cytochrome c oxidase assembly protein COX15 homolog

Overview
Namecytochrome c oxidase assembly protein COX15 homolog
Smed IDSMED30003798
Length (bp)1193
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cytochrome c oxidase assembly protein COX15 homolog (SMED30003798) t-SNE clustered cells

Violin plots show distribution of expression levels for cytochrome c oxidase assembly protein COX15 homolog (SMED30003798) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cytochrome c oxidase assembly protein COX15 homolog (SMED30003798) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cytochrome c oxidase assembly protein COX15 homolog (SMED30003798) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003798

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003798SMESG000059741.1 SMESG000059731.1 SmedASXL_011788SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
oocyteSMED30003798SMESG000059731.1 Contig27942newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003798SMESG000059731.1 Contig27942newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30003798SMESG000059731.1 Contig27942uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003798SMESG000059731.1 Contig27942uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Human
Match: COX15 (cytochrome c oxidase assembly homolog COX15 [Source:HGNC Symbol;Acc:HGNC:2263])

HSP 1 Score: 358.992 bits (920), Expect = 2.930e-121
Identity = 200/354 (56.50%), Postives = 247/354 (69.77%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S + +R VG WL   SG   GAVILGGVTRLTESGLSM DWHL KE +PP ++EEW  EF +YQ FPE+K     N  M+L+EFKFIW+MEY HRMWGR +G+ Y +PA YF+ KG+ ++ MK +VL   GL+ FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSA+ LY   LW + S L  P K+ +  +L  +R   HG    V LTA+SGAFVAGLDAGL YN++PKM + WIP DL T SP   N+FEN T VQFDHR LG  + T I  L+ + ++    LPRR ++A   L   A  Q+ LGI+TL+ YVP PLAATHQ+GSL LL+ ALWL + LRR+PK
Sbjct:   62 SKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFK---ILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIP--LPRRTKMAAVTLLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK 410          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Human
Match: COX15 (cytochrome c oxidase assembly homolog COX15 [Source:HGNC Symbol;Acc:HGNC:2263])

HSP 1 Score: 301.982 bits (772), Expect = 2.789e-99
Identity = 172/310 (55.48%), Postives = 214/310 (69.03%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIA 1053
            S + +R VG WL   SG   GAVILGGVTRLTESGLSM DWHL KE +PP ++EEW  EF +YQ FPE+K     N  M+L+EFKFIW+MEY HRMWGR +G+ Y +PA YF+ KG+ ++ MK +VL   GL+ FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSA+ LY   LW + S L  P K+ +  +L  +R   HG    V LTA+SGAFVAGLDAGL YN++PKM + WIP DL T SP   N+FEN T VQFDHR LG  + T I  L+ + ++    LPRR ++A  A+ L A+A
Sbjct:   62 SKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFK---ILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIP--LPRRTKMA--AVTLLALA 364          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Human
Match: AL133353.2 (novel transcript)

HSP 1 Score: 94.7449 bits (234), Expect = 2.438e-22
Identity = 46/79 (58.23%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  139 KRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSE 372
            +R VG WL   SG   GAVILGGVTRLTESGLSM DWHL KE +PP ++EEW  EF +YQ FPE+K          L E
Sbjct:   66 ERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKMPCVHPACCLLLE 144          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Celegans
Match: cox-15 (Cytochrome OXidase assembly protein [Source:UniProtKB/TrEMBL;Acc:Q22251])

HSP 1 Score: 374.015 bits (959), Expect = 7.932e-128
Identity = 189/377 (50.13%), Postives = 257/377 (68.17%), Query Frame = 1
Query:   61 SKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADF-PKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S+ +  ++   R+ F      +    ++++G WL   +GM  GAV LGGVTRLTESGLSM +W LF+  +PPF +++W +EF KY+ +PEYK+K S +  M+L+EFKFIW MEYGHRMWGRAIG+ + +P  YF+ +G F   MK ++ +   L+  QG +GW+MV+SGL  +K+ + VPRVSQYRLA HL  A  LYS+F WN  SHL  P  ++    KL  +RGMTHG KL V  TAI GAFVAGLDAGL YN+WPK A+ WIP ++L+ SP W N FEN  TVQF HR L  +T   +L+ +++ +  +A +P+R ++A +    A   Q  LG+ TL++YVP+ LAA HQ+GS+ LLS+ LWLSH LRRLPK
Sbjct:   22 SQGIQNVRQGFRRNFGISVKDVDDKSRKRIGWWLMGCAGMCYGAVALGGVTRLTESGLSMVNWDLFRTMKPPFGQKQWEEEFEKYKAYPEYKYK-SSSEEMTLNEFKFIWSMEYGHRMWGRAIGIVFLIPCAYFWARGRFAPDMKRRMALATTLLLAQGGIGWWMVKSGLDPSKNSSDVPRVSQYRLATHLTMAFVLYSIFFWNGLSHLVKPHDLSKVRSKLGALRGMTHGSKLMVFSTAIMGAFVAGLDAGLVYNSWPKFAENWIPENMLSRSPTWKNFFENDVTVQFVHRNLAYLTVISVLSTFLIGR--RAPIPKRTRMALNLTVAAVFGQAALGVFTLINYVPVWLAACHQSGSMALLSSVLWLSHELRRLPK 395          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Fly
Match: CG3803 (gene:FBgn0034938 transcript:FBtr0072208)

HSP 1 Score: 337.035 bits (863), Expect = 3.184e-113
Identity = 199/353 (56.37%), Postives = 244/353 (69.12%), Query Frame = 1
Query:  133 SPK--RQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQET-KSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHL-STPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRL 1179
            +PK  + VG W   +SGM   AV LGGVTRLTESGLSM  W L  ER P  +EEW +EF  YQ +PEYK K   N +M++ EFKFI+ MEY HRMWGRAIG  + +PA+YF+ KGYF    K  VL+ G LIG QGL+GWYMV+SGL++  +    VPRVSQYRLA+HL +A  LYSL L  A S L  T   V    K   I+G+TH  K  V+LTAISGAFVAGLDAGL YN++PKM D+WIP D+ T +P   NI EN TTVQF+HR LG  T TL  ALW+V ++ +  LP+R   A +A+   A  Q TLG+TTL++YVP+PLA  HQ+GSL+LLS ALWLSH +R L
Sbjct:   41 TPKSDKTVGRWFLGVSGMVFVAVGLGGVTRLTESGLSMVTWKLTGERMPRTQEEWVQEFNLYQQYPEYKLK---NVNMTVEEFKFIFMMEYMHRMWGRAIGGFFLLPAVYFWRKGYFCAKTKKSVLLLGTLIGLQGLMGWYMVKSGLEDRFQDPNDVPRVSQYRLASHLAAAFVLYSLSLSKAMSLLIPTNTFVIQAKKAFNIKGLTHLTKAMVLLTAISGAFVAGLDAGLVYNSFPKMGDKWIPDDMWTFAPIQKNITENPTTVQFNHRILGISTVTLTTALWLVTRRMQ--LPKRANWAINAVVAMAWTQATLGVTTLLNYVPVPLATAHQSGSLILLSFALWLSHEVRLL 388          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Zebrafish
Match: cox15 (cytochrome c oxidase assembly homolog 15 (yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-955])

HSP 1 Score: 363.999 bits (933), Expect = 1.171e-123
Identity = 195/354 (55.08%), Postives = 249/354 (70.34%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S +  R +G WL   SG+ +GAV+LGGVTRLTESGLSM DWHL KE +PP  + EW +EFAKYQ FPE+K     N  M+L+EFKFI++ME+GHRMWGR +G+AY +PA YF+ +GYF++SMK +VL   G + FQGLLGWYMV+SGL+E      VPRVSQYRLAAHLGSA+ LY+  LW   + L    ++ D  +L  +R         V LTA+SGAFVAGLDAGL YN++PKM +RWIP DLL  SP   N+FEN TTVQFDHR LG  + T I  L++  +  +  LPRR ++A   L   A  Q+ LGI+TL+ YVP PLAATHQ+GS+ LL+ A+W+   LR++PK
Sbjct:   51 SAASDRLIGRWLLGCSGLVLGAVVLGGVTRLTESGLSMVDWHLVKEMKPPQTQAEWEQEFAKYQQFPEFKIM---NHDMTLTEFKFIFYMEWGHRMWGRLVGLAYILPAAYFWRRGYFSRSMKTRVLGLCGFVVFQGLLGWYMVKSGLEEKPESYDVPRVSQYRLAAHLGSALLLYAASLWTGLTLLLPANRMPDSRQLLNLRRFAKMTGGLVFLTALSGAFVAGLDAGLVYNSFPKMGERWIPDDLLAFSPALKNVFENPTTVQFDHRILGIGSLTAITGLYLFSR--RMILPRRAKMAISLLTAMAYTQVVLGISTLLLYVPTPLAATHQSGSVALLTFAIWVLAELRKVPK 399          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Zebrafish
Match: cox15 (cytochrome c oxidase assembly homolog 15 (yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-955])

HSP 1 Score: 363.999 bits (933), Expect = 1.472e-123
Identity = 195/354 (55.08%), Postives = 249/354 (70.34%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S +  R +G WL   SG+ +GAV+LGGVTRLTESGLSM DWHL KE +PP  + EW +EFAKYQ FPE+K     N  M+L+EFKFI++ME+GHRMWGR +G+AY +PA YF+ +GYF++SMK +VL   G + FQGLLGWYMV+SGL+E      VPRVSQYRLAAHLGSA+ LY+  LW   + L    ++ D  +L  +R         V LTA+SGAFVAGLDAGL YN++PKM +RWIP DLL  SP   N+FEN TTVQFDHR LG  + T I  L++  +  +  LPRR ++A   L   A  Q+ LGI+TL+ YVP PLAATHQ+GS+ LL+ A+W+   LR++PK
Sbjct:   51 SAASDRLIGRWLLGCSGLVLGAVVLGGVTRLTESGLSMVDWHLVKEMKPPQTQAEWEQEFAKYQQFPEFKIM---NHDMTLTEFKFIFYMEWGHRMWGRLVGLAYILPAAYFWRRGYFSRSMKTRVLGLCGFVVFQGLLGWYMVKSGLEEKPESYDVPRVSQYRLAAHLGSALLLYAASLWTGLTLLLPANRMPDSRQLLNLRRFAKMTGGLVFLTALSGAFVAGLDAGLVYNSFPKMGERWIPDDLLAFSPALKNVFENPTTVQFDHRILGIGSLTAITGLYLFSR--RMILPRRAKMAISLLTAMAYTQVVLGISTLLLYVPTPLAATHQSGSVALLTFAIWVLAELRKVPK 399          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Xenopus
Match: ENSXETT00000031067.1 (cytochrome c oxidase assembly homolog COX15 [Source:NCBI gene;Acc:100486044])

HSP 1 Score: 375.941 bits (964), Expect = 5.419e-128
Identity = 206/352 (58.52%), Postives = 249/352 (70.74%), Query Frame = 1
Query:  133 SPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S +R +G WL   SGM  GAVILGGVTRLTESGLSM DWHL KE +PP  +EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGRA+G+AY +PA+YF+ KG+F++ MK +VL   G + FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSAI LY   LW   S L    K+ +  +L  +R  TH     V LTA+SGAFVAGLDAGL YN++PKM ++WIP DLL  SP + N FENATTVQFDHR LG  +   I  L+   ++    LPRR +LA ++L   A  Q+TLGI+TL+ YVP  LAA HQ+GSL LLS ALWL + LRRLPK
Sbjct:   61 SAERIMGRWLLVCSGMVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPATQEEWQAEFEKYQQFPEFKIL---NHEMTLNEFKFIWFMEYSHRMWGRAVGLAYILPAVYFWRKGWFSRGMKGRVLGLCGFVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSAIVLYCASLWTGLSLLLPKHKLPETRQLLQLRRFTHWTTGLVFLTALSGAFVAGLDAGLVYNSFPKMGEKWIPDDLLAFSPTFKNFFENATTVQFDHRILGISSVAAITGLYYFSRRVP--LPRRAKLALNSLIAVAYLQVTLGISTLLLYVPTSLAAAHQSGSLALLSMALWLMNELRRLPK 407          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Xenopus
Match: ENSXETT00000015779.1 (cytochrome c oxidase assembly homolog COX15 [Source:NCBI gene;Acc:100486044])

HSP 1 Score: 375.17 bits (962), Expect = 5.747e-128
Identity = 206/352 (58.52%), Postives = 249/352 (70.74%), Query Frame = 1
Query:  133 SPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S +R +G WL   SGM  GAVILGGVTRLTESGLSM DWHL KE +PP  +EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGRA+G+AY +PA+YF+ KG+F++ MK +VL   G + FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSAI LY   LW   S L    K+ +  +L  +R  TH     V LTA+SGAFVAGLDAGL YN++PKM ++WIP DLL  SP + N FENATTVQFDHR LG  +   I  L+   ++    LPRR +LA ++L   A  Q+TLGI+TL+ YVP  LAA HQ+GSL LLS ALWL + LRRLPK
Sbjct:   48 SAERIMGRWLLVCSGMVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPATQEEWQAEFEKYQQFPEFK---ILNHEMTLNEFKFIWFMEYSHRMWGRAVGLAYILPAVYFWRKGWFSRGMKGRVLGLCGFVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSAIVLYCASLWTGLSLLLPKHKLPETRQLLQLRRFTHWTTGLVFLTALSGAFVAGLDAGLVYNSFPKMGEKWIPDDLLAFSPTFKNFFENATTVQFDHRILGISSVAAITGLYYFSRRVP--LPRRAKLALNSLIAVAYLQVTLGISTLLLYVPTSLAAAHQSGSLALLSMALWLMNELRRLPK 394          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Xenopus
Match: ENSXETT00000031062.1 (cytochrome c oxidase assembly homolog COX15 [Source:NCBI gene;Acc:100486044])

HSP 1 Score: 374.785 bits (961), Expect = 7.190e-128
Identity = 206/352 (58.52%), Postives = 249/352 (70.74%), Query Frame = 1
Query:  133 SPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S +R +G WL   SGM  GAVILGGVTRLTESGLSM DWHL KE +PP  +EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGRA+G+AY +PA+YF+ KG+F++ MK +VL   G + FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSAI LY   LW   S L    K+ +  +L  +R  TH     V LTA+SGAFVAGLDAGL YN++PKM ++WIP DLL  SP + N FENATTVQFDHR LG  +   I  L+   ++    LPRR +LA ++L   A  Q+TLGI+TL+ YVP  LAA HQ+GSL LLS ALWL + LRRLPK
Sbjct:   41 SAERIMGRWLLVCSGMVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPATQEEWQAEFEKYQQFPEFK---ILNHEMTLNEFKFIWFMEYSHRMWGRAVGLAYILPAVYFWRKGWFSRGMKGRVLGLCGFVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSAIVLYCASLWTGLSLLLPKHKLPETRQLLQLRRFTHWTTGLVFLTALSGAFVAGLDAGLVYNSFPKMGEKWIPDDLLAFSPTFKNFFENATTVQFDHRILGISSVAAITGLYYFSRRVP--LPRRAKLALNSLIAVAYLQVTLGISTLLLYVPTSLAAAHQSGSLALLSMALWLMNELRRLPK 387          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Xenopus
Match: ENSXETT00000015768.1 (cytochrome c oxidase assembly homolog COX15 [Source:NCBI gene;Acc:100486044])

HSP 1 Score: 374.785 bits (961), Expect = 7.264e-128
Identity = 206/352 (58.52%), Postives = 249/352 (70.74%), Query Frame = 1
Query:  133 SPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S +R +G WL   SGM  GAVILGGVTRLTESGLSM DWHL KE +PP  +EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGRA+G+AY +PA+YF+ KG+F++ MK +VL   G + FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSAI LY   LW   S L    K+ +  +L  +R  TH     V LTA+SGAFVAGLDAGL YN++PKM ++WIP DLL  SP + N FENATTVQFDHR LG  +   I  L+   ++    LPRR +LA ++L   A  Q+TLGI+TL+ YVP  LAA HQ+GSL LLS ALWL + LRRLPK
Sbjct:   40 SAERIMGRWLLVCSGMVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPATQEEWQAEFEKYQQFPEFK---ILNHEMTLNEFKFIWFMEYSHRMWGRAVGLAYILPAVYFWRKGWFSRGMKGRVLGLCGFVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSAIVLYCASLWTGLSLLLPKHKLPETRQLLQLRRFTHWTTGLVFLTALSGAFVAGLDAGLVYNSFPKMGEKWIPDDLLAFSPTFKNFFENATTVQFDHRILGISSVAAITGLYYFSRRVP--LPRRAKLALNSLIAVAYLQVTLGISTLLLYVPTSLAAAHQSGSLALLSMALWLMNELRRLPK 386          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Xenopus
Match: ENSXETT00000031051.1 (cytochrome c oxidase assembly homolog COX15 [Source:NCBI gene;Acc:100486044])

HSP 1 Score: 374.785 bits (961), Expect = 7.760e-128
Identity = 206/352 (58.52%), Postives = 249/352 (70.74%), Query Frame = 1
Query:  133 SPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S +R +G WL   SGM  GAVILGGVTRLTESGLSM DWHL KE +PP  +EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGRA+G+AY +PA+YF+ KG+F++ MK +VL   G + FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSAI LY   LW   S L    K+ +  +L  +R  TH     V LTA+SGAFVAGLDAGL YN++PKM ++WIP DLL  SP + N FENATTVQFDHR LG  +   I  L+   ++    LPRR +LA ++L   A  Q+TLGI+TL+ YVP  LAA HQ+GSL LLS ALWL + LRRLPK
Sbjct:   41 SAERIMGRWLLVCSGMVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPATQEEWQAEFEKYQQFPEFK---ILNHEMTLNEFKFIWFMEYSHRMWGRAVGLAYILPAVYFWRKGWFSRGMKGRVLGLCGFVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSAIVLYCASLWTGLSLLLPKHKLPETRQLLQLRRFTHWTTGLVFLTALSGAFVAGLDAGLVYNSFPKMGEKWIPDDLLAFSPTFKNFFENATTVQFDHRILGISSVAAITGLYYFSRRVP--LPRRAKLALNSLIAVAYLQVTLGISTLLLYVPTSLAAAHQSGSLALLSMALWLMNELRRLPK 387          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Mouse
Match: Cox15 (cytochrome c oxidase assembly protein 15 [Source:MGI Symbol;Acc:MGI:1920112])

HSP 1 Score: 363.999 bits (933), Expect = 2.406e-123
Identity = 205/354 (57.91%), Postives = 249/354 (70.34%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S + +R VG WL   SG   GAVILGGVTRLTESGLSM DWHL KE +PP ++EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGRA+G+AY +PA YF+ KG+ N+ MK +VL   GL+ FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSA+ LY   LW + S L    K+ +  +L  +R    G    V LTA+SGAFVAGLDAGL YN++PKM + WIP DLLT SP   N+FEN T VQFDHR LG  + T I  L+ + ++    LPRR ++A   L   A AQ+ LGI+TL+ YVP PLAATHQ+GSL LLS ALWL + LRR+PK
Sbjct:   65 SRAAERAVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQKYQQFPEFKIL---NHDMTLAEFKFIWYMEYSHRMWGRAVGLAYILPAAYFWRKGWLNRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPQHKLPETRQLLWLRRFAGGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLLTFSPVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIP--LPRRTKMAAVTLLALAYAQVALGISTLLMYVPTPLAATHQSGSLALLSGALWLMNELRRVPK 413          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. UniProt/SwissProt
Match: sp|Q8BJ03|COX15_MOUSE (Cytochrome c oxidase assembly protein COX15 homolog OS=Mus musculus OX=10090 GN=Cox15 PE=1 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 1.683e-122
Identity = 205/354 (57.91%), Postives = 249/354 (70.34%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S + +R VG WL   SG   GAVILGGVTRLTESGLSM DWHL KE +PP ++EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGRA+G+AY +PA YF+ KG+ N+ MK +VL   GL+ FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSA+ LY   LW + S L    K+ +  +L  +R    G    V LTA+SGAFVAGLDAGL YN++PKM + WIP DLLT SP   N+FEN T VQFDHR LG  + T I  L+ + ++    LPRR ++A   L   A AQ+ LGI+TL+ YVP PLAATHQ+GSL LLS ALWL + LRR+PK
Sbjct:   65 SRAAERAVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQKYQQFPEFKIL---NHDMTLAEFKFIWYMEYSHRMWGRAVGLAYILPAAYFWRKGWLNRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPQHKLPETRQLLWLRRFAGGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLLTFSPVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIP--LPRRTKMAAVTLLALAYAQVALGISTLLMYVPTPLAATHQSGSLALLSGALWLMNELRRVPK 413          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. UniProt/SwissProt
Match: sp|Q7KZN9|COX15_HUMAN (Cytochrome c oxidase assembly protein COX15 homolog OS=Homo sapiens OX=9606 GN=COX15 PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.407e-120
Identity = 200/354 (56.50%), Postives = 247/354 (69.77%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            S + +R VG WL   SG   GAVILGGVTRLTESGLSM DWHL KE +PP ++EEW  EF +YQ FPE+K     N  M+L+EFKFIW+MEY HRMWGR +G+ Y +PA YF+ KG+ ++ MK +VL   GL+ FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSA+ LY   LW + S L  P K+ +  +L  +R   HG    V LTA+SGAFVAGLDAGL YN++PKM + WIP DL T SP   N+FEN T VQFDHR LG  + T I  L+ + ++    LPRR ++A   L   A  Q+ LGI+TL+ YVP PLAATHQ+GSL LL+ ALWL + LRR+PK
Sbjct:   62 SKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFK---ILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIP--LPRRTKMAAVTLLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK 410          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. UniProt/SwissProt
Match: sp|Q08DG6|COX15_BOVIN (Cytochrome c oxidase assembly protein COX15 homolog OS=Bos taurus OX=9913 GN=COX15 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 2.245e-120
Identity = 203/370 (54.86%), Postives = 252/370 (68.11%), Query Frame = 1
Query:   79 IKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            I +V  +   S  +  S + +R VG WL   SG   GAVILGGVTRLTESGLSM DWHL KE +PP ++EEW  EF KYQ FPE+K     N  M+L+EFKFIW+MEY HRMWGR +G+AY +PA YF+ KG+  + +K +VL   GL+ FQGLLGWYMV+SGL+E      +PRVSQYRLAAHLGSA+ LY   LW + S L    K+ +  +L  +R   HG    V LTA+SGAFVAGLDAGL YN++PKM + WIP DL T SP   N+FEN T VQFDHR LG  + T +  L+ + ++    LPRR ++A   L   A  Q+ LGI+TL+ YVP PLAATHQ+GSL LLS ALWL + LRR+PK
Sbjct:   49 ISDVALQPGRSTVSLPSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSKEEWEAEFQKYQQFPEFK---ILNHDMTLAEFKFIWYMEYSHRMWGRLVGLAYILPAAYFWKKGWLTRGLKGRVLALCGLVCFQGLLGWYMVKSGLEEKPDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPQHKLTETRQLLRLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLFTFSPLLRNVFENPTMVQFDHRVLGIASVTAVTVLYFLSRRIP--LPRRTKIAATTLLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLSVALWLMNELRRVPK 413          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. UniProt/SwissProt
Match: sp|Q9FKT8|COX15_ARATH (Cytochrome c oxidase assembly protein COX15 OS=Arabidopsis thaliana OX=3702 GN=COX15 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 2.399e-85
Identity = 156/343 (45.48%), Postives = 202/343 (58.89%), Query Frame = 1
Query:  124 ISVSPKRQ--VGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRG------MTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGS 1128
            ++  P+ Q  VGIWL   +      V+LGGVTRLT SGLSMTDW    E PP ++E W KEF KY+  PEYK     N  M+L +FKFI+WMEY HRMWGR +G+ +A+P  YF  KGY    +  ++     L   QG +GW+MV+SGL+E  SE + PRVS YRLAAHL SA A+Y    W A S +  P   A+   L  +RG      +   V L V +TAISGAFVAG DAG  +N +PKM D WIP ++  + P   N FEN  TVQ DHR L   T   I  +W   +K     P    L    +G+ A+ Q+TLG++TL+ YVP+ L + HQ G+
Sbjct:   89 VTGGPQAQKWVGIWLFGSAAWVFSMVVLGGVTRLTRSGLSMTDWKFTGEFPPLSDEAWAKEFEKYKQSPEYKR---VNKGMNLEDFKFIYWMEYAHRMWGRGLGIMFALPFSYFLRKGYITLRLGVQLSGLFALGAGQGFIGWWMVKSGLEEPPSEYSQPRVSPYRLAAHLTSAFAIYCGLFWTALS-VVMPEPPAE--SLAWVRGAAKVKKLALPVSLIVGITAISGAFVAGNDAGRAFNTFPKMGDTWIPDNIFEMKPLLRNFFENTATVQLDHRLLATTTLIAIGTMWWFTRKLDIH-PAVKALIGSTVGMTAV-QVTLGVSTLLSYVPVSLGSAHQAGA 423          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. UniProt/SwissProt
Match: sp|Q2Y9R4|CTAA_NITMU (Heme A synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=ctaA PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.216e-73
Identity = 147/368 (39.95%), Postives = 209/368 (56.79%), Query Frame = 1
Query:   79 IKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWH-LFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAF-LPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRR 1176
            ++ VQ  T   Q T    + ++ + IWL     +    V++GGVTRLT+SGLS+ +W  L    PP ++ +W + F KY   P+YK     N  MSL EFK I+W EY HR+ GR IG+A+ +P +YF  K   ++ +  K+     L   QG +GWYMV+SGL +       P VSQYRL AHLG A A+Y+   W A   L+    ++    L+ +   +  +   V +  +SG FVAG+ AGL YN +P M   +IP +L  L P + N F+N TTVQFDHR +      L+   W+   K++A  L    +LAC  L +    QITLGI+TL+  VP+ LAA HQ G+L+L + ALW++H LRR
Sbjct:    1 MQFVQTSTL-PQKTDQKFAVQKPIAIWLFVCCALVFAMVVVGGVTRLTDSGLSIVEWQPLVGTVPPLSQNDWDELFEKYHQTPQYK---KVNLGMSLEEFKTIFWWEYFHRLLGRVIGLAFFIPFLYFLMKKAVDRPLGLKLSGIFLLGALQGGMGWYMVKSGLVDN------PHVSQYRLTAHLGLAFAIYAAMFWVALDLLNPGRGLSANSGLRGLLNFSTMLSALVFIMVLSGGFVAGIRAGLAYNTFPLMDGHFIPPELFMLEPWYRNFFDNMTTVQFDHRLIAWTLAILVPIFWL---KSRAVPLSGSARLACTLLLIMLAVQITLGISTLLLVVPLTLAAAHQAGALLLFTAALWVNHELRR 355          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. TrEMBL
Match: A0A2T7Q1C4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02071 PE=3 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 4.584e-137
Identity = 211/356 (59.27%), Postives = 271/356 (76.12%), Query Frame = 1
Query:  121 TISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
             ISVS ++ VG WL   SGM  GAVILGGVTRLTESGLSM DW L K+ + P +E EWT EF KY+ FPEYK++ S+   M+LS+FKFI++ME+ HRMWGRA G+A+ +PA+YF+ KG+ +K+MK +++++  L+GFQG LGWYMV+SGL+E      +PRVSQYRLAAHLGSA+ LY+LFLW   SHL+TP  + +  ++  +RG++HG+   + LTA+SGAFVAGLDAGL Y++WPKM+DRWIP DL+  SPKW NIFEN+TTVQF+HR LG+ T  LI A W +C+K    L  R +LA + L   +I Q TLGITTL+ YVP  LAATHQ+GSLVLLS A+W +H LRRLPK
Sbjct:   92 NISVSAQKIVGRWLIGCSGMVFGAVILGGVTRLTESGLSMVDWRLLKDMKLPQSEAEWTAEFEKYKTFPEYKYQASQK-EMTLSDFKFIYFMEWAHRMWGRATGIAFILPAVYFWRKGWISKAMKPRLIIYAALLGFQGFLGWYMVKSGLEEKPGPNDIPRVSQYRLAAHLGSALLLYTLFLWGGLSHLTTPQAMPNVKQMAKLRGLSHGLMTIIFLTALSGAFVAGLDAGLIYSSWPKMSDRWIPDDLIAFSPKWKNIFENSTTVQFNHRHLGESTVILIAAFWWMCRKIP--LAPRARLAINCLLGMSILQATLGITTLLTYVPTSLAATHQSGSLVLLSIAVWFAHELRRLPK 444          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. TrEMBL
Match: A0A1S3JHD0 (cytochrome c oxidase assembly protein COX15 homolog OS=Lingula unguis OX=7574 GN=LOC106173096 PE=4 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 1.365e-135
Identity = 218/398 (54.77%), Postives = 278/398 (69.85%), Query Frame = 1
Query:   28 FSLLMKSLINNSKNVLKIKNVQ--RKTFCSQTTT---------ISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVAD-FPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            FS LM     + +   ++ ++Q  R+T  S   +         +S   ++ VG WL   +GM  GAV LGGVTRLTESGLSM DW LF   PP +  EW +EF KY+ FPEY++ ++E G MSL EFKFIW MEY HRMWGR IGV + +PA++F+ KG+  K MK ++ ++GGL+ FQGLLGWYMV+SGL+E K    +PRVSQYRLA+HLGSA  LYSLFLW + SHL TP  V+   P L+ ++G+ H     + LTA+SGAFVAGLDAGL YN+WPKMAD+WIP D+L  SPKW NIFENATTVQF+HR LG++T T I   W++ +K    LP R +LA +AL   A+ Q++LGITTL+ YVP  LAATHQ+GSLVLLS  +WL   L+RLPK
Sbjct:   40 FSTLMSKQCRSLRQSTQLSSLQFLRRTGTSSVNSTVKQGLADGLSDRARKAVGWWLFGCAGMCFGAVALGGVTRLTESGLSMVDWKLFGRPPPRSSAEWEEEFNKYKAFPEYQYHVAEKGEMSLGEFKFIWLMEYTHRMWGRTIGVVFLLPAIFFWSKGWITKPMKPRIGIYGGLLLFQGLLGWYMVKSGLKEKKDPNWIPRVSQYRLASHLGSAFILYSLFLWGSLSHLLTPQMVSGAIPGLRKLQGLAHANLALIFLTAMSGAFVAGLDAGLVYNSWPKMADKWIPDDILAQSPKWKNIFENATTVQFNHRHLGELTATSITLFWLMSRKVP--LPPRARLAMNALFGMAMIQVSLGITTLLTYVPTHLAATHQSGSLVLLSIGIWLMQELKRLPK 435          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. TrEMBL
Match: K1PN57 (Cytochrome c oxidase assembly protein COX15-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10006320 PE=3 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.099e-134
Identity = 215/393 (54.71%), Postives = 273/393 (69.47%), Query Frame = 1
Query:   25 MFSLLMKSLINN---SKNVLKIKNVQ--RKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            MFS    S+ +      + L IK +Q  R T     T      ++ +G WL   +GM  GAVILGGVTRLTESGLSM DW L K+ +PP +++EW +EF +Y+ +PEY+H I E    +LS+FKFI++MEYGHRMWGR IGVA+ VPA +F  KG+ N+S+KF++     L+GFQG LGWYMV+SGLQ+    T VPRVSQYRLAAHLGSA  LYS+FLW   +       + +  +++ +R M H +K    +TAISGAFVAGLDAGLTYN+WPKMADRWIP+DLL  SP W N FEN TTVQFDHR L + T  LI A W + +  KA LP R+++A +AL    + Q +LGI+TL+ YVP PLAATHQ+GSLVLLS A+WL+H  RRLPK
Sbjct:    1 MFSQTFASICSRPYVEIDGLSIKVIQPTRGTTTDAATAPFSRQQKIIGAWLFGCAGMCFGAVILGGVTRLTESGLSMVDWQLLKDMKPPRSQQEWEEEFERYKQYPEYQHIIKER-DFTLSDFKFIYYMEYGHRMWGRMIGVAFLVPAAFFLSKGWVNRSLKFRLAGNAALLGFQGFLGWYMVKSGLQQQPLPTDVPRVSQYRLAAHLGSAFILYSMFLWQGLTQFIPINNLPNTSQMRRLRIMAHSIKGLTFVTAISGAFVAGLDAGLTYNSWPKMADRWIPSDLLAFSPTWKNFFENPTTVQFDHRHLAESTVLLIAAFWYMSR--KAPLPPRMRMAVNALLGMGLLQASLGISTLLMYVPTPLAATHQSGSLVLLSFAIWLTHEFRRLPK 390          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. TrEMBL
Match: A0A210QVL6 (Cytochrome c oxidase assembly protein COX15-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17574 PE=3 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 7.124e-134
Identity = 209/385 (54.29%), Postives = 276/385 (71.69%), Query Frame = 1
Query:   40 MKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVAD--FPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            +KS+   S+ +L    +++    + T  +    ++ +G WL   SGM  GAV+LGGVTRLTESGLSM DW LFK+ +PP ++EEW  EF +Y+ FPEY + ++++  M+LS+FKFI++MEY HRMWGR +G+ + +PA YF  KG+ +K++K ++ ++  LIGFQG LGWYMV+SGLQE    T VPRVSQYRLA+HLGSA  LYSLFL+ A  HL +P K+ D    +   +RG++HGV   V +TA+SGAFVAGLDAGL YN WPKMADRWIP+DL + SP W NIFEN TTVQF+HR L + T   I   W +C+  KA LP R +LAC+ L   A  Q TLGI+TL+ YVP  LAATHQ+GSLVLLS A+W++H L+R+PK
Sbjct:   60 VKSITGQSRQLLP--GIRKSATQASTPALPAYTQKAIGWWLVGCSGMVFGAVVLGGVTRLTESGLSMVDWKLFKDMKPPRSQEEWVAEFERYKQFPEYIY-VNKHNEMTLSDFKFIFYMEYAHRMWGRLVGITFLLPAAYFLKKGWVSKALKPRLAIYTALIGFQGFLGWYMVKSGLQEQAKSTDVPRVSQYRLASHLGSAFLLYSLFLYQALGHLLSPNKLPDTHLKQFVKLRGLSHGVMATVFITALSGAFVAGLDAGLVYNTWPKMADRWIPSDLFSYSPTWKNIFENPTTVQFNHRNLAESTVIAICGFWWMCR--KAPLPPRARLACNCLLGMAFVQATLGISTLLMYVPTHLAATHQSGSLVLLSFAIWVAHELKRMPK 439          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. TrEMBL
Match: A0A0B6ZJ51 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF63922 PE=3 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 2.883e-133
Identity = 206/355 (58.03%), Postives = 265/355 (74.65%), Query Frame = 1
Query:  124 ISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            IS   ++ VGIW+   +GM  GAV+LGGVTRLTESGLSM DW L K+ +PP +EEEW +EF KY+ FPEYK+  S+   M+LS+FKFI++ME+GHRMWGR  G+ + +PA+YF  KG+ ++S K ++ +  GL+G QG LGWYMV+SGL++  + + VPRVS YRLA HLG+A ALY+LFLW  F+HL TP+K+AD   LK +RGM HGVK  V LTA+SGAFVAGLDAGLTYN++PKMAD+WIP D+  +SPKW NIFEN T VQF+HR L + T  LI   W + +  KA L  R +LA + L   A  Q +LG+ TL+ YVP  +AATHQ+GSLVLLS A+W++H LRRLPK
Sbjct:    5 ISQRAQKIVGIWMVGCAGMCFGAVVLGGVTRLTESGLSMVDWRLLKDMKPPGSEEEWQQEFDKYKQFPEYKYMESKK-EMTLSDFKFIYYMEWGHRMWGRTTGIVFLLPALYFLRKGWISQSAKPRLALCAGLLGLQGFLGWYMVKSGLEDKPNPSDVPRVSHYRLATHLGAAFALYTLFLWQGFNHLLTPIKMADAQSLKKLRGMAHGVKTAVFLTALSGAFVAGLDAGLTYNSYPKMADKWIPDDMWVISPKWRNIFENPTFVQFNHRHLAESTVLLIAGFWWLAR--KAPLHPRARLAVNLLLGMAFGQASLGVLTLLTYVPTSIAATHQSGSLVLLSLAVWMTHELRRLPK 356          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Cavefish
Match: cox15 (cytochrome c oxidase assembly protein COX15 homolog [Source:NCBI gene;Acc:103027427])

HSP 1 Score: 303.908 bits (777), Expect = 4.977e-100
Identity = 165/313 (52.72%), Postives = 211/313 (67.41%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQIT 1062
            + +  R VG WL   SG+ +GAV+LGGVTRLTESGLSM DWHL KE +PP ++ EW  EF+KYQ FPE+K     N  M+L+EFKFI++ME+GHRMWGR +G+AY +P +YF+ KGYFN+SMK +VL   G + FQGLLGWYMV+SGL+E      VPRVSQYRLA+HLGSA+ LY   LW     +    K+ +  ++  +R    G    V LTA+SGAFVAGLDAGL YN++PKM D WIP DL+  SP   N FEN TTVQFDHR L   +   I  L++  +  +  LPRR ++A   L   A  Q++
Sbjct:   58 NAATDRTVGRWLVGCSGLVLGAVVLGGVTRLTESGLSMVDWHLVKEMKPPRSQAEWEAEFSKYQQFPEFKIM---NRDMTLTEFKFIFYMEWGHRMWGRLVGLAYILPTVYFWKKGYFNRSMKTRVLGLCGFVFFQGLLGWYMVKSGLEEKPESYDVPRVSQYRLASHLGSALLLYCASLWTGLKLMLPANKLPETRQVLQLRRFAKGTGALVFLTALSGAFVAGLDAGLVYNSFPKMGDYWIPDDLMNFSPALKNFFENPTTVQFDHRVLAIGSLAAISGLYLFSR--RLHLPRRAKIAITCLTAMAYTQVS 365          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Cavefish
Match: cox15 (cytochrome c oxidase assembly protein COX15 homolog [Source:NCBI gene;Acc:103027427])

HSP 1 Score: 303.908 bits (777), Expect = 4.977e-100
Identity = 165/313 (52.72%), Postives = 211/313 (67.41%), Query Frame = 1
Query:  127 SVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQIT 1062
            + +  R VG WL   SG+ +GAV+LGGVTRLTESGLSM DWHL KE +PP ++ EW  EF+KYQ FPE+K     N  M+L+EFKFI++ME+GHRMWGR +G+AY +P +YF+ KGYFN+SMK +VL   G + FQGLLGWYMV+SGL+E      VPRVSQYRLA+HLGSA+ LY   LW     +    K+ +  ++  +R    G    V LTA+SGAFVAGLDAGL YN++PKM D WIP DL+  SP   N FEN TTVQFDHR L   +   I  L++  +  +  LPRR ++A   L   A  Q++
Sbjct:   58 NAATDRTVGRWLVGCSGLVLGAVVLGGVTRLTESGLSMVDWHLVKEMKPPRSQAEWEAEFSKYQQFPEFKIM---NRDMTLTEFKFIFYMEWGHRMWGRLVGLAYILPTVYFWKKGYFNRSMKTRVLGLCGFVFFQGLLGWYMVKSGLEEKPESYDVPRVSQYRLASHLGSALLLYCASLWTGLKLMLPANKLPETRQVLQLRRFAKGTGALVFLTALSGAFVAGLDAGLVYNSFPKMGDYWIPDDLMNFSPALKNFFENPTTVQFDHRVLAIGSLAAISGLYLFSR--RLHLPRRAKIAITCLTAMAYTQVS 365          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Yeast
Match: COX15 (Protein required for the hydroxylation of heme O to form heme A; heme A is an essential prosthetic group for cytochrome c oxidase [Source:SGD;Acc:S000000943])

HSP 1 Score: 240.35 bits (612), Expect = 2.982e-75
Identity = 145/371 (39.08%), Postives = 206/371 (55.53%), Query Frame = 1
Query:  142 RQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWH-LFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETK--SETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHL------STPL------KVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPK-----------WVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRR 1176
            + V  WL   SG+  G V+LGG+TRLTESGLS+T+W  +    PP N++EW +EF KY+  PE+K     N  + L EFKFI++ME+ HR+WGRAIG  + +PA+YF      +  +  ++    GL+G QG +GW+MV+SGL + +  +  + P VSQYRL  HLG+A  LY   LW     L        P+      K  D P +  +R ++  +     LTA+SG  VAGLDAG  YN WPKM +RW P+    +              W N+ EN  TVQ  HR    +  T +LA  +   K KA +PR    + H +      Q TLGI T+++ VP+ LA+ HQ G+L LL+++L  +  LR+
Sbjct:   84 KNVAYWLIGTSGLVFGIVVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL---NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKRLFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAFFLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLAVSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKKDLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTSLHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLRK 451          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Nematostella
Match: EDO48814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RII8])

HSP 1 Score: 355.91 bits (912), Expect = 1.273e-121
Identity = 204/344 (59.30%), Postives = 237/344 (68.90%), Query Frame = 1
Query:  148 VGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRR 1176
            +G WL   +GMT   V LGG+TRLTESGLSM DW L K  +PP  + EW  EFAKYQ FPEYK  IS  G MSL++FK IW+MEY HRMWGRAIGV Y +PA Y + +GYFNKSMK +V V GGL+ FQGLLGWYMV+SGL E      +PRVSQYRLA+HLGSAI  Y   LW +   L    +     +L+  R  TH  K  V LTAISGAFVAGLDAGL YN++PKMA RWIPTDL   SP W N FENATTVQFDHR LG  T   +  LW + +     LP R +LA + L   A  Q+TLGI TL+++VP  LAATHQ+GSLVLLS ALWLS  LR+
Sbjct:    7 LGYWLLGCAGMTFAMVALGGITRLTESGLSMVDWDLIKGMKPPTTQAEWEAEFAKYQEFPEYK--ISNQG-MSLADFKRIWYMEYFHRMWGRAIGVVYFLPAGYLWARGYFNKSMKIRVGVLGGLLVFQGLLGWYMVKSGLDEELIGNNIPRVSQYRLASHLGSAIVFYMGLLWCSLGQLLPRNQYELTKELRRFRMYTHSCKGLVFLTAISGAFVAGLDAGLVYNSYPKMAGRWIPTDLFAQSPTWRNFFENATTVQFDHRILGSTTVAAVAMLWGLARPLA--LPGRARLAVNCLVGMASVQVTLGILTLLYFVPTHLAATHQSGSLVLLSIALWLSTELRK 345          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Medaka
Match: cox15 (cytochrome c oxidase assembly protein COX15 homolog [Source:NCBI gene;Acc:101165997])

HSP 1 Score: 337.806 bits (865), Expect = 2.293e-113
Identity = 196/357 (54.90%), Postives = 247/357 (69.19%), Query Frame = 1
Query:  118 TTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKE-RPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFKXXXXXXXXXXXXXXXWYMVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            T  + +  R VG WL   SG+ VGAV+LGGVTRLTESGLSM DWHL +E +PP  +EEW  EF KY+ FPE+K     N  M+L EFKFI++ME+GHRMWGR +G+AY +P +YF+ KGYF +S+K KVL   G + FQGLLGWYMV+SGL+E +    VPRVSQYRL+AHLGSA+ LY+  LW   + L    K+ +   L  +R    G    V LTA+SGAFVAGLDAGL YN++PKMAD+WIP DLL  SP   N FEN TTVQFDHR LG  +   I  L++  +  +  LPRR ++A   L   A  Q+ LGI+TL+ YVP PLAATHQ+GS+ LL+ A+W+   LRR+PK
Sbjct:   55 TVPNAATNRIVGRWLLGCSGLVVGAVVLGGVTRLTESGLSMVDWHLVREMKPPQTQEEWEAEFFKYKQFPEFK---ILNHEMTLPEFKFIFYMEWGHRMWGRLVGLAYILPTIYFWRKGYFTRSVKGKVLGLCGFVFFQGLLGWYMVKSGLEEKQDSYDVPRVSQYRLSAHLGSALLLYTASLWMGLTMLLPAHKMVESKHLMQLRRFAKGTGGLVFLTALSGAFVAGLDAGLVYNSFPKMADKWIPDDLLAFSPTLRNFFENPTTVQFDHRILGISSLAAITGLYLFSR--RMVLPRRAKIAISLLATMAYTQVALGISTLLLYVPTPLAATHQSGSVALLTFAIWVLAELRRMPK 406          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Planmine SMEST
Match: SMESG000059731.1 (SMESG000059731.1)

HSP 1 Score: 430.639 bits (1106), Expect = 5.931e-153
Identity = 211/212 (99.53%), Postives = 212/212 (100.00%), Query Frame = 1
Query:  550 MVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 1185
            MVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTP+KVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK
Sbjct:    1 MVQSGLQETKSETAVPRVSQYRLAAHLGSAIALYSLFLWNAFSHLSTPIKVADFPKLKMIRGMTHGVKLFVVLTAISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFDHRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGITTLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK 212          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Planmine SMEST
Match: SMESG000059741.1 (SMESG000059741.1)

HSP 1 Score: 332.028 bits (850), Expect = 1.656e-114
Identity = 158/158 (100.00%), Postives = 158/158 (100.00%), Query Frame = 1
Query:   25 MFSLLMKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFK 498
            MFSLLMKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFK
Sbjct:    1 MFSLLMKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFK 158          
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Planmine SMEST
Match: SMESG000059741.1 (SMESG000059741.1)

HSP 1 Score: 322.398 bits (825), Expect = 6.476e-111
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 1
Query:   40 MKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFK 498
            MKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFK
Sbjct:    1 MKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMSGMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFPEYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGYFNKSMKFK 153          
The following BLAST results are available for this feature:
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
COX152.930e-12156.50cytochrome c oxidase assembly homolog COX15 [Sourc... [more]
COX152.789e-9955.48cytochrome c oxidase assembly homolog COX15 [Sourc... [more]
AL133353.22.438e-2258.23novel transcript[more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cox-157.932e-12850.13Cytochrome OXidase assembly protein [Source:UniPr... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG38033.184e-11356.37gene:FBgn0034938 transcript:FBtr0072208[more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cox151.171e-12355.08cytochrome c oxidase assembly homolog 15 (yeast) [... [more]
cox151.472e-12355.08cytochrome c oxidase assembly homolog 15 (yeast) [... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031067.15.419e-12858.52cytochrome c oxidase assembly homolog COX15 [Sourc... [more]
ENSXETT00000015779.15.747e-12858.52cytochrome c oxidase assembly homolog COX15 [Sourc... [more]
ENSXETT00000031062.17.190e-12858.52cytochrome c oxidase assembly homolog COX15 [Sourc... [more]
ENSXETT00000015768.17.264e-12858.52cytochrome c oxidase assembly homolog COX15 [Sourc... [more]
ENSXETT00000031051.17.760e-12858.52cytochrome c oxidase assembly homolog COX15 [Sourc... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cox152.406e-12357.91cytochrome c oxidase assembly protein 15 [Source:M... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BJ03|COX15_MOUSE1.683e-12257.91Cytochrome c oxidase assembly protein COX15 homolo... [more]
sp|Q7KZN9|COX15_HUMAN1.407e-12056.50Cytochrome c oxidase assembly protein COX15 homolo... [more]
sp|Q08DG6|COX15_BOVIN2.245e-12054.86Cytochrome c oxidase assembly protein COX15 homolo... [more]
sp|Q9FKT8|COX15_ARATH2.399e-8545.48Cytochrome c oxidase assembly protein COX15 OS=Ara... [more]
sp|Q2Y9R4|CTAA_NITMU1.216e-7339.95Heme A synthase OS=Nitrosospira multiformis (strai... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7Q1C44.584e-13759.27Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3JHD01.365e-13554.77cytochrome c oxidase assembly protein COX15 homolo... [more]
K1PN571.099e-13454.71Cytochrome c oxidase assembly protein COX15-like p... [more]
A0A210QVL67.124e-13454.29Cytochrome c oxidase assembly protein COX15-like O... [more]
A0A0B6ZJ512.883e-13358.03Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cox154.977e-10052.72cytochrome c oxidase assembly protein COX15 homolo... [more]
cox154.977e-10052.72cytochrome c oxidase assembly protein COX15 homolo... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COX152.982e-7539.08Protein required for the hydroxylation of heme O t... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO488141.273e-12159.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cox152.293e-11354.90cytochrome c oxidase assembly protein COX15 homolo... [more]
back to top
BLAST of cytochrome c oxidase assembly protein COX15 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000059731.15.931e-15399.53SMESG000059731.1[more]
SMESG000059741.11.656e-114100.00SMESG000059741.1[more]
SMESG000059741.16.476e-111100.00SMESG000059741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003798 ID=SMED30003798|Name=cytochrome c oxidase assembly protein COX15 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1193bp
TTTCGAAATTTATTATTCTGAGCAATGTTTTCCTTATTGATGAAATCTTT
AATTAACAATTCGAAAAATGTTTTAAAAATAAAAAATGTTCAACGAAAAA
CTTTCTGTTCTCAAACTACTACTATTTCTGTTTCGCCTAAAAGGCAAGTT
GGAATATGGTTAGCAGCAATGTCTGGCATGACTGTAGGAGCTGTAATATT
AGGTGGTGTTACTCGTTTAACAGAATCTGGGTTGTCAATGACCGATTGGC
ATTTATTTAAAGAAAGACCACCATTTAACGAGGAAGAATGGACAAAGGAA
TTTGCAAAATATCAAATGTTTCCAGAATACAAGCATAAAATATCTGAAAA
TGGCTCGATGTCTTTATCGGAATTTAAATTTATTTGGTGGATGGAATACG
GTCATAGGATGTGGGGACGCGCTATAGGAGTCGCTTACGCTGTTCCAGCA
ATGTATTTTTATTATAAAGGCTATTTTAATAAATCTATGAAATTCAAAGT
GTTGGTTTTTGGAGGATTAATAGGATTTCAAGGTTTGTTAGGATGGTATA
TGGTACAGAGTGGGCTTCAGGAAACAAAATCTGAAACTGCCGTTCCACGG
GTGTCTCAATATCGATTGGCCGCACATTTGGGGTCGGCAATCGCACTATA
TTCATTGTTCTTGTGGAATGCATTTTCCCATTTATCCACCCCATTAAAGG
TAGCAGATTTTCCTAAATTGAAAATGATTCGCGGTATGACGCATGGAGTG
AAATTGTTTGTTGTTCTTACAGCGATTTCTGGTGCTTTTGTAGCCGGGTT
AGATGCAGGGTTGACGTATAATAATTGGCCGAAAATGGCTGATAGATGGA
TACCAACAGATCTCTTAACCCTGTCCCCGAAATGGGTTAATATATTTGAG
AATGCTACAACTGTGCAATTCGATCATCGTTGGCTCGGCCAAATCACCGG
AACATTGATTCTAGCTTTATGGATAGTTTGCCAAAAAAATAAAGCTTTTC
TTCCTCGACGTGTGCAATTGGCCTGTCATGCGTTAGGCTTAGCTGCAATC
GCGCAAATCACTCTCGGAATCACTACATTGGTACACTATGTTCCGATGCC
GTTGGCTGCAACCCATCAGACCGGTTCATTAGTCTTATTATCAACAGCAC
TCTGGTTGTCGCACTCATTGAGGAGGCTCCCGAAATGATTCCA
back to top

protein sequence of SMED30003798-orf-1

>SMED30003798-orf-1 ID=SMED30003798-orf-1|Name=SMED30003798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MFSLLMKSLINNSKNVLKIKNVQRKTFCSQTTTISVSPKRQVGIWLAAMS
GMTVGAVILGGVTRLTESGLSMTDWHLFKERPPFNEEEWTKEFAKYQMFP
EYKHKISENGSMSLSEFKFIWWMEYGHRMWGRAIGVAYAVPAMYFYYKGY
FNKSMKFKVLVFGGLIGFQGLLGWYMVQSGLQETKSETAVPRVSQYRLAA
HLGSAIALYSLFLWNAFSHLSTPLKVADFPKLKMIRGMTHGVKLFVVLTA
ISGAFVAGLDAGLTYNNWPKMADRWIPTDLLTLSPKWVNIFENATTVQFD
HRWLGQITGTLILALWIVCQKNKAFLPRRVQLACHALGLAAIAQITLGIT
TLVHYVPMPLAATHQTGSLVLLSTALWLSHSLRRLPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR003780COX15/CtaA_fam
Vocabulary: biological process
TermDefinition
GO:0006784heme a biosynthetic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016627oxidoreductase activity, acting on the CH-CH group of donors
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane