMDIKNISFLLSIKTSNSLLKELTISSELKTLG
TTFQGKSNFFLKSAKSYNIQITQVRKLDLTNGEDLVSNVKWESNIPYLNS
GSYVFGYLMSKNRNAQINFSLIYKNSKKINVKFSFDSKSNEFQILGESFI
VFPLKVSLIVSRISKNTYTVNSEFGFKEKFLKISDSKVSWIFENGKNYVD
FAMSLQSSNEVFSDMTFAMDSYYETGRFFQSYKSNLHSKYKGKTIQLYKI
DLPSGEIKIDSQLGYYIKYSSLSSIKLDMKYKFNSIRDMSMKYKMLLNPA
FDEIQFEFIYFRNLEGEKPKNFETFGEAKWFCKMDFKCKDNLLKAVGFVD
KNFAKGVFNFQANIPKISLKFNEVLFNVEIQKESDSSYKGTAKYKELEYK
FRYKPLGLSKQSLEVEAVSKNTQPKIITLSYDFNDNLILKVSIDKLLKFD
VNLKSESGEKKAGTVELVFKDKNILKVNLNVNVKYPSDVKTINDAVISLF
KFKKGIYFKYQINGKIFEKNVKRTTEMYHMKSEKFPGGTKSFYSSETTIE
SARSMSSKILISLDGNSPMYEWEDACFLKVDNELIFDVSHLVKFISYNDI
MVRTSSIIKNKYKSNILAIYNSQIIQFNGKFEFPEKDILLGFGFRVARSN
DLDLSLAYCNNNYTFSTNLGNLISLDKRENYFPVGKEYYIVISKTYEIRI
ARKKSMEYEAVLNCNWPKPLKVNVMIEIKKEKWWLELKGSSPFEQMKSFN
LKFTNVYLQNPYEFIVSIRLNKKQISDLNLKIYLAYQNTPYSIKLNYKGN
KNVNGEISLDVKNYKFSHSIVVKDGAYKTELWSCFSKCQIMPTFDCYITH
KNSAREIVVGMNLEKNVKRLELTWHKSKRQSLILTIKEKSGEKIILFENP
MNKIRLMRAQVIQQDEKVGKLYLDVESIGKSTEKNNFINVNYVMKGSLKS
DYKLEVKLNTSLMHKEVKVVIKRDVSLDIGDLYALEVNASFVNEKSAFFT
VKGYLRQLSTRSYEVKLHSTNYDRFATLTITTIFASEEISLEYKLIQSDL
PAKEFLFQYIPLRKFHLTNKKDLNILMNRVMYQYGYRSDYALKLGKDGLD
ISAFSTFSRSPIKYYLEINRKDEKIVIHLRPVGNFIIGELYRKTSDKKML
DASLKLNIDDRNVLNSKLYWNPELLERIKKLLDLIFNPKNIRNLMTQTYQ
NSENQLSKYLSSVKMDIIKNVNVPVSLDFAKSIVNDWEEFPKTMSLSYEN
DNYYIKTALKKMSDGFAQMDFSLSFNRFQNSCSELKNVLSSSLYEWFVEA
KLYSIFYEPIKNKLNSFTYDHIKSGIQMIVNCGKRGFQVYKVIVGKIADV
MGIISEKAKKTLFLSNSLKNALKNVYSNSLIMDLFSIMADLKTEVLNILE
KIMQTDIIKQRIKYYQDAIKDSEETINLILSFKNKVLEYFKTSNAVTNIL
KTIEFIRSLKYKEAFLNLVKLEETKLQMNLDEASIEFKMYVPPVSMTYFK
ILKTFTNWLPSQTFYKVAKLRISDKLLELFYRYEYIMFNYGSYNFESLRK
LLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMN
VDSKNNKIEYELSYINKIVIRNDGRVSVDGKIVNILPAVFKDEKRNFAIY
RNDDLVKIKTSEGIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSN
DLSTPTGLITHDAGVLSKSWSLGKCDAKTKTGLYSIKISTSQLQECENTF
HPDSLSYLKRCFSLINPEPYFALCHRTLQYGPKSKSEFKELLCSLSRNYV
MRCKSKGILIRLDKTCVNCGKINLNKKISDHELQKNSKFHYIFIIEQSKC
IESYRVLIENLAKMMGLKSENIFTLLSFNGKDVYKEVHFKTINNKMYVNY
DEIMKLLQEAFSPEQLTSKMTEKKITEPGQAIYDVIKMSSVPGFTEKIVL
LTCSACSEHQKYGYSLLAGLLNNAGISISYLTTETFTGGNSDVVGIANKM
VYTFEKDKIKKVQWKRNIQLPSDACSALARLKDGNIWSLKPLVDDMRNRR
LSEVIHEELIKPKINSQTCYCMAGNYENGKTECKISKFRQTYSMLF*
back to top

protein sequence of SMED30003809-orf-2

>SMED30003809-orf-2 ID=SMED30003809-orf-2|Name=SMED30003809-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1199bp
CFLNMNQISSSYKLACIIYVIFIASSAYSLNLKPGESCASSCRGKEKIFK
YEEGKIYVYDFLSTHTIKNPNSEKETLQLELSGKAEISKISACDFGLKLS
NINLKETFLENSNVKKDYQMMKTLLENYSLRFGFDDGRVVGICQDKKDNE
FAVNVKKAIISSLQVSLDSLDSPNYLTETDISGDCITEYSTLPEPPNFVI
VKKIKSIAGCARKNKYFSTLSGRQFEEPMENRHLALLDGSYECNIKMKRS
EGLKESICKETQVFKPFSSDKTGSKIEVKHEIRFDTVKNGKVSTETPNTR
SDLTMNHGDQAPLFMKKEKIPVLDIAKQLCMTLKKNNAASEKAQLFVKFI
RALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKF
LIEDSNLQNFQDLGISFFENTTPTIIKLFSNKIGDPKFDNSALLTLSSMI
KSFCDKTPGCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALG
NSGNFHNYKLLIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLW
KVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWS
HISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQ
RGYSAVKLDTNILFSNSPIPSSISTNVSVDIFGRSVNILEFGIRGKGISE
KLFGRFYPKPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPN
VLSALTMSILNPNMKFYVDKSFLLLDVIVSVSTITGFPIELTIESALSVD
LSSNNMIKLGDINLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAE
FGGKLKTISGLKKDDGTSLTDYQFEINKIPDDKKLLAISNELSLIHNLKI
EEAKPKYSALLNKCTSDAFLELRGFKLCALVSVAPKYETFLPNIKAELNI
KKFSGFKFQFKKQNTLKPIKKLINFILSLSFKGEEKDTFKFQFQRNIEKK
TSMYEISLFNKDIYAKLEVDEKKVTGKVKYGKVEADLSGSIETKGIVSRI
INVNIKMGKDEFGVTYNQKFDKGLLISVKAEKKNDKEFSFSSLTSMTLTN
HKVFNYFERFRHSTTLKLSGENELGLTLSNDKGNNPIKENKASFETFWKT
KSKYNFNIKQKYFWSKYLVVDNSELPTQGTNYTISLEQLFEVGGKNMM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000419prepharyngeal region
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0002056medial muscle cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001747Lipid_transpt_N
IPR015255Vitellinogen_open_b-sht
IPR015816Vitellinogen_b-sht_N
IPR011030Lipovitellin_superhlx_dom
IPR015817Vitellinogen_open_b-sht_sub1
IPR015819Lipid_transp_b-sht_shell
IPR001846VWF_type-D
Vocabulary: biological process
TermDefinition
GO:0006869lipid transport
Vocabulary: molecular function
TermDefinition
GO:0005319lipid transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001747Lipid transport protein, N-terminalSMARTSM00638lpd_ncoord: 51..603
e-value: 3.0E-10
score: -37.3
IPR001747Lipid transport protein, N-terminalPFAMPF01347Vitellogenin_Ncoord: 51..602
e-value: 1.4E-54
score: 185.6
IPR001747Lipid transport protein, N-terminalPROSITEPS51211VITELLOGENINcoord: 51..673
score: 18.349
IPR015255Vitellinogen, open beta-sheetSMARTSM01169DUF1943_3coord: 640..895
e-value: 4.9E-11
score: 52.7
IPR015255Vitellinogen, open beta-sheetPFAMPF09172DUF1943coord: 641..858
e-value: 9.0E-24
score: 84.3
IPR011030Lipovitellin-phosvitin complex, superhelical domainGENE3DG3DSA:1.25.10.20coord: 310..632
e-value: 3.4E-43
score: 150.0
IPR011030Lipovitellin-phosvitin complex, superhelical domainSUPERFAMILYSSF48431Lipovitellin-phosvitin complex, superhelical domaincoord: 326..626
IPR015816Vitellinogen, beta-sheet N-terminalGENE3DG3DSA:2.30.230.10coord: 50..304
e-value: 9.8E-34
score: 119.0
NoneNo IPR availablePANTHERPTHR23345VITELLOGENIN-RELATEDcoord: 44..856
IPR015819Lipid transport protein, beta-sheet shellSUPERFAMILYSSF56968Lipovitellin-phosvitin complex; beta-sheet shell regionscoord: 641..896
IPR015819Lipid transport protein, beta-sheet shellSUPERFAMILYSSF56968Lipovitellin-phosvitin complex; beta-sheet shell regionscoord: 51..296