Tyrosine-protein phosphatase non-receptor type 23

Overview
NameTyrosine-protein phosphatase non-receptor type 23
Smed IDSMED30003808
Length (bp)360
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein phosphatase non-receptor type 23 (SMED30003808) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase non-receptor type 23 (SMED30003808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein phosphatase non-receptor type 23 (SMED30003808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase non-receptor type 23 (SMED30003808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003808h1SMcG0010889 Contig3848GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003808h1SMcG0020717 Contig3848GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30003808h1SMcG0010889 dd_Smed_v4_3351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003808h1SMcG0010889 dd_Smed_v4_3351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003808h1SMcG0010889 dd_Smed_v4_3351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003808h1SMcG0010889 dd_Smed_v4_3351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Human
Match: PTPN23 (protein tyrosine phosphatase non-receptor type 23 [Source:HGNC Symbol;Acc:HGNC:14406])

HSP 1 Score: 65.4698 bits (158), Expect = 4.893e-13
Identity = 34/92 (36.96%), Postives = 56/92 (60.87%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L+++++ SE  ++ EE LKK+ +L  YL QN+ AQ R++ A+ E N   A  +  + ++ Q
Sbjct:  559 ILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDH-SEMKKLFEEQLKKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQ 649          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Fly
Match: mop (gene:FBgn0036448 transcript:FBtr0075700)

HSP 1 Score: 52.373 bits (124), Expect = 1.064e-8
Identity = 28/92 (30.43%), Postives = 47/92 (51.09%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV EM +QR+     L+  + EDD+T  +++         +    L KH ++ + L QNM+AQ  I+ A+ E+ A  A     + ++KQ
Sbjct:  560 ILNKVNEMKAQRAQFHADLRIAINEDDITGKVIAHGGQEGLQALFATELGKHDKITELLDQNMVAQGNILQALTENYAKAAPVLKTLQDVKQ 651          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Zebrafish
Match: ptpn23a (protein tyrosine phosphatase, non-receptor type 23, a [Source:ZFIN;Acc:ZDB-GENE-100921-24])

HSP 1 Score: 58.5362 bits (140), Expect = 9.982e-11
Identity = 31/92 (33.70%), Postives = 53/92 (57.61%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QRS L  QL+  + +DD+T  L+++   ++  ++ EE LKK+ ++  Y+ QN+ AQ  I+ A+ E N   A  +  + E + 
Sbjct:  541 ILGKVQEMRDQRSSLEKQLRDLIQQDDITTALVTTER-ADMKKLFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYATVRKGLTETEH 631          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Zebrafish
Match: ptpn23a (protein tyrosine phosphatase, non-receptor type 23, a [Source:ZFIN;Acc:ZDB-GENE-100921-24])

HSP 1 Score: 58.151 bits (139), Expect = 1.111e-10
Identity = 31/92 (33.70%), Postives = 53/92 (57.61%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QRS L  QL+  + +DD+T  L+++   ++  ++ EE LKK+ ++  Y+ QN+ AQ  I+ A+ E N   A  +  + E + 
Sbjct:  557 ILGKVQEMRDQRSSLEKQLRDLIQQDDITTALVTTER-ADMKKLFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYATVRKGLTETEH 647          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Zebrafish
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 52.373 bits (124), Expect = 1.143e-8
Identity = 29/82 (35.37%), Postives = 49/82 (59.76%), Query Frame = 2
Query:   80 SIFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIA 325
            +I  KV+EM  QR  L  QL+  + +DD+T  L++++  ++   +  E LKK+ +L  Y+ QN++AQ  I+ A+ E N   A
Sbjct:  566 TILGKVDEMRKQRMSLESQLRDLIHKDDITGVLVTTDR-ADFKTLFAEQLKKYDQLKGYIEQNLVAQDNILKALTEANVQYA 646          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Zebrafish
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 52.373 bits (124), Expect = 1.347e-8
Identity = 29/82 (35.37%), Postives = 49/82 (59.76%), Query Frame = 2
Query:   80 SIFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIA 325
            +I  KV+EM  QR  L  QL+  + +DD+T  L++++  ++   +  E LKK+ +L  Y+ QN++AQ  I+ A+ E N   A
Sbjct:  552 TILGKVDEMRKQRMSLESQLRDLIHKDDITGVLVTTDR-ADFKTLFAEQLKKYDQLKGYIEQNLVAQDNILKALTEANVQYA 632          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Xenopus
Match: ptpn23 (protein tyrosine phosphatase, non-receptor type 23 [Source:NCBI gene;Acc:100217320])

HSP 1 Score: 59.3066 bits (142), Expect = 6.990e-11
Identity = 32/92 (34.78%), Postives = 51/92 (55.43%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L++++      ++  E LKK+ +L  Y+ QN+ AQ  I+ A+ E N   A  +  I E +Q
Sbjct:  479 ILNKVQEMREQRQSLEQQLRDTIQQDDITTSLVTTDPFHLLQKLFAEQLKKYDQLKVYVEQNLSAQENILKALTEANVKYAPVRKIITEAEQ 570          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Xenopus
Match: ptpn23 (protein tyrosine phosphatase, non-receptor type 23 [Source:NCBI gene;Acc:100217320])

HSP 1 Score: 58.9214 bits (141), Expect = 8.242e-11
Identity = 32/92 (34.78%), Postives = 51/92 (55.43%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L++++      ++  E LKK+ +L  Y+ QN+ AQ  I+ A+ E N   A  +  I E +Q
Sbjct:  529 ILNKVQEMREQRQSLEQQLRDTIQQDDITTSLVTTDPFHLLQKLFAEQLKKYDQLKVYVEQNLSAQENILKALTEANVKYAPVRKIITEAEQ 620          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Xenopus
Match: ptpn23 (protein tyrosine phosphatase, non-receptor type 23 [Source:NCBI gene;Acc:100217320])

HSP 1 Score: 58.9214 bits (141), Expect = 8.252e-11
Identity = 32/92 (34.78%), Postives = 51/92 (55.43%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L++++      ++  E LKK+ +L  Y+ QN+ AQ  I+ A+ E N   A  +  I E +Q
Sbjct:  539 ILNKVQEMREQRQSLEQQLRDTIQQDDITTSLVTTDPFHLLQKLFAEQLKKYDQLKVYVEQNLSAQENILKALTEANVKYAPVRKIITEAEQ 630          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Xenopus
Match: ptpn23 (protein tyrosine phosphatase, non-receptor type 23 [Source:NCBI gene;Acc:100217320])

HSP 1 Score: 58.9214 bits (141), Expect = 9.921e-11
Identity = 32/92 (34.78%), Postives = 51/92 (55.43%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L++++      ++  E LKK+ +L  Y+ QN+ AQ  I+ A+ E N   A  +  I E +Q
Sbjct:  547 ILNKVQEMREQRQSLEQQLRDTIQQDDITTSLVTTDPFHLLQKLFAEQLKKYDQLKVYVEQNLSAQENILKALTEANVKYAPVRKIITEAEQ 638          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Xenopus
Match: ptpn23 (protein tyrosine phosphatase, non-receptor type 23 [Source:NCBI gene;Acc:100217320])

HSP 1 Score: 58.151 bits (139), Expect = 1.910e-10
Identity = 32/92 (34.78%), Postives = 51/92 (55.43%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L++++      ++  E LKK+ +L  Y+ QN+ AQ  I+ A+ E N   A  +  I E +Q
Sbjct:  539 ILNKVQEMREQRQSLEQQLRDTIQQDDITTSLVTTDPFHLLQKLFAEQLKKYDQLKVYVEQNLSAQENILKALTEANVKYAPVRKIITEAEQ 630          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Mouse
Match: Ptpn23 (protein tyrosine phosphatase, non-receptor type 23 [Source:MGI Symbol;Acc:MGI:2144837])

HSP 1 Score: 65.0846 bits (157), Expect = 5.571e-13
Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L+++++ SE  ++ EE LKK+ +L  YL QN+ AQ  ++ A+ E N   A  +  + E+ Q
Sbjct:  561 ILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDH-SEMKKLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQ 651          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. UniProt/SwissProt
Match: sp|Q9H3S7|PTN23_HUMAN (Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.350e-12
Identity = 34/92 (36.96%), Postives = 56/92 (60.87%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L+++++ SE  ++ EE LKK+ +L  YL QN+ AQ R++ A+ E N   A  +  + ++ Q
Sbjct:  559 ILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDH-SEMKKLFEEQLKKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQ 649          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. UniProt/SwissProt
Match: sp|Q6PB44|PTN23_MOUSE (Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus OX=10090 GN=Ptpn23 PE=1 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 3.897e-12
Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L+++++ SE  ++ EE LKK+ +L  YL QN+ AQ  ++ A+ E N   A  +  + E+ Q
Sbjct:  561 ILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDH-SEMKKLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQ 651          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. UniProt/SwissProt
Match: sp|O88902|PTN23_RAT (Tyrosine-protein phosphatase non-receptor type 23 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptpn23 PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 5.188e-12
Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L+++++ SE  ++ EE LKK+ +L  YL QN+ AQ  ++ A+ E N   A  +  + E+ Q
Sbjct:  386 ILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDH-SEMKKLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQ 476          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. TrEMBL
Match: A0A0R3TXX1 (Tyrosine-protein phosphatase domain-containing protein OS=Rodentolepis nana OX=102285 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.105e-11
Identity = 34/92 (36.96%), Postives = 57/92 (61.96%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I +KVEEM +QR+ +L +L++ +  DD+TQ LL++N   ERN + +  L  H + +D L  N+ AQ  I  A+++ +A +   K  IL+ +Q
Sbjct:  236 ILSKVEEMRAQRTRMLEKLRADLQADDVTQELLATNTKEERNALFQRHLDVHQKAVDLLNLNLTAQENISKALIDAHATVGVKKHDILKRRQ 327          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. TrEMBL
Match: A0A3P7WJX0 (Tyrosine-protein phosphatase domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12694 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.155e-11
Identity = 34/92 (36.96%), Postives = 57/92 (61.96%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I +KVEEM +QR+ +L +L++ +  DD+TQ LL++N   ERN + +  L  H + +D L  N+ AQ  I  A+++ +A +   K  IL+ +Q
Sbjct:  236 ILSKVEEMRAQRTRMLEKLRADLQADDVTQELLATNTKEERNALFQRHLDVHQKAVDLLNLNLTAQENISKALIDAHATVGVKKHDILKRRQ 327          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. TrEMBL
Match: A0A2P6KPV6 (Ptpn23 OS=Nephila clavipes OX=2585209 GN=NCL1_32654 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.448e-11
Identity = 37/89 (41.57%), Postives = 52/89 (58.43%), Query Frame = 2
Query:   92 KVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            KVEEM  QR  L  QL+  +M DD+T++L++     +  +   E LKKH  +I YL QN+ AQ  I+ A+ E NA+ A  +  I EIK 
Sbjct:  566 KVEEMRKQRQYLEQQLRDSLMNDDITKNLVTMKKKEDLQQTFAEELKKHDGIITYLDQNLSAQDNILCALTEANANFAETRKAISEIKH 654          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. TrEMBL
Match: A0A4Y2BIB2 (Tyrosine-protein phosphatase non-receptor type 23 OS=Araneus ventricosus OX=182803 GN=PTPN23_0 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.317e-10
Identity = 34/92 (36.96%), Postives = 53/92 (57.61%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            +  KV+EM  QR  L  QL+  +M DD+T+ L++     +  ++  E LKKH  +++YL QN+ AQ  I+ A+ E NA  A  +  + EIK 
Sbjct: 1219 LVNKVDEMRKQRQYLEQQLRDSLMNDDITKTLVTLKKKEDLQQVFVEELKKHDGIVNYLDQNLSAQDNILCALTEANARYADTRKAMTEIKH 1310          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. TrEMBL
Match: F6UV21 (Protein tyrosine phosphatase non-receptor type 23 OS=Callithrix jacchus OX=9483 GN=PTPN23 PE=4 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 2.440e-10
Identity = 35/92 (38.04%), Postives = 56/92 (60.87%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR  L  QL+  + +DD+T  L+++++ SE  ++ EE LKK+ +L  YL QN+ AQ RI+ A+ E N   A  +  + ++ Q
Sbjct:  528 ILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDH-SEMKKLFEEQLKKYDQLKVYLEQNLAAQDRILRALTEANVQYAAVRRVLSDLDQ 618          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 60.8474 bits (146), Expect = 1.203e-11
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 2
Query:   71 CPYSIFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            C   I  KV+EM  QRS L  QL+  + +DD+T  L+++   ++  R+ EE LKK+ ++  Y+ QN+ AQ  I+ A+ E N   A  +  + E + 
Sbjct:  537 CMKRILGKVQEMKDQRSSLEKQLRDLIQQDDITSVLVTTER-ADMKRLFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYATVRKGLAETEH 631          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 60.8474 bits (146), Expect = 1.379e-11
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 2
Query:   71 CPYSIFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            C   I  KV+EM  QRS L  QL+  + +DD+T  L+++   ++  R+ EE LKK+ ++  Y+ QN+ AQ  I+ A+ E N   A  +  + E + 
Sbjct:  553 CMKRILGKVQEMKDQRSSLEKQLRDLIQQDDITSVLVTTER-ADMKRLFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYATVRKGLAETEH 647          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 59.6918 bits (143), Expect = 2.671e-11
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 2
Query:   71 CPYSIFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            C   I  KV+EM  QRS L  QL+  + +DD+T  L+++   ++  R+ EE LKK+ ++  Y+ QN+ AQ  I+ A+ E N   A  +  + E + 
Sbjct:  553 CMKRILGKVQEMKDQRSSLEKQLRDLIQQDDITSVLVTTER-ADMKRLFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYATVRKGLAETEH 647          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Sea Lamprey
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 43.1282 bits (100), Expect = 3.327e-6
Identity = 28/81 (34.57%), Postives = 45/81 (55.56%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIA 325
            +  KV EM  QR  L  Q++  +  DD+T  L+++   S R    +E +KK+ +L  Y+ QN+ AQ  I+ A+ + NA  A
Sbjct:  571 MLRKVGEMREQRIALEHQIRDVVQGDDITGVLVTAAPGSVRELFNKE-MKKYDQLKVYIDQNLSAQENILRALTDANAKYA 650          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Medaka
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:101156355])

HSP 1 Score: 61.6178 bits (148), Expect = 7.208e-12
Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR+ L  QL+  + +DD+T  L+++    +  RI EE LKK+ ++  Y+ QN+ AQ  I+ A+ E N   A  + ++ + +Q
Sbjct:  545 ILGKVQEMREQRNSLEKQLRDLIQQDDITSTLVTTER-GDMKRIFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYASVRKRLSQTEQ 635          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Medaka
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:101156355])

HSP 1 Score: 61.2326 bits (147), Expect = 8.259e-12
Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            I  KV+EM  QR+ L  QL+  + +DD+T  L+++    +  RI EE LKK+ ++  Y+ QN+ AQ  I+ A+ E N   A  + ++ + +Q
Sbjct:  561 ILGKVQEMREQRNSLEKQLRDLIQQDDITSTLVTTER-GDMKRIFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYASVRKRLSQTEQ 651          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Planmine SMEST
Match: SMESG000061013.1 (SMESG000061013.1)

HSP 1 Score: 171.014 bits (432), Expect = 9.160e-57
Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 2
Query:  104 MTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            MTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ
Sbjct:    1 MTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 85          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Planmine SMEST
Match: SMESG000061288.1 (SMESG000061288.1)

HSP 1 Score: 172.555 bits (436), Expect = 7.045e-51
Identity = 84/92 (91.30%), Postives = 86/92 (93.48%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            +  KVEEM SQRSDLLVQLK+QMMEDDLTQ LLSSNNDSERNRIIEEGLKKHSELIDYLRQNM AQ RIMDAIVEHNAHIAGFKMQILEIKQ
Sbjct:  546 LLGKVEEMMSQRSDLLVQLKTQMMEDDLTQQLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMSAQTRIMDAIVEHNAHIAGFKMQILEIKQ 637          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Planmine SMEST
Match: SMESG000061288.1 (SMESG000061288.1)

HSP 1 Score: 172.555 bits (436), Expect = 7.253e-51
Identity = 84/92 (91.30%), Postives = 86/92 (93.48%), Query Frame = 2
Query:   83 IFTKVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            +  KVEEM SQRSDLLVQLK+QMMEDDLTQ LLSSNNDSERNRIIEEGLKKHSELIDYLRQNM AQ RIMDAIVEHNAHIAGFKMQILEIKQ
Sbjct:  546 LLGKVEEMMSQRSDLLVQLKTQMMEDDLTQQLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMSAQTRIMDAIVEHNAHIAGFKMQILEIKQ 637          
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Planmine SMEST
Match: SMESG000061288.1 (SMESG000061288.1)

HSP 1 Score: 172.555 bits (436), Expect = 7.466e-51
Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 2
Query:   92 KVEEMTSQRSDLLVQLKSQMMEDDLTQHLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMIAQARIMDAIVEHNAHIAGFKMQILEIKQ 358
            KVEEM SQRSDLLVQLK+QMMEDDLTQ LLSSNNDSERNRIIEEGLKKHSELIDYLRQNM AQ RIMDAIVEHNAHIAGFKMQILEIKQ
Sbjct:  541 KVEEMMSQRSDLLVQLKTQMMEDDLTQQLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMSAQTRIMDAIVEHNAHIAGFKMQILEIKQ 629          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PTPN234.893e-1336.96protein tyrosine phosphatase non-receptor type 23 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mop1.064e-830.43gene:FBgn0036448 transcript:FBtr0075700[more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ptpn23a9.982e-1133.70protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn23a1.111e-1033.70protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn23b1.143e-835.37protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn23b1.347e-835.37protein tyrosine phosphatase, non-receptor type 23... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn236.990e-1134.78protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn238.242e-1134.78protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn238.252e-1134.78protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn239.921e-1134.78protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn231.910e-1034.78protein tyrosine phosphatase, non-receptor type 23... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ptpn235.571e-1336.96protein tyrosine phosphatase, non-receptor type 23... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9H3S7|PTN23_HUMAN2.350e-1236.96Tyrosine-protein phosphatase non-receptor type 23 ... [more]
sp|Q6PB44|PTN23_MOUSE3.897e-1236.96Tyrosine-protein phosphatase non-receptor type 23 ... [more]
sp|O88902|PTN23_RAT5.188e-1236.96Tyrosine-protein phosphatase non-receptor type 23 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TXX15.105e-1136.96Tyrosine-protein phosphatase domain-containing pro... [more]
A0A3P7WJX05.155e-1136.96Tyrosine-protein phosphatase domain-containing pro... [more]
A0A2P6KPV67.448e-1141.57Ptpn23 OS=Nephila clavipes OX=2585209 GN=NCL1_3265... [more]
A0A4Y2BIB22.317e-1036.96Tyrosine-protein phosphatase non-receptor type 23 ... [more]
F6UV212.440e-1038.04Protein tyrosine phosphatase non-receptor type 23 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ptpn23a1.203e-1134.38protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a1.379e-1134.38protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a2.671e-1134.38protein tyrosine phosphatase non-receptor type 23 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ptpn23b3.327e-634.57protein tyrosine phosphatase, non-receptor type 23... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptpn23a7.208e-1234.78protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a8.259e-1234.78protein tyrosine phosphatase non-receptor type 23 ... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 23 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000061013.19.160e-57100.00SMESG000061013.1[more]
SMESG000061288.17.045e-5191.30SMESG000061288.1[more]
SMESG000061288.17.253e-5191.30SMESG000061288.1[more]
SMESG000061288.17.466e-5194.38SMESG000061288.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003808 ID=SMED30003808|Name=Tyrosine-protein phosphatase non-receptor type 23|organism=Schmidtea mediterranea sexual|type=transcript|length=360bp
AAATGATTAACATACCGTGGTATAAAGTATTAATGTTCATTATACTGAAT
CCTGGAGAGGAAGAGATTTTTGTCCTTATTCCATTTTTACAAAAGTCGAA
GAAATGACGAGTCAACGTTCGGATTTGCTGGTGCAATTGAAATCCCAGAT
GATGGAGGATGATTTGACTCAGCATCTGTTGAGCAGTAATAATGACTCGG
AAAGAAATCGGATTATCGAGGAAGGGTTGAAGAAGCACAGTGAATTAATT
GATTATTTGCGGCAAAACATGATAGCTCAGGCTCGAATTATGGATGCTAT
AGTTGAGCACAATGCTCATATTGCTGGGTTTAAAATGCAAATATTGGAAA
TAAAGCAGGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0005515protein binding
GO:0004725protein tyrosine phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR025304ALIX_V_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025304ALIX V-shaped domainPFAMPF13949ALIX_LYPXL_bndcoord: 1..74
e-value: 1.7E-8
score: 34.1
NoneNo IPR availableGENE3DG3DSA:1.20.120.560coord: 1..77
e-value: 2.7E-11
score: 45.9
NoneNo IPR availablePANTHERPTHR23030:SF30TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 23coord: 1..75
NoneNo IPR availablePANTHERPTHR23030PCD6 INTERACTING PROTEIN-RELATEDcoord: 1..75