Sorting nexin-13

Overview
NameSorting nexin-13
Smed IDSMED30003796
Length (bp)2925
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin-13 (SMED30003796) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin-13 (SMED30003796) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin-13 (SMED30003796) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin-13 (SMED30003796) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003796

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30003796SMESG000002662.1 dd_Smed_v4_4243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003796SMESG000002662.1 dd_Smed_v4_4243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003796SMESG000002673.1 SMESG000002662.1 Contig35333newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003796SMESG000002673.1 SMESG000002662.1 Contig35333uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin-13 vs. Ensembl Human
Match: SNX13 (sorting nexin 13 [Source:HGNC Symbol;Acc:HGNC:21335])

HSP 1 Score: 379.022 bits (972), Expect = 1.975e-115
Identity = 265/917 (28.90%), Postives = 478/917 (52.13%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIE------NELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN----------SYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
             FG   + Y    +  F+ G     LLF    S  Y  +   S+    S G+ K ++ MK E+    ++  ++GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  F+ R + +DW    T  + ++  +H+R++R + Q      D+      DL + FF +E E +K+ CR  +CT P  E+ +L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQY++WM +D++   E F+  I++SDN  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC SRI +L       ++  ++  + +  KL ++ L+ IL   + +  F++++     Q ++  ++ +  +R    +  + ++     R  K    +   +     V   ++ L  K +  + + + L+ ++   ++  D T  +FDD+ +++ + ML +++F+ +F+Q+  + +   E D L+D S    ++              N  +    N S+ DS      I D  V N++   Y LY + + + +   ++E WKT RRY DF   +  IT Q   ++  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N              S F    L        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L+++++A +G  +N+ I++     TS +Q+A+ V++F+D++WPNG LA +   RD+  ++RT +  +TK+L  + DE+   +G ETTR+G+ RVF++FQ   LN+R+ +  L+   + +FP + F +L 
Sbjct:   23 TFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLEQCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKITEKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQS----GKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQ--QLEVLLSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSNVSSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRN-LNSEEMWKTYRRYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMKASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELF 929          
BLAST of Sorting nexin-13 vs. Ensembl Human
Match: SNX13 (sorting nexin 13 [Source:HGNC Symbol;Acc:HGNC:21335])

HSP 1 Score: 329.331 bits (843), Expect = 1.372e-97
Identity = 248/879 (28.21%), Postives = 452/879 (51.42%), Query Frame = 1
Query:  112 FGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEA------------IDACL--IEN-------ELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLN---RIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN----------SYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDE 2556
            FG   + Y    +  F+ G     LLF    S  Y  +   S+    S G+ K ++ MK E+    ++  ++GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  F+ R + +DW    T  + ++  +H+R++R + Q      D+      DL + FF +E E +K+ CR  +CT P  E+ +L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQY++WM +D++   E F+  I++SDN  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC SRI +L       ++  ++  + +  KL ++ L+ IL   + +  F++++     Q ++  ++ +  +R    +  + ++     R  K    +   +     V   ++ L  K +  + + + L+ ++   ++  D T  +FDD+ +++ + ML +++F+ +F+Q+  + +   E D L+D S    ++             I+  L  + N       +L +   +T  +D D Y V    A V N++   Y LY + + + +   ++E WKT RRY DF   +  IT Q   ++  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++   +   ++ + VNP+++ +    NV    K +  S++      S N              S F    L        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L+++++A +G  +N+ I++     TS +Q+A+ V++F+D++WPNG LA +   RD+  ++RT +  +TK+L  +  E
Sbjct:   24 FGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLEQCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKITEKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQS----GKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQ--QLEVLLSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSNVSSDDSVQLHAYISDTVYADYDPYAV----AGVCNDHGKTYALYAITVHRRN-LNSEEMWKTYRRYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMKASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPGE 888          
BLAST of Sorting nexin-13 vs. Ensembl Human
Match: SNX25 (sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:21883])

HSP 1 Score: 78.5666 bits (192), Expect = 4.107e-14
Identity = 83/366 (22.68%), Postives = 158/366 (43.17%), Query Frame = 1
Query: 1558 ELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKET--WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            +L+D+ ++ E+E  D  L        C N     + + +  + +   +N   +    V++   + G  ET  W   RR  +F +++  ++     + +++LPS  K PF ++   F+EK   +L ++L      + L              Q E         + + ++P    L + +  V   K  +S  S  ++L           + +  D S  G+D D  K  +      F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +   S   +   +  F+D++WPNGKLA     R +     T    + K+L +I D +   +G +  R G+ ++F+  Q+   NK 
Sbjct:  478 KLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTE---ENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERL-------------CQSE--------ALYAFLSPSPDYLKVID--VQGKKNSFSLSSFLERLPRDFFSHQEEETEEDSDLSDYGDDVDGRK--DALAEPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKH 811          
BLAST of Sorting nexin-13 vs. Ensembl Human
Match: SNX25 (sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:21883])

HSP 1 Score: 78.5666 bits (192), Expect = 4.107e-14
Identity = 83/366 (22.68%), Postives = 158/366 (43.17%), Query Frame = 1
Query: 1558 ELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKET--WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            +L+D+ ++ E+E  D  L        C N     + + +  + +   +N   +    V++   + G  ET  W   RR  +F +++  ++     + +++LPS  K PF ++   F+EK   +L ++L      + L              Q E         + + ++P    L + +  V   K  +S  S  ++L           + +  D S  G+D D  K  +      F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +   S   +   +  F+D++WPNGKLA     R +     T    + K+L +I D +   +G +  R G+ ++F+  Q+   NK 
Sbjct:  478 KLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTE---ENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERL-------------CQSE--------ALYAFLSPSPDYLKVID--VQGKKNSFSLSSFLERLPRDFFSHQEEETEEDSDLSDYGDDVDGRK--DALAEPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKH 811          
BLAST of Sorting nexin-13 vs. Ensembl Human
Match: SNX25 (sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:21883])

HSP 1 Score: 78.1814 bits (191), Expect = 6.160e-14
Identity = 83/366 (22.68%), Postives = 158/366 (43.17%), Query Frame = 1
Query: 1558 ELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKET--WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            +L+D+ ++ E+E  D  L        C N     + + +  + +   +N   +    V++   + G  ET  W   RR  +F +++  ++     + +++LPS  K PF ++   F+EK   +L ++L      + L              Q E         + + ++P    L + +  V   K  +S  S  ++L           + +  D S  G+D D  K  +      F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +   S   +   +  F+D++WPNGKLA     R +     T    + K+L +I D +   +G +  R G+ ++F+  Q+   NK 
Sbjct:  642 KLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTE---ENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERL-------------CQSE--------ALYAFLSPSPDYLKVID--VQGKKNSFSLSSFLERLPRDFFSHQEEETEEDSDLSDYGDDVDGRK--DALAEPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKH 975          

HSP 2 Score: 51.6026 bits (122), Expect = 8.304e-6
Identity = 74/349 (21.20%), Postives = 144/349 (41.26%), Query Frame = 1
Query:  130 IYFIISLSAFLYGLLFF----DPISLPY-FMKSYKCQISKGLLKIVQG---MKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVR-QSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMC-----------KDNSYTSEY--FIQAIRMSDNPDEIKS-----VLEKLDMFT-------SRLRSKDSGGDDDALIKAQ-----ISSIEFVRKVCQSRINKLAEP 1059
            +Y   + +AFL G+LF      P + P  F  ++    +    +   G      S +      +  + N+DKA  EV D   RDYI  WY ++S      Y +  +  ++I +    R  +VD + V+  D+   L +H    + +N    R++++              + +       +   E  +L + S  +++ +  S++     LR  L EIL   +L P + ++++PD+INQ ++              +  +Y   Y  FI+ I  + + + +K      V+E +   T        R + K++      L++A+     I+ +   +K C+ RI  L  P
Sbjct:   96 LYLSCAAAAFLLGILFALVCRSPRAQPPDFAAAWSRLAATSAARRPPGSPVYGNSHESAQSRRVVISHNMDKALKEVFDYSYRDYILSWYGNLSRDEGQLYHLLLEDFWEIARQLHHRLSHVDVVKVVCNDVVRTLLTHFCDLKAANA---RHEEQP-------------RPFVLHACLRNSDDEVRFLQTCSRVLVFCLLPSKDVQSLSLRIMLAEILTTKVLKPVVELLSNPDYINQMLLAQLAYREQMNEHHKRAYTYAPSYEDFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNMKRYINQLTVAKKQCEKRIRILGGP 428          
BLAST of Sorting nexin-13 vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 335.495 bits (859), Expect = 7.805e-100
Identity = 252/936 (26.92%), Postives = 454/936 (48.50%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYGLLFF---------DPISLPYFMKSYKCQISKG---LLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCR---RNKDKDLHXXXXXXXX---------XXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDY-AQKILKDAR----DMKMSERLLTEIEMRIS---------SNDITESL-FDDVLKQLLDMLH-EKQFFDAFKQS-NYFRQFFEES--DELRDDSLISEEEAIDACLIENELMSPC------VNTSNSDSDLYTVRIVDAVVKN--------NNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFV-QREWDNRQPLNR--IQSIVNPIK--------SMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
             FG   LI    S+  F+ G L+          D I+        K ++S G   LLK  + +KE ++      +  +P LD    +++  I RDY+  WYK +S  N F   ++++  + + + +   R VDW+ ++T D+ ++  SH+RL+R + +      + KDK L  E    E          E +K  CR  + T P  E  YL  + + ILY++   E+F   PLR+ LRE++V  ++LPT++ ++DP+ I Q IVW+  +     + F+  +  S + +E+++V   +      +R KDSGG+ D  +K Q++S++FV  + Q RI+ L      ++ +L         +L  + L  IL   I +S F EFL S   QNY+ +YL I  F+                    SV+ +   ++  +L +  A + +K+A     D  +SE  +T + +  +          ND    L F+ + ++++++L  +  FF AFK+S  Y +   E    DE R+D  +SE +++ +     +    C      ++    D  L    ++ A V+           Y LY + + +        +W   RRY DF +++ ++  +  K++ L  P KK FNN+ N+FLEKR+  L  YL+   +P LL+ YP++     +F+ Q+++ N  PL +  + ++ +PI+        +++ + + V     +M   I+   K+    S S ++     ++  ++       ++ENIP R+L L+V E+F  Q  S   RR ++ +++ IV   FG  +NK I++     TS  Q+   +  F++S WPNG+LA     +      +T LL +T ML S+ DE+   LG   + +G+  + + FQ++ LN+RL + +L+    K+FP + F+K+ 
Sbjct:   17 TFGSTGLIVLPASILCFVAGFLYIFYQTGHEKHDEIAGILSENLQKGKLSAGIEALLKNGKRLKEQNQYVEVHSMCNSPQLDLVLEQILGNITRDYVGFWYKTLSNDNIFEQSLKRTSRRSIASLTQCLRQVDWVPLLTRDVVDDFASHLRLFRKAKERTAFQAKEKDKTLSPEDLEAELLSNFFDFELEMEKSLCRDLLSTTPHYENAYLHDLVDIILYLIMPPEDFRCRPLRFLLREVVVRKVILPTLDYLSDPNEIFQLIVWLLSEVEPKPDDFVACLTSSTSIEELEAVFRAIADEKIVMRGKDSGGEQDTFVKQQLASLQFVENLVQRRIDFLGS----KDSALLTKFGEDGDQLVQLPLHVILTNSIALSQFCEFLKSAGGQNYIDLYLAIEGFKV-------------------SVEHQMRSLSKGELSESDAYETVKEAAKYMYDQYLSEEAITRVPLEDALISRFLQSLKNDEPHDLWFESIQEKVIEVLKTDDHFFPAFKKSAGYVKMLLELEIIDEDRNDPTLSECDSVTSFSSSQDRSEDCESALRKMSIEVVDGPLEDEPVMTATVETLGIGHQGKQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKYANSNPLTKKFMSAMFDPIRNGVKAVGTTVMAVPDQVFEGVTKMGVGINNAAKIIINPSSSSTVNRPPVMETDRVAASLTDTESENIPLRVLVLVVSEVFGAQG-SAWFRRQLVTVIKHIVTP-FGTSINKRIVDIVNWLTSEQQVGGYLNSFRESMWPNGELAAEYVEKPPELHHKTRLLAKTLMLSSLPDELRIILGANVSYKGINTISEAFQNKNLNRRLLYVLLERTLIKVFPSNRFEKIF 927          
BLAST of Sorting nexin-13 vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 335.495 bits (859), Expect = 7.805e-100
Identity = 252/936 (26.92%), Postives = 454/936 (48.50%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYGLLFF---------DPISLPYFMKSYKCQISKG---LLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCR---RNKDKDLHXXXXXXXX---------XXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDY-AQKILKDAR----DMKMSERLLTEIEMRIS---------SNDITESL-FDDVLKQLLDMLH-EKQFFDAFKQS-NYFRQFFEES--DELRDDSLISEEEAIDACLIENELMSPC------VNTSNSDSDLYTVRIVDAVVKN--------NNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFV-QREWDNRQPLNR--IQSIVNPIK--------SMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
             FG   LI    S+  F+ G L+          D I+        K ++S G   LLK  + +KE ++      +  +P LD    +++  I RDY+  WYK +S  N F   ++++  + + + +   R VDW+ ++T D+ ++  SH+RL+R + +      + KDK L  E    E          E +K  CR  + T P  E  YL  + + ILY++   E+F   PLR+ LRE++V  ++LPT++ ++DP+ I Q IVW+  +     + F+  +  S + +E+++V   +      +R KDSGG+ D  +K Q++S++FV  + Q RI+ L      ++ +L         +L  + L  IL   I +S F EFL S   QNY+ +YL I  F+                    SV+ +   ++  +L +  A + +K+A     D  +SE  +T + +  +          ND    L F+ + ++++++L  +  FF AFK+S  Y +   E    DE R+D  +SE +++ +     +    C      ++    D  L    ++ A V+           Y LY + + +        +W   RRY DF +++ ++  +  K++ L  P KK FNN+ N+FLEKR+  L  YL+   +P LL+ YP++     +F+ Q+++ N  PL +  + ++ +PI+        +++ + + V     +M   I+   K+    S S ++     ++  ++       ++ENIP R+L L+V E+F  Q  S   RR ++ +++ IV   FG  +NK I++     TS  Q+   +  F++S WPNG+LA     +      +T LL +T ML S+ DE+   LG   + +G+  + + FQ++ LN+RL + +L+    K+FP + F+K+ 
Sbjct:   17 TFGSTGLIVLPASILCFVAGFLYIFYQTGHEKHDEIAGILSENLQKGKLSAGIEALLKNGKRLKEQNQYVEVHSMCNSPQLDLVLEQILGNITRDYVGFWYKTLSNDNIFEQSLKRTSRRSIASLTQCLRQVDWVPLLTRDVVDDFASHLRLFRKAKERTAFQAKEKDKTLSPEDLEAELLSNFFDFELEMEKSLCRDLLSTTPHYENAYLHDLVDIILYLIMPPEDFRCRPLRFLLREVVVRKVILPTLDYLSDPNEIFQLIVWLLSEVEPKPDDFVACLTSSTSIEELEAVFRAIADEKIVMRGKDSGGEQDTFVKQQLASLQFVENLVQRRIDFLGS----KDSALLTKFGEDGDQLVQLPLHVILTNSIALSQFCEFLKSAGGQNYIDLYLAIEGFKV-------------------SVEHQMRSLSKGELSESDAYETVKEAAKYMYDQYLSEEAITRVPLEDALISRFLQSLKNDEPHDLWFESIQEKVIEVLKTDDHFFPAFKKSAGYVKMLLELEIIDEDRNDPTLSECDSVTSFSSSQDRSEDCESALRKMSIEVVDGPLEDEPVMTATVETLGIGHQGKQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKYANSNPLTKKFMSAMFDPIRNGVKAVGTTVMAVPDQVFEGVTKMGVGINNAAKIIINPSSSSTVNRPPVMETDRVAASLTDTESENIPLRVLVLVVSEVFGAQG-SAWFRRQLVTVIKHIVTP-FGTSINKRIVDIVNWLTSEQQVGGYLNSFRESMWPNGELAAEYVEKPPELHHKTRLLAKTLMLSSLPDELRIILGANVSYKGINTISEAFQNKNLNRRLLYVLLERTLIKVFPSNRFEKIF 927          
BLAST of Sorting nexin-13 vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 220.32 bits (560), Expect = 3.952e-61
Identity = 169/633 (26.70%), Postives = 307/633 (48.50%), Query Frame = 1
Query:  946 LRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDY-AQKILKDAR----DMKMSERLLTEIEMRIS---------SNDITESL-FDDVLKQLLDMLH-EKQFFDAFKQS-NYFRQFFEES--DELRDDSLISEEEAIDACLIENELMSPC------VNTSNSDSDLYTVRIVDAVVKN--------NNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFV-QREWDNRQPLNR--IQSIVNPIK--------SMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            +R KDSGG+ D  +K Q++S++FV  + Q RI+ L      ++ +L         +L  + L  IL   I +S F EFL S   QNY+ +YL I  F+                    SV+ +   ++  +L +  A + +K+A     D  +SE  +T + +  +          ND    L F+ + ++++++L  +  FF AFK+S  Y +   E    DE R+D  +SE +++ +     +    C      ++    D  L    ++ A V+           Y LY + + +        +W   RRY DF +++ ++  +  K++ L  P KK FNN+ N+FLEKR+  L  YL+   +P LL+ YP++     +F+ Q+++ N  PL +  + ++ +PI+        +++ + + V     +M   I+   K+    S S ++     ++  ++       ++ENIP R+L L+V E+F  Q  S   RR ++ +++ IV  F G  +NK I++     TS  Q+   +  F++S WPNG+LA     +      +T LL +T ML S+ DE+   LG   + +G+  + + FQ++ LN+RL + +L+    K+FP + F+K+ 
Sbjct:    1 MRGKDSGGEQDTFVKQQLASLQFVENLVQRRIDFLGS----KDSALLTKFGEDGDQLVQLPLHVILTNSIALSQFCEFLKSAGGQNYIDLYLAIEGFKV-------------------SVEHQMRSLSKGELSESDAYETVKEAAKYMYDQYLSEEAITRVPLEDALISRFLQSLKNDEPHDLWFESIQEKVIEVLKTDDHFFPAFKKSAGYVKMLLELEIIDEDRNDPTLSECDSVTSFSSSQDRSEDCESALRKMSIEVVDGPLEDEPVMTATVETLGIGHQGKQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKYANSNPLTKKFMSAMFDPIRNGVKAVGTTVMAVPDQVFEGVTKMGVGINNAAKIIINPSSSSTVNRPPVMETDRVAASLTDTESENIPLRVLVLVVSEVFGAQG-SAWFRRQLVTVIKHIVTPF-GTSINKRIVDIVNWLTSEQQVGGYLNSFRESMWPNGELAAEYVEKPPELHHKTRLLAKTLMLSSLPDELRIILGANVSYKGINTISEAFQNKNLNRRLLYVLLERTLIKVFPSNRFEKIF 608          
BLAST of Sorting nexin-13 vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 220.32 bits (560), Expect = 3.952e-61
Identity = 169/633 (26.70%), Postives = 307/633 (48.50%), Query Frame = 1
Query:  946 LRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDY-AQKILKDAR----DMKMSERLLTEIEMRIS---------SNDITESL-FDDVLKQLLDMLH-EKQFFDAFKQS-NYFRQFFEES--DELRDDSLISEEEAIDACLIENELMSPC------VNTSNSDSDLYTVRIVDAVVKN--------NNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFV-QREWDNRQPLNR--IQSIVNPIK--------SMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            +R KDSGG+ D  +K Q++S++FV  + Q RI+ L      ++ +L         +L  + L  IL   I +S F EFL S   QNY+ +YL I  F+                    SV+ +   ++  +L +  A + +K+A     D  +SE  +T + +  +          ND    L F+ + ++++++L  +  FF AFK+S  Y +   E    DE R+D  +SE +++ +     +    C      ++    D  L    ++ A V+           Y LY + + +        +W   RRY DF +++ ++  +  K++ L  P KK FNN+ N+FLEKR+  L  YL+   +P LL+ YP++     +F+ Q+++ N  PL +  + ++ +PI+        +++ + + V     +M   I+   K+    S S ++     ++  ++       ++ENIP R+L L+V E+F  Q  S   RR ++ +++ IV  F G  +NK I++     TS  Q+   +  F++S WPNG+LA     +      +T LL +T ML S+ DE+   LG   + +G+  + + FQ++ LN+RL + +L+    K+FP + F+K+ 
Sbjct:    1 MRGKDSGGEQDTFVKQQLASLQFVENLVQRRIDFLGS----KDSALLTKFGEDGDQLVQLPLHVILTNSIALSQFCEFLKSAGGQNYIDLYLAIEGFKV-------------------SVEHQMRSLSKGELSESDAYETVKEAAKYMYDQYLSEEAITRVPLEDALISRFLQSLKNDEPHDLWFESIQEKVIEVLKTDDHFFPAFKKSAGYVKMLLELEIIDEDRNDPTLSECDSVTSFSSSQDRSEDCESALRKMSIEVVDGPLEDEPVMTATVETLGIGHQGKQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKYANSNPLTKKFMSAMFDPIRNGVKAVGTTVMAVPDQVFEGVTKMGVGINNAAKIIINPSSSSTVNRPPVMETDRVAASLTDTESENIPLRVLVLVVSEVFGAQG-SAWFRRQLVTVIKHIVTPF-GTSINKRIVDIVNWLTSEQQVGGYLNSFRESMWPNGELAAEYVEKPPELHHKTRLLAKTLMLSSLPDELRIILGANVSYKGINTISEAFQNKNLNRRLLYVLLERTLIKVFPSNRFEKIF 608          
BLAST of Sorting nexin-13 vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 180.644 bits (457), Expect = 3.262e-48
Identity = 121/449 (26.95%), Postives = 226/449 (50.33%), Query Frame = 1
Query: 1453 FDDVLKQLLDMLH-EKQFFDAFKQS-NYFRQFFEES--DELRDDSLISEEEAIDACLIENELMSPC------VNTSNSDSDLYTVRIVDAVVKN--------NNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKL-REIATNFVQREWDNRQPLNR--IQSIVNPIK--------SMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            F+ + ++++++L  +  FF AFK+S  Y +   E    DE R+D  +SE +++ +     +    C      ++    D  L    ++ A V+           Y LY + + +        +W   RRY DF +++ ++  +  K++ L  P KK FNN+ N+FLEKR+  L  YL+   +P LL+ YP++ R +     Q+++ N  PL +  + ++ +PI+        +++ + + V     +M   I+   K+    S S ++     ++  ++       ++ENIP R+L L+V E+F  Q  S   RR ++ +++ IV  F G  +NK I++     TS  Q+   +  F++S WPNG+LA     +      +T LL +T ML S+ DE+   LG   + +G+  + + FQ++ LN+RL + +L+    K+FP + F+K+ 
Sbjct:   62 FESIQEKVIEVLKTDDHFFPAFKKSAGYVKMLLELEIIDEDRNDPTLSECDSVTSFSSSQDRSEDCESALRKMSIEVVDGPLEDEPVMTATVETLGIGHQGKQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKYANSNPLTKKFMSAMFDPIRNGVKAVGTTVMAVPDQVFEGVTKMGVGINNAAKIIINPSSSSTVNRPPVMETDRVAASLTDTESENIPLRVLVLVVSEVFGAQG-SAWFRRQLVTVIKHIVTPF-GTSINKRIVDIVNWLTSEQQVGGYLNSFRESMWPNGELAAEYVEKPPELHHKTRLLAKTLMLSSLPDELRIILGANVSYKGINTISEAFQNKNLNRRLLYVLLERTLIKVFPSNRFEKIF 508          
BLAST of Sorting nexin-13 vs. Ensembl Fly
Match: snz (gene:FBgn0029976 transcript:FBtr0071092)

HSP 1 Score: 70.8626 bits (172), Expect = 5.000e-12
Identity = 96/459 (20.92%), Postives = 188/459 (40.96%), Query Frame = 1
Query:  310 NLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEV-RQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIV----------WMCKDN-SYTSEY--FIQAIRMSDNPDEI----KSVLEKLDMFTS-----RLRSKDSGGDDDALIKAQISSI----EFVRKV------CQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFE--ESDELRDDSLI 1581
             +D    ++I+ +LRD++  W  ++        +V R+ ++  ++    R   +D   +I  D+ N +  H+   R++           +              +       D   E ++L  + E I+ I+     +++PPL+  L EIL   I  P I M+T PD+INQ +V           M K +  Y + +  F++ I  S N +E+    KS++  L   T+     R +  D   +D +L K+++++      +VR++      C+  + K                + + +    +TL  IL+  +G   F  FL  + A   +  YL + + +  +                KS     +++ T+    Y  ++ K    +   ER L E  +     D    +F D+ + +L  L EK ++  F  S+ +RQ  E  +S+E+ D +L+
Sbjct:  141 TVDLQLQQIIEYVLRDFMLPWLGYVVTKPKLINDVVREDLWNAIQKIHERALRMDAAKIIAVDMVNRVTVHLEKIRIAEARAAETNTPPV--------------FSTNSYLADEEKEMEFLRKLCE-IMVILLLPRGYSLPPLKVLLSEILSYKIFFPMIKMLTAPDYINQKVVQNIETRLAAAAMSKRSYEYAASFEDFLKIINNSGNLEELSLIRKSIVNDLMHATTMQNLQRAKGLDPDHEDHSLSKSELTAAVRLKRYVRQLTMAKGECEKNLAKFG-------------WNGNYSSDIDLTLVEILNTAVGRRYFTLFLEPLKASALIGFYLAVEEIKHAH----------------KSAS---HQLGTEIFYTYI-RVPKSEIQIDKHERKLIETFLL---GDAEPDIFYDIQRNVLRTLEEK-YYPPFVLSDQYRQLKEALDSNEIADPTLL 547          

HSP 2 Score: 62.003 bits (149), Expect = 2.387e-9
Identity = 35/146 (23.97%), Postives = 71/146 (48.63%), Query Frame = 1
Query: 2251 LFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFP 2688
            ++ L+ EIFD+    + +R+ +++     V+  +G  +N+ I E  A       +         S+WP G LA++   R E  +  T    +  +   I + +   +G +  ++GV +VFD  Q+   NK+L + +L+++  + FP
Sbjct:  866 MYALMGEIFDMGGVFKWLRKSLISF----VQITYGRTINRQIRESVAYLFEESMLHNYFSAILKSFWPGGVLASAYPTRSEDMREMTTTAAKALLTDHIPEVLCNLVGAQAAKRGVLKVFDALQNPAYNKQLFYELLEILMIEFFP 1007          
BLAST of Sorting nexin-13 vs. Ensembl Fly
Match: snz (gene:FBgn0029976 transcript:FBtr0340148)

HSP 1 Score: 70.8626 bits (172), Expect = 5.000e-12
Identity = 96/459 (20.92%), Postives = 188/459 (40.96%), Query Frame = 1
Query:  310 NLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEV-RQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIV----------WMCKDN-SYTSEY--FIQAIRMSDNPDEI----KSVLEKLDMFTS-----RLRSKDSGGDDDALIKAQISSI----EFVRKV------CQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFE--ESDELRDDSLI 1581
             +D    ++I+ +LRD++  W  ++        +V R+ ++  ++    R   +D   +I  D+ N +  H+   R++           +              +       D   E ++L  + E I+ I+     +++PPL+  L EIL   I  P I M+T PD+INQ +V           M K +  Y + +  F++ I  S N +E+    KS++  L   T+     R +  D   +D +L K+++++      +VR++      C+  + K                + + +    +TL  IL+  +G   F  FL  + A   +  YL + + +  +                KS     +++ T+    Y  ++ K    +   ER L E  +     D    +F D+ + +L  L EK ++  F  S+ +RQ  E  +S+E+ D +L+
Sbjct:  141 TVDLQLQQIIEYVLRDFMLPWLGYVVTKPKLINDVVREDLWNAIQKIHERALRMDAAKIIAVDMVNRVTVHLEKIRIAEARAAETNTPPV--------------FSTNSYLADEEKEMEFLRKLCE-IMVILLLPRGYSLPPLKVLLSEILSYKIFFPMIKMLTAPDYINQKVVQNIETRLAAAAMSKRSYEYAASFEDFLKIINNSGNLEELSLIRKSIVNDLMHATTMQNLQRAKGLDPDHEDHSLSKSELTAAVRLKRYVRQLTMAKGECEKNLAKFG-------------WNGNYSSDIDLTLVEILNTAVGRRYFTLFLEPLKASALIGFYLAVEEIKHAH----------------KSAS---HQLGTEIFYTYI-RVPKSEIQIDKHERKLIETFLL---GDAEPDIFYDIQRNVLRTLEEK-YYPPFVLSDQYRQLKEALDSNEIADPTLL 547          

HSP 2 Score: 62.003 bits (149), Expect = 2.387e-9
Identity = 35/146 (23.97%), Postives = 71/146 (48.63%), Query Frame = 1
Query: 2251 LFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFP 2688
            ++ L+ EIFD+    + +R+ +++     V+  +G  +N+ I E  A       +         S+WP G LA++   R E  +  T    +  +   I + +   +G +  ++GV +VFD  Q+   NK+L + +L+++  + FP
Sbjct:  866 MYALMGEIFDMGGVFKWLRKSLISF----VQITYGRTINRQIRESVAYLFEESMLHNYFSAILKSFWPGGVLASAYPTRSEDMREMTTTAAKALLTDHIPEVLCNLVGAQAAKRGVLKVFDALQNPAYNKQLFYELLEILMIEFFP 1007          
BLAST of Sorting nexin-13 vs. Ensembl Zebrafish
Match: snx13 (sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-12])

HSP 1 Score: 396.741 bits (1018), Expect = 3.343e-122
Identity = 270/918 (29.41%), Postives = 483/918 (52.61%), Query Frame = 1
Query:  112 FGIVNLIYFIISL--SAFLYGLLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK-------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERL------LTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVR--------IVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREW---DNRQPLNRIQSIVNPIKSMLWMQENVV----GNFKQMYSSISPTKKLNSQ---NSYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQ 2715
            F I  L ++I+      F+  LLF    S  +  +   SY       +LK+++ MK ES    ++  ++G+  +D+   +VI   LRDYI  WY  +S    F  E+R ++   L  FS R + VDW    T  L ++  +H+R++R + +     +D        +L + FF +E E ++  CR  +C     E+ YL  + E +LY++    +F+   +RYFLRE+L   +LLP IN ++DPD+INQ+++WM +D+S   E F+  ++++D P E+++V +K+      LRS D+G DD  +IK QI+S+ FV+KVC++RI ++       ++  +L  + +  KL  I LE+IL   I +  F++++  +  Q  +  +L +  +R    +  + ++       ++   R+  + T   L   A  +       K S R+      +T +  +++  D T  +FD++ +++ DM L  + ++ +F+Q   + +   E D L++ S    ++        N   +  +N S  D    +V         I D  V N++   Y LYT+ +I+ +  G+++TWKT RRY DF   +  IT Q   +A  L+LP KK FNNM  +FLEKR  +L  YL     P++++  P L     +F++ +      R+   ++ + VNP++S +    N V     +  +  S +S      S+        SIF    L        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L++++KA +G  +N+ I++     TS +Q+++ V++F+DS+WPNG LA +   RD+  ++RT +  +T +LG + DE+   +G +TTR+G+ RVF++FQ Q LN+RL +  L+   + +FP + F +L +
Sbjct:   27 FAIFYLAFYILCFIGGGFVVLLLFGKTNSEKHLERCEHSYMLPTQTAVLKVLEEMKSESKLIKIDRRLTGSNIIDEPLQQVIQFALRDYIQYWYYTLSDDETFLLEIRLTVQNALVEFSTRSKEVDWQPYFTTRLVDDFATHLRVFRKAQEKLNEKEDPKQRDDPDELLDSFFEVEVEMERKICRDVVCMSRKDEEGYLRDLCEVLLYLLLPPGDFHSKNMRYFLREVLARGVLLPLINQLSDPDYINQFVIWMIRDSSCNYEAFLNILKLTDEPSELEAVKDKVLEELQYLRSLDTGSDDINIIKNQINSLLFVKKVCETRIQRIQS----GKEVDALKLAANFGKLCVIPLEHILVHNIALQFFMDYMQCMGGQAILFFWLTVEGYRVTAQQ--QLEVL---QSCQRDGKRQSSQTTKGLLRAAALGVFDQYLSEKASPRVQVDEASVTRLAQKLNKEDPTPEIFDEIQRKVYDMMLKHEHYYPSFRQHPLYVRMLAELDMLKEPSYRGSDDGDGESF--NGSPTGSINLSLDDLSSGSVDESVQLHAFISDTGVCNDHGKTYALYTITVIRKNSDGSEDTWKTYRRYSDFHDFHMRITEQFESLAPILKLPGKKTFNNMDREFLEKRKKDLNAYLQLLLNPEMVKACPILMPYVYDFLENKAYSKGKREFARKMDTFVNPLRSSMRNVSNAVKSLPDSLAEGVSKVSADMGRMSEKLGQDIKQSIFKVPPLIQKSDIDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKDRNQWLRRNIKNLLQQLIKATYGDTINRKIVDHVDNMTSPEQVSDYVKRFRDSYWPNGILAETPPRRDKNLRMRTRVAAKTTLLGIMPDELKHIIGADTTRKGILRVFEMFQHQPLNRRLVYVFLEGFLETLFPQYKFPELFE 933          
BLAST of Sorting nexin-13 vs. Ensembl Zebrafish
Match: snx13 (sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-12])

HSP 1 Score: 148.288 bits (373), Expect = 7.288e-40
Identity = 65/176 (36.93%), Postives = 119/176 (67.61%), Query Frame = 1
Query: 2188 DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQ 2715
            ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L++++KA +G  +N+ I++     TS +Q+++ V++F+DS+WPNG LA +   RD+  ++RT +  +T +LG + DE+   +G +TTR+G+ RVF++FQ Q LN+RL +  L+   + +FP + F +L +
Sbjct:   31 EHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKDRNQWLRRNIKNLLQQLIKATYGDTINRKIVDHVDNMTSPEQVSDYVKRFRDSYWPNGILAETPPRRDKNLRMRTRVAAKTTLLGIMPDELKHIIGADTTRKGILRVFEMFQHQPLNRRLVYVFLEGFLETLFPQYKFPELFE 206          
BLAST of Sorting nexin-13 vs. Ensembl Zebrafish
Match: snx25 (sorting nexin 25 [Source:ZFIN;Acc:ZDB-GENE-121105-11])

HSP 1 Score: 84.3445 bits (207), Expect = 5.036e-16
Identity = 72/309 (23.30%), Postives = 145/309 (46.93%), Query Frame = 1
Query: 1768 WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFK-PKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIF 2685
            W   R+  +F +++  +T     + +++LPS  K PF ++   FL+K   +L  +L +     ++ Q+     E    F+    ++ + ++  +     + S L   E + G+F             + Q   +      D  D S  G++ D  K  +      F+L+ EIF+L+   + VR+ ++A+    V+  FG  +NK I +      S   +   +  F+D++WPNGKLA  NK R E  +  T    + K+L +I D +   +G +  R G+ ++F+  Q+   N+ L + +L+++ ++++
Sbjct:  674 WTVSRKLIEFQALHRKLTECFPSLKKVQLPSLSKLPFKSIDQKFLDKSKNQLNAFLQKVLTDERMCQS-----EALYAFLSPSPEHLKVIDIQKKSSFSLASFL---ERLPGDF------------FSHQEDEA-----EDDSDLSDYGDEPDGKK--DALAEPCFMLIGEIFELRGMFKWVRKTLIAL----VQVTFGRTINKQIRDTVNWIFSEQMMVYYINVFRDTFWPNGKLAPHNKSRCESERRETKERAQQKLLDNIPDALQNLVGQQNARYGIIKIFNALQESSANRHLLYMLLEMLVKELY 951          

HSP 2 Score: 57.7658 bits (138), Expect = 7.207e-8
Identity = 65/285 (22.81%), Postives = 116/285 (40.70%), Query Frame = 1
Query:  310 NLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYE-VRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRR-NKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDE-IKSVLEKLDM-FTSRL---------------------RSKDSGGDDDALIKAQ----------ISSIEFVRKVCQSRINKLAEP 1059
            N+DKA  EV D   RDYI  WY  +S      Y+ + +  ++++K   +R   VD ++++  D+   L  H    + +N       +   LH              C Q     P  E  +L   +  +L  +    +     LR  L E++   +L P +++++DPD+IN+ ++   +     +E+  +A   + + +E IK +    D+ F  +L                     R KDS G + A +KA           I+ +   +K C+ RI  L  P
Sbjct:  123 NVDKALKEVFDYSYRDYILSWYVPLSRDEGQLYQMLSEDFWEMIKQVRMRLSEVDVVNLVCNDMVKTLHQHFCDLKAANTRLEEVPRPFPLHP-------------CLQ----SPDEELRFLRCCARLLLLRLLPVRDARSRSLRLLLVEVVTTKVLKPLVDVLSDPDYINRMLLAQLEHREQVNEHHKKAYTYAPSYEEFIKLISSSSDIQFLKQLRYQIVVEIIQATTISSIPQLKRQKDSKGKEAAALKADLLRARNMKRYINQLTVAKKQCEKRIRLLGGP 390          
BLAST of Sorting nexin-13 vs. Ensembl Zebrafish
Match: snx25 (sorting nexin 25 [Source:ZFIN;Acc:ZDB-GENE-121105-11])

HSP 1 Score: 82.8037 bits (203), Expect = 1.517e-15
Identity = 48/171 (28.07%), Postives = 91/171 (53.22%), Query Frame = 1
Query: 2173 SSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIF 2685
            + D  D S  G++ D  K  +      F+L+ EIF+L+   + VR+ ++A+    V+  FG  +NK I +      S   +   +  F+D++WPNGKLA  NK R E  +  T    + K+L +I D +   +G +  R G+ ++F+  Q+   N+ L + +L+++ ++++
Sbjct:  749 AEDDSDLSDYGDEPDGKK--DALAEPCFMLIGEIFELRGMFKWVRKTLIAL----VQVTFGRTINKQIRDTVNWIFSEQMMVYYINVFRDTFWPNGKLAPHNKSRCESERRETKERAQQKLLDNIPDALQNLVGQQNARYGIIKIFNALQESSANRHLLYMLLEMLVKELY 913          

HSP 2 Score: 57.7658 bits (138), Expect = 7.551e-8
Identity = 65/285 (22.81%), Postives = 116/285 (40.70%), Query Frame = 1
Query:  310 NLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYE-VRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRR-NKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDE-IKSVLEKLDM-FTSRL---------------------RSKDSGGDDDALIKAQ----------ISSIEFVRKVCQSRINKLAEP 1059
            N+DKA  EV D   RDYI  WY  +S      Y+ + +  ++++K   +R   VD ++++  D+   L  H    + +N       +   LH              C Q     P  E  +L   +  +L  +    +     LR  L E++   +L P +++++DPD+IN+ ++   +     +E+  +A   + + +E IK +    D+ F  +L                     R KDS G + A +KA           I+ +   +K C+ RI  L  P
Sbjct:  123 NVDKALKEVFDYSYRDYILSWYVPLSRDEGQLYQMLSEDFWEMIKQVRMRLSEVDVVNLVCNDMVKTLHQHFCDLKAANTRLEEVPRPFPLHP-------------CLQ----SPDEELRFLRCCARLLLLRLLPVRDARSRSLRLLLVEVVTTKVLKPLVDVLSDPDYINRMLLAQLEHREQVNEHHKKAYTYAPSYEEFIKLISSSSDIQFLKQLRYQIVVEIIQATTISSIPQLKRQKDSKGKEAAALKADLLRARNMKRYINQLTVAKKQCEKRIRLLGGP 390          
BLAST of Sorting nexin-13 vs. Ensembl Zebrafish
Match: snx14 (sorting nexin 14 [Source:NCBI gene;Acc:555970])

HSP 1 Score: 56.9954 bits (136), Expect = 1.201e-7
Identity = 75/339 (22.12%), Postives = 138/339 (40.71%), Query Frame = 1
Query: 1762 ETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREW--DNRQPLNRIQSIVNPIKSMLWMQ--ENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQN---------KTENIPFRILFLLVDEIFDLQ---SKSQVVRR----------GILAILRRIVKAFFG----IKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFP 2688
            E+W   R+Y +F  + + +T   G     +LPSK+       +FL  +  E +EYL +      L     L +  + F       D   P   +  I   +   L  +  +N+    +  +SS    K   S+   +  I S    +  KL N+  +N         K  N  + +  + VD  +D      K +VV R          G+  +L+R ++A+ G     K+ +I+ E         ++  LV   +D+ +       S + R    K R       +M+  + D V + +G E    GV+ +F+  Q  +LNK++++ +L +  Q++FP
Sbjct:  596 ESWSVYRKYVEFYVLESKLTEFHGPFQDAQLPSKRIIGPKNYEFLSSKRGEFEEYLQKLLHHPELSNSQLLADFLSPFSMESQFRDKMLPDVNLGKIFKSVPGKLIKEKGQNLEPFIQSFFSSCESPKPKPSRPELT--ILSPTAENNKKLFNELYRNNANLPEGLEKKHNQNYFMELMEVDGAYDYMMYIGKCRVVFRMPDWLHHLLSGVRILLKRTLEAYVGHYFQYKLEQIMEEH--------RLVSLVTLLRDAVF-----CESTEERSPEDKQRRAKQTFEEMMNYLPDIVGKCIGEEAKYDGVKMLFNTIQQPLLNKQMTYVLLDIAIQELFP 919          
BLAST of Sorting nexin-13 vs. Ensembl Xenopus
Match: SNX13 (sorting nexin 13 [Source:NCBI gene;Acc:100495358])

HSP 1 Score: 380.178 bits (975), Expect = 9.057e-116
Identity = 269/918 (29.30%), Postives = 477/918 (51.96%), Query Frame = 1
Query:  112 FGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHC------RRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACL--IENELMSPCVNTSNSDSDLYTVR--IVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQL-RLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYS------------------KLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQYKL 2724
            FG   + YF   +  F+ G     +LF    S  Y  +   S+    S G+ K ++ +K   +   ++  I+GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  FS R + +DW    T  L ++  +H+R++R + Q        +++K +D  + FF +E E +K  CR  +CT    E+  L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQYI+WM  D S   E F+  I++S N  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC++RI +L       ++  ++  + +  KL ++ L+ IL   + +  F++F+     Q ++  +L +  +R    +  + ++     R  K    +   +         ++ L  K +  + + + LL ++E +++S D T  +FDD+ +++ DM L  ++F+ +F+Q+  + +   E D L++ S    ++          N  +   ++   S  +L  +   I D  V N +   Y LY + + +      ++ WKT RRY DF   +  IT Q   +A L +LP KK FNNM  +FLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N    S      + +S                  ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I ++L+++++A +G  +N+ I++     TS DQ+A+ V++F++S+WPNG LA ++  RD   ++RT +  +TK+L  + DE+   +G ETTR+G+ RVF++FQ   LN+RL +  L+   + +FP + F +L  YKL
Sbjct:   43 FGPFAIFYFAFYILCFVGGGFVVTILFGKTSSERYLERCEHSFLPSTSTGIPKCLEEIKREPRTIKIDRRITGASMIDEPLQQVIQFSLRDYVQYWYYTLSEDESFLLEIRQTVQNALVQFSTRSKEIDWQPYFTTRLVDDFATHLRVFRKAQQKMAEKEDQKKDKAEDFIDTFFEVEVEMEKCVCRDLVCTSSKDEEGCLKDLCEVLLYLLLPPGDFQNKIMRYFVREILSRGILLPLINQLSDPDYINQYIIWMIHDFSCNYEAFMNVIKLSGNISELEAVRDKAAEELQYLRSLDTVGDDINTIKNQINSLLFVKKVCETRIQRLQS----GKEIDTVKLAANFGKLCTVPLDKILVDNVALQFFMDFMQQTGGQAHLFFWLTVEGYRVTAQQ--QLEVLHSRQRDGKHQTNQTKGLLKAAAFGVYEQYLSEKASPRVHIDDYLLAKLEEKLNSEDPTPEIFDDIQRKVYDMMLRNERFYPSFRQNTLYIRMLAELDMLKEPSFKGSDDGDGESFNGSPNGSIHSSLDDLTSSDELLQINAFISDTGVCNEHGKTYALYAITVQRRALDSMEDMWKTYRRYSDFHDFHMRITEQFENLASLLKLPGKKTFNNMDKEFLEKRRNDLNAYLQLLLNPEIVKASPALAHYVFDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSIPDSLAEGMNKMSDNMGKMSEKIGQDIKHSFFKAPILVPKTDAFPENYRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRQITSLLQQLIRATYGDTINRKIVDHVQYMTSPDQVADYVKQFRESFWPNGILAEASLRRDRSIRMRTRVAAKTKLLEIMPDELKHIIGAETTRKGILRVFEMFQYNQLNRRLVYVFLEGFLETLFPQYKFRELF-YKL 950          
BLAST of Sorting nexin-13 vs. Ensembl Xenopus
Match: SNX13 (sorting nexin 13 [Source:NCBI gene;Acc:100495358])

HSP 1 Score: 377.481 bits (968), Expect = 5.827e-115
Identity = 267/918 (29.08%), Postives = 472/918 (51.42%), Query Frame = 1
Query:  112 FGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHC------RRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIEN-------ELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQL-RLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYS------------------KLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQYKL 2724
            FG   + YF   +  F+ G     +LF    S  Y  +   S+    S G+ K ++ +K   +   ++  I+GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  FS R + +DW    T  L ++  +H+R++R + Q        +++K +D  + FF +E E +K  CR  +CT    E+  L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQYI+WM  D S   E F+  I++S N  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC++RI +L       ++  ++  + +  KL ++ L+ IL   + +  F++F+     Q ++  +L +  +R       + ++     R  K    +   +         ++ L  K +  + + + LL ++E +++S D T  +FDD+ +++ DM L  ++F+ +F+Q+  + +   E D L++ S    ++                EL+   +N   SD+ +              Y LY + + +      ++ WKT RRY DF   +  IT Q   +A L +LP KK FNNM  +FLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N    S      + +S                  ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I ++L+++++A +G  +N+ I++     TS DQ+A+ V++F++S+WPNG LA ++  RD   ++RT +  +TK+L  + DE+   +G ETTR+G+ RVF++FQ   LN+RL +  L+   + +FP + F +L  YKL
Sbjct:   25 FGPFAIFYFAFYILCFVGGGFVVTILFGKTSSERYLERCEHSFLPSTSTGIPKCLEEIKREPRTIKIDRRITGASMIDEPLQQVIQFSLRDYVQYWYYTLSEDESFLLEIRQTVQNALVQFSTRSKEIDWQPYFTTRLVDDFATHLRVFRKAQQKMAEKEDQKKDKAEDFIDTFFEVEVEMEKCVCRDLVCTSSKDEEGCLKDLCEVLLYLLLPPGDFQNKIMRYFVREILSRGILLPLINQLSDPDYINQYIIWMIHDFSCNYEAFMNVIKLSGNISELEAVRDKAAEELQYLRSLDTVGDDINTIKNQINSLLFVKKVCETRIQRLQS----GKEIDTVKLAANFGKLCTVPLDKILVDNVALQFFMDFMQQTGGQAHLFFWLTVEGYRVT--AQQQLEVLHSRQRDGKHQTNQTKGLLKAAAFGVYEQYLSEKASPRVHIDDYLLAKLEEKLNSEDPTPEIFDDIQRKVYDMMLRNERFYPSFRQNTLYIRMLAELDMLKEPSFKGSDDGDGGISSSLDDLTSSDELLQ--INAFISDTGVCNEH-------GKTYALYAITVQRRALDSMEDMWKTYRRYSDFHDFHMRITEQFENLASLLKLPGKKTFNNMDKEFLEKRRNDLNAYLQLLLNPEIVKASPALAHYVFDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSIPDSLAEGMNKMSDNMGKMSEKIGQDIKHSFFKAPILVPKTDAFPENYRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRQITSLLQQLIRATYGDTINRKIVDHVQYMTSPDQVADYVKQFRESFWPNGILAEASLRRDRSIRMRTRVAAKTKLLEIMPDELKHIIGAETTRKGILRVFEMFQYNQLNRRLVYVFLEGFLETLFPQYKFRELF-YKL 923          
BLAST of Sorting nexin-13 vs. Ensembl Xenopus
Match: SNX13 (sorting nexin 13 [Source:NCBI gene;Acc:100495358])

HSP 1 Score: 377.096 bits (967), Expect = 6.838e-115
Identity = 267/918 (29.08%), Postives = 472/918 (51.42%), Query Frame = 1
Query:  112 FGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHC------RRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIEN-------ELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQL-RLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYS------------------KLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQYKL 2724
            FG   + YF   +  F+ G     +LF    S  Y  +   S+    S G+ K ++ +K   +   ++  I+GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  FS R + +DW    T  L ++  +H+R++R + Q        +++K +D  + FF +E E +K  CR  +CT    E+  L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQYI+WM  D S   E F+  I++S N  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC++RI +L       ++  ++  + +  KL ++ L+ IL   + +  F++F+     Q ++  +L +  +R       + ++     R  K    +   +         ++ L  K +  + + + LL ++E +++S D T  +FDD+ +++ DM L  ++F+ +F+Q+  + +   E D L++ S    ++                EL+   +N   SD+ +              Y LY + + +      ++ WKT RRY DF   +  IT Q   +A L +LP KK FNNM  +FLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N    S      + +S                  ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I ++L+++++A +G  +N+ I++     TS DQ+A+ V++F++S+WPNG LA ++  RD   ++RT +  +TK+L  + DE+   +G ETTR+G+ RVF++FQ   LN+RL +  L+   + +FP + F +L  YKL
Sbjct:   19 FGPFAIFYFAFYILCFVGGGFVVTILFGKTSSERYLERCEHSFLPSTSTGIPKCLEEIKREPRTIKIDRRITGASMIDEPLQQVIQFSLRDYVQYWYYTLSEDESFLLEIRQTVQNALVQFSTRSKEIDWQPYFTTRLVDDFATHLRVFRKAQQKMAEKEDQKKDKAEDFIDTFFEVEVEMEKCVCRDLVCTSSKDEEGCLKDLCEVLLYLLLPPGDFQNKIMRYFVREILSRGILLPLINQLSDPDYINQYIIWMIHDFSCNYEAFMNVIKLSGNISELEAVRDKAAEELQYLRSLDTVGDDINTIKNQINSLLFVKKVCETRIQRLQS----GKEIDTVKLAANFGKLCTVPLDKILVDNVALQFFMDFMQQTGGQAHLFFWLTVEGYRVT--AQQQLEVLHSRQRDGKHQTNQTKGLLKAAAFGVYEQYLSEKASPRVHIDDYLLAKLEEKLNSEDPTPEIFDDIQRKVYDMMLRNERFYPSFRQNTLYIRMLAELDMLKEPSFKGSDDGDGGISSSLDDLTSSDELLQ--INAFISDTGVCNEH-------GKTYALYAITVQRRALDSMEDMWKTYRRYSDFHDFHMRITEQFENLASLLKLPGKKTFNNMDKEFLEKRRNDLNAYLQLLLNPEIVKASPALAHYVFDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSIPDSLAEGMNKMSDNMGKMSEKIGQDIKHSFFKAPILVPKTDAFPENYRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRQITSLLQQLIRATYGDTINRKIVDHVQYMTSPDQVADYVKQFRESFWPNGILAEASLRRDRSIRMRTRVAAKTKLLEIMPDELKHIIGAETTRKGILRVFEMFQYNQLNRRLVYVFLEGFLETLFPQYKFRELF-YKL 917          
BLAST of Sorting nexin-13 vs. Ensembl Xenopus
Match: SNX13 (sorting nexin 13 [Source:NCBI gene;Acc:100495358])

HSP 1 Score: 214.927 bits (546), Expect = 2.568e-57
Identity = 139/472 (29.45%), Postives = 248/472 (52.54%), Query Frame = 1
Query: 1399 LLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIEN-------ELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQL-RLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYS------------------KLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQYKL 2724
            LL ++E +++S D T  +FDD+ +++ DM L  ++F+ +F+Q+  + +   E D L++ S    ++                EL+   +N   SD+ +              Y LY + + +      ++ WKT RRY DF   +  IT Q   +A L +LP KK FNNM  +FLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N    S      + +S                  ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I ++L+++++A +G  +N+ I++     TS DQ+A+ V++F++S+WPNG LA ++  RD   ++RT +  +TK+L  + DE+   +G ETTR+G+ RVF++FQ   LN+RL +  L+   + +FP + F +L  YKL
Sbjct:  402 LLAKLEEKLNSEDPTPEIFDDIQRKVYDMMLRNERFYPSFRQNTLYIRMLAELDMLKEPSFKGSDDGDGGISSSLDDLTSSDELLQ--INAFISDTGVCNEH-------GKTYALYAITVQRRALDSMEDMWKTYRRYSDFHDFHMRITEQFENLASLLKLPGKKTFNNMDKEFLEKRRNDLNAYLQLLLNPEIVKASPALAHYVFDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSIPDSLAEGMNKMSDNMGKMSEKIGQDIKHSFFKAPILVPKTDAFPENYRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRQITSLLQQLIRATYGDTINRKIVDHVQYMTSPDQVADYVKQFRESFWPNGILAEASLRRDRSIRMRTRVAAKTKLLEIMPDELKHIIGAETTRKGILRVFEMFQYNQLNRRLVYVFLEGFLETLFPQYKFRELF-YKL 860          

HSP 2 Score: 152.14 bits (383), Expect = 4.415e-37
Identity = 101/303 (33.33%), Postives = 161/303 (53.14%), Query Frame = 1
Query:  112 FGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHC------RRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDD 975
            FG   + YF   +  F+ G     +LF    S  Y  +   S+    S G+ K ++ +K   +   ++  I+GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  FS R + +DW    T  L ++  +H+R++R + Q        +++K +D  + FF +E E +K  CR  +CT    E+  L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQYI+WM  D S   E F+  I++S N  E+++V +K       LRS D+ GDD
Sbjct:   25 FGPFAIFYFAFYILCFVGGGFVVTILFGKTSSERYLERCEHSFLPSTSTGIPKCLEEIKREPRTIKIDRRITGASMIDEPLQQVIQFSLRDYVQYWYYTLSEDESFLLEIRQTVQNALVQFSTRSKEIDWQPYFTTRLVDDFATHLRVFRKAQQKMAEKEDQKKDKAEDFIDTFFEVEVEMEKCVCRDLVCTSSKDEEGCLKDLCEVLLYLLLPPGDFQNKIMRYFVREILSRGILLPLINQLSDPDYINQYIIWMIHDFSCNYEAFMNVIKLSGNISELEAVRDKAAEELQYLRSLDTVGDD 327          
BLAST of Sorting nexin-13 vs. Ensembl Xenopus
Match: SNX13 (sorting nexin 13 [Source:NCBI gene;Acc:100495358])

HSP 1 Score: 200.675 bits (509), Expect = 1.565e-54
Identity = 147/513 (28.65%), Postives = 265/513 (51.66%), Query Frame = 1
Query:  112 FGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHC------RRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEA 1596
            FG   + YF   +  F+ G     +LF    S  Y  +   S+    S G+ K ++ +K   +   ++  I+GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  FS R + +DW    T  L ++  +H+R++R + Q        +++K +D  + FF +E E +K  CR  +CT    E+  L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQYI+WM  D S   E F+  I++S N  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC++RI +L       ++  ++  + +  KL ++ L+ IL   + +  F++F+     Q ++  +L +  +R       + ++     R  K    +   +         ++ L  K +  + + + LL ++E +++S D T  +FDD+ +++ D ML  ++F+ +F+Q+  + +   E D L++ S    ++ 
Sbjct:   24 FGPFAIFYFAFYILCFVGGGFVVTILFGKTSSERYLERCEHSFLPSTSTGIPKCLEEIKREPRTIKIDRRITGASMIDEPLQQVIQFSLRDYVQYWYYTLSEDESFLLEIRQTVQNALVQFSTRSKEIDWQPYFTTRLVDDFATHLRVFRKAQQKMAEKEDQKKDKAEDFIDTFFEVEVEMEKCVCRDLVCTSSKDEEGCLKDLCEVLLYLLLPPGDFQNKIMRYFVREILSRGILLPLINQLSDPDYINQYIIWMIHDFSCNYEAFMNVIKLSGNISELEAVRDKAAEELQYLRSLDTVGDDINTIKNQINSLLFVKKVCETRIQRLQSG----KEIDTVKLAANFGKLCTVPLDKILVDNVALQFFMDFMQQTGGQAHLFFWLTVEGYRVT--AQQQLEVLHSRQRDGKHQTNQTKGLLKAAAFGVYEQYLSEKASPRVHIDDYLLAKLEEKLNSEDPTPEIFDDIQRKVYDMMLRNERFYPSFRQNTLYIRMLAELDMLKEPSFKGSDDG 530          
BLAST of Sorting nexin-13 vs. Ensembl Mouse
Match: Snx13 (sorting nexin 13 [Source:MGI Symbol;Acc:MGI:2661416])

HSP 1 Score: 382.874 bits (982), Expect = 4.775e-117
Identity = 267/921 (28.99%), Postives = 481/921 (52.23%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMS--ERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVR----------IVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN----------SYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
             FG   + Y    +  F+ G     LL+    S  Y  +   S+    S G+ K ++ MK E+    ++  ++GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  F+ R + +DW    T  + ++  +H+R++R + Q      D+      DL E FF +E E +KD CR  +CT P  E+ +L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQY++WM +D++   E F+  I++SDN  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC SRI +L       ++  ++  + +  KL ++ L+ IL   + +  F++++     Q ++  ++ +  +R    +  + ++     R  K    +   +     V   ++ L +    +++  + L+ ++   ++  D T  +FDD+ +++ + ML +++F+ +F+Q+  + +   E D L+D S    ++  D    E+   SP  + + S  DL +V           I D  V N++   Y LY + + + +    +E WKT RRY DF   +  IT Q   ++  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N              S F    L        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L+++++A +G  +N+ I++     TS +Q+A+ V++F+D++WPNG LA +   RD+  ++RT +  +TK+   + DE+   +G ETTR+G+ RVF++FQ   LN+R+ +  L+   + +FP + F +L 
Sbjct:   24 TFGPFVIFYLAFYILCFVGGGLVVTLLYGKTNSEKYLEQCEHSFLPPTSSGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQS----GKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQ--QLEVLSGRQRDGKQQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDG-DG---ESFNGSPTGSINLSLDDLSSVTSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRN-LNTEEMWKTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKASPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSLPDSLAEGVTKMSDNVGRMSERLGQDIKQSFFKVPPLITKTDSDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAETVPCRDKAIRMRTRIAGKTKLFAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELF 930          
BLAST of Sorting nexin-13 vs. Ensembl Mouse
Match: Snx13 (sorting nexin 13 [Source:MGI Symbol;Acc:MGI:2661416])

HSP 1 Score: 261.922 bits (668), Expect = 2.206e-74
Identity = 199/696 (28.59%), Postives = 356/696 (51.15%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVR----------IVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLN---RIQSIVNPIKSMLWMQENVV 2091
             FG   + Y    +  F+ G     LL+    S  Y  +   S+    S G+ K ++ MK E+    ++  ++GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  F+ R + +DW    T  + ++  +H+R++R + Q      D+      DL E FF +E E +KD CR  +CT P  E+ +L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQY++WM +D++   E F+  I++SDN  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC SRI +L       ++  ++  + +  KL ++ L+ IL   + +  F++++     Q ++  ++ +  +R    +  + ++     R  K    +   +     V   ++ L  K +  + + + L+ ++   ++  D T  +FDD+ +++ + ML +++F+ +F+Q+  + +   E D L+D S    ++  D    E+   SP  + + S  DL +V           I D  V N++   Y LY + + + +    +E WKT RRY DF   +  IT Q   ++  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++   +   ++ + VNP+++ +    N V
Sbjct:   24 TFGPFVIFYLAFYILCFVGGGLVVTLLYGKTNSEKYLEQCEHSFLPPTSSGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQS----GKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQ--QLEVLSGRQRDGKQQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDG-DG---ESFNGSPTGSINLSLDDLSSVTSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRN-LNTEEMWKTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKASPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAV 708          
BLAST of Sorting nexin-13 vs. Ensembl Mouse
Match: Snx25 (sorting nexin 25 [Source:MGI Symbol;Acc:MGI:2142610])

HSP 1 Score: 77.7962 bits (190), Expect = 4.249e-14
Identity = 86/358 (24.02%), Postives = 153/358 (42.74%), Query Frame = 1
Query: 1609 LIENELMSPCVNTSNSDS-----DLYTVRIVDAVV--KNNNYVLYTLVIIKTDKYGNKET--WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFK-PKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN-SYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            LIE E  +  ++ + +D       L+   I  A V  +N   +    V +   + G  ET  W   RR  +F +++  ++     + +++LPS  K PF ++ + FL K   +L  +L       +L Q+                        + + ++P    L + +  V   K  +S  S  +KL     S+       D  D S  G+D D  K  +      F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +  +S   +   +  F+D++WPNGKLA   + R       T    + K+L +I D +   +G +  R G+ ++F   Q+   NK 
Sbjct:  485 LIEKECTALQLHMARTDWWCENLGLWRASITSAEVTEENGEQMPCYFVRVNLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLGKSRNQLNAFLQNLLSDERLFQS----------------------EALYAFLSPSPDYLKVID--VQGKKTSFSLSSFLEKLPRDFFSHQEEEIEEDS-DLSDYGDDVDGKK--DSLAEPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAFWPNGKLAPPTRIRSVAQSQETKQRAQQKLLENIPDTLQSLVGQQNARHGIIKIFKALQETKANKH 811          

HSP 2 Score: 63.1586 bits (152), Expect = 1.475e-9
Identity = 64/281 (22.78%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  313 LDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVR-QSMYKILKNFSIRCRNVDWISVITEDLPNELRSHI-RLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEY-------------FIQAIRMSDNPDEIKS-----VLEKLDMFT-------SRLRSKDSGGDDDALIKAQ-----ISSIEFVRKVCQSRINKLAEP 1059
            +D+   +V D   RDYI  WY ++S  +   Y +     ++I+K    R  +VD + V+  D+   L +H   L   + +H  + +   LH                     D   E  +L + S+ ++  +  S++     LR  L EIL   +L P + ++++PD+INQ ++   +     SE+             FI+ I  + + D +K      V+E +   T        R + K+S      L++A+     I+ +   +K C+ RI  L  P
Sbjct:    1 MDRVLRDVFDYSYRDYILSWYGNLSRDDGQLYHLLLDDFWEIVKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHA-----------------CLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQLEYREQMSEHHKRAYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTISSFPQLKRHKGKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRILGGP 264          
BLAST of Sorting nexin-13 vs. Ensembl Mouse
Match: Snx25 (sorting nexin 25 [Source:MGI Symbol;Acc:MGI:2142610])

HSP 1 Score: 77.7962 bits (190), Expect = 4.249e-14
Identity = 86/358 (24.02%), Postives = 153/358 (42.74%), Query Frame = 1
Query: 1609 LIENELMSPCVNTSNSDS-----DLYTVRIVDAVV--KNNNYVLYTLVIIKTDKYGNKET--WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFK-PKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN-SYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            LIE E  +  ++ + +D       L+   I  A V  +N   +    V +   + G  ET  W   RR  +F +++  ++     + +++LPS  K PF ++ + FL K   +L  +L       +L Q+                        + + ++P    L + +  V   K  +S  S  +KL     S+       D  D S  G+D D  K  +      F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +  +S   +   +  F+D++WPNGKLA   + R       T    + K+L +I D +   +G +  R G+ ++F   Q+   NK 
Sbjct:  485 LIEKECTALQLHMARTDWWCENLGLWRASITSAEVTEENGEQMPCYFVRVNLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLGKSRNQLNAFLQNLLSDERLFQS----------------------EALYAFLSPSPDYLKVID--VQGKKTSFSLSSFLEKLPRDFFSHQEEEIEEDS-DLSDYGDDVDGKK--DSLAEPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAFWPNGKLAPPTRIRSVAQSQETKQRAQQKLLENIPDTLQSLVGQQNARHGIIKIFKALQETKANKH 811          

HSP 2 Score: 63.1586 bits (152), Expect = 1.475e-9
Identity = 64/281 (22.78%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  313 LDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVR-QSMYKILKNFSIRCRNVDWISVITEDLPNELRSHI-RLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEY-------------FIQAIRMSDNPDEIKS-----VLEKLDMFT-------SRLRSKDSGGDDDALIKAQ-----ISSIEFVRKVCQSRINKLAEP 1059
            +D+   +V D   RDYI  WY ++S  +   Y +     ++I+K    R  +VD + V+  D+   L +H   L   + +H  + +   LH                     D   E  +L + S+ ++  +  S++     LR  L EIL   +L P + ++++PD+INQ ++   +     SE+             FI+ I  + + D +K      V+E +   T        R + K+S      L++A+     I+ +   +K C+ RI  L  P
Sbjct:    1 MDRVLRDVFDYSYRDYILSWYGNLSRDDGQLYHLLLDDFWEIVKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHA-----------------CLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQLEYREQMSEHHKRAYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTISSFPQLKRHKGKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRILGGP 264          
BLAST of Sorting nexin-13 vs. Ensembl Mouse
Match: Snx25 (sorting nexin 25 [Source:MGI Symbol;Acc:MGI:2142610])

HSP 1 Score: 74.3294 bits (181), Expect = 6.973e-13
Identity = 45/151 (29.80%), Postives = 75/151 (49.67%), Query Frame = 1
Query: 2188 DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNK 2640
            D S  G+D D  K         F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +  +S   +   +  F+D++WPNGKLA   + R       T    + K+L +I D +   +G +  R G+ ++F   Q+   NK
Sbjct:  812 DLSDYGDDVDGKKDSLA--EPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAFWPNGKLAPPTRIRSVAQSQETKQRAQQKLLENIPDTLQSLVGQQNARHGIIKIFKALQETKANK 956          

HSP 2 Score: 65.855 bits (159), Expect = 2.586e-10
Identity = 70/305 (22.95%), Postives = 124/305 (40.66%), Query Frame = 1
Query:  280 PLESDISGAP-------------NLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVR-QSMYKILKNFSIRCRNVDWISVITEDLPNELRSHI-RLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEY-------------FIQAIRMSDNPDEIKS-----VLEKLDMFT-------SRLRSKDSGGDDDALIKAQ-----ISSIEFVRKVCQSRINKLAEP 1059
            PL S + G P             N+D+   +V D   RDYI  WY ++S  +   Y +     ++I+K    R  +VD + V+  D+   L +H   L   + +H  + +   LH                     D   E  +L + S+ ++  +  S++     LR  L EIL   +L P + ++++PD+INQ ++   +     SE+             FI+ I  + + D +K      V+E +   T        R + K+S      L++A+     I+ +   +K C+ RI  L  P
Sbjct:  123 PLRSPVYGNPQETAQGRRVVISHNMDRVLRDVFDYSYRDYILSWYGNLSRDDGQLYHLLLDDFWEIVKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHA-----------------CLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQLEYREQMSEHHKRAYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTISSFPQLKRHKGKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRILGGP 410          
BLAST of Sorting nexin-13 vs. UniProt/SwissProt
Match: sp|Q6PHS6|SNX13_MOUSE (Sorting nexin-13 OS=Mus musculus OX=10090 GN=Snx13 PE=2 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 3.040e-116
Identity = 268/921 (29.10%), Postives = 481/921 (52.23%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVR----------IVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN----------SYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
             FG   + Y    +  F+ G     LL+    S  Y  +   S+    S G+ K ++ MK E+    ++  ++GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  F+ R + +DW    T  + ++  +H+R++R + Q      D+      DL E FF +E E +KD CR  +CT P  E+ +L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQY++WM +D++   E F+  I++SDN  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC SRI +L       ++  ++  + +  KL ++ L+ IL   + +  F++++     Q ++  ++ +  +R    +  + ++     R  K    +   +     V   ++ L  K +  + + + L+ ++   ++  D T  +FDD+ +++ + ML +++F+ +F+Q+  + +   E D L+D S    ++  D    E+   SP  + + S  DL +V           I D  V N++   Y LY + + + +    +E WKT RRY DF   +  IT Q   ++  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N              S F    L        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L+++++A +G  +N+ I++     TS +Q+A+ V++F+D++WPNG LA +   RD+  ++RT +  +TK+   + DE+   +G ETTR+G+ RVF++FQ   LN+R+ +  L+   + +FP + F +L 
Sbjct:   23 TFGPFVIFYLAFYILCFVGGGLVVTLLYGKTNSEKYLEQCEHSFLPPTSSGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQS----GKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQ--QLEVLSGRQRDGKQQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDG-DG---ESFNGSPTGSINLSLDDLSSVTSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRN-LNTEEMWKTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKASPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSLPDSLAEGVTKMSDNVGRMSERLGQDIKQSFFKVPPLITKTDSDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAETVPCRDKAIRMRTRIAGKTKLFAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELF 929          
BLAST of Sorting nexin-13 vs. UniProt/SwissProt
Match: sp|Q9Y5W8|SNX13_HUMAN (Sorting nexin-13 OS=Homo sapiens OX=9606 GN=SNX13 PE=1 SV=4)

HSP 1 Score: 373.244 bits (957), Expect = 1.668e-112
Identity = 268/932 (28.76%), Postives = 485/932 (52.04%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYG-----LLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKIL--KDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEA------------IDACL--IEN-------ELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN----------SYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
             FG   + Y    +  F+ G     LLF    S  Y  +   S+    S G+ K ++ MK E+    ++  ++GA  +D+   +VI   LRDY+  WY  +S   +F  E+RQ++   L  F+ R + +DW    T  + ++  +H+R++R + Q      D+      DL + FF +E E +K+ CR  +CT P  E+ +L  + E +LY++    +F    +RYF+REIL   ILLP IN ++DPD+INQY++WM +D++   E F+  I++SDN  E+++V +K       LRS D+ GDD   IK QI+S+ FV+KVC SRI +L       ++  ++  + +  KL ++ L+ IL   + +  F++++     Q ++  ++ +  +R    +  + ++     R  K    +   +     V   ++ L  K +  + + + L+ ++   ++  D T  +FDD+ +++ + ML +++F+ +F+Q+  + +   E D L+D S    ++             I+  L  + N       +L +   +T  +D D Y V    A V N++   Y LY + + + +   ++E WKT RRY DF   +  IT Q   ++  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP+++ +    NV    K +  S++      S N              S F    L        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L+++++A +G  +N+ I++     TS +Q+A+ V++F+D++WPNG LA +   RD+  ++RT +  +TK+L  + DE+   +G ETTR+G+ RVF++FQ   LN+R+ +  L+   + +FP + F +L 
Sbjct:   23 TFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLEQCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKITEKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQS----GKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQ--QLEVLLSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSNVSSDDSVQLHAYISDTVYADYDPYAV----AGVCNDHGKTYALYAITVHRRN-LNSEEMWKTYRRYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMKASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSM---RNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELF 940          
BLAST of Sorting nexin-13 vs. UniProt/SwissProt
Match: sp|Q9H3E2|SNX25_HUMAN (Sorting nexin-25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 1.972e-13
Identity = 83/366 (22.68%), Postives = 158/366 (43.17%), Query Frame = 1
Query: 1558 ELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKET--WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            +L+D+ ++ E+E  D  L        C N     + + +  + +   +N   +    V++   + G  ET  W   RR  +F +++  ++     + +++LPS  K PF ++   F+EK   +L ++L      + L              Q E         + + ++P    L + +  V   K  +S  S  ++L           + +  D S  G+D D  K  +      F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +   S   +   +  F+D++WPNGKLA     R +     T    + K+L +I D +   +G +  R G+ ++F+  Q+   NK 
Sbjct:  478 KLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTE---ENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERL-------------CQSE--------ALYAFLSPSPDYLKVID--VQGKKNSFSLSSFLERLPRDFFSHQEEETEEDSDLSDYGDDVDGRK--DALAEPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKH 811          
BLAST of Sorting nexin-13 vs. UniProt/SwissProt
Match: sp|Q3ZT31|SNX25_MOUSE (Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25 PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 2.972e-13
Identity = 86/358 (24.02%), Postives = 153/358 (42.74%), Query Frame = 1
Query: 1609 LIENELMSPCVNTSNSDS-----DLYTVRIVDAVV--KNNNYVLYTLVIIKTDKYGNKET--WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFK-PKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN-SYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            LIE E  +  ++ + +D       L+   I  A V  +N   +    V +   + G  ET  W   RR  +F +++  ++     + +++LPS  K PF ++ + FL K   +L  +L       +L Q+                        + + ++P    L + +  V   K  +S  S  +KL     S+       D  D S  G+D D  K  +      F+L+ EIF+L+   + VRR ++A+    V+  FG  +NK I +  +  +S   +   +  F+D++WPNGKLA   + R       T    + K+L +I D +   +G +  R G+ ++F   Q+   NK 
Sbjct:  485 LIEKECTALQLHMARTDWWCENLGLWRASITSAEVTEENGEQMPCYFVRVNLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLGKSRNQLNAFLQNLLSDERLFQS----------------------EALYAFLSPSPDYLKVID--VQGKKTSFSLSSFLEKLPRDFFSHQEEEIEEDS-DLSDYGDDVDGKK--DSLAEPCFMLIGEIFELRGMFKWVRRTLIAL----VQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAFWPNGKLAPPTRIRSVAQSQETKQRAQQKLLENIPDTLQSLVGQQNARHGIIKIFKALQETKANKH 811          

HSP 2 Score: 63.1586 bits (152), Expect = 1.031e-8
Identity = 64/281 (22.78%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  313 LDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVR-QSMYKILKNFSIRCRNVDWISVITEDLPNELRSHI-RLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEY-------------FIQAIRMSDNPDEIKS-----VLEKLDMFT-------SRLRSKDSGGDDDALIKAQ-----ISSIEFVRKVCQSRINKLAEP 1059
            +D+   +V D   RDYI  WY ++S  +   Y +     ++I+K    R  +VD + V+  D+   L +H   L   + +H  + +   LH                     D   E  +L + S+ ++  +  S++     LR  L EIL   +L P + ++++PD+INQ ++   +     SE+             FI+ I  + + D +K      V+E +   T        R + K+S      L++A+     I+ +   +K C+ RI  L  P
Sbjct:    1 MDRVLRDVFDYSYRDYILSWYGNLSRDDGQLYHLLLDDFWEIVKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHA-----------------CLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQLEYREQMSEHHKRAYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTISSFPQLKRHKGKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRILGGP 264          
BLAST of Sorting nexin-13 vs. UniProt/SwissProt
Match: sp|Q8BHY8|SNX14_MOUSE (Sorting nexin-14 OS=Mus musculus OX=10090 GN=Snx14 PE=1 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 8.604e-8
Identity = 80/338 (23.67%), Postives = 145/338 (42.90%), Query Frame = 1
Query: 1762 ETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLR--EIATNFVQREWDNRQPLNRIQSIVN--------PIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGND---SDQNKTENIP------FRILFLLVDEIFD-LQSKSQVV------RRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHN 2697
            E W   RRY +F  + + +T   G     +LPSK+       +FL+ +  E QEYL      KL+Q +P+L   ++  +F+       Q L++I   VN        P K M    +++        +S    K   S+   +  I S    +  KL ND   ++ N+ EN        + +  + VD ++D L    +VV         +L   R + K    +  +  +  K  +     ++  L+   +D+ +       + +PR    K +       +M+  I D + + +G ET  + ++ +FD  Q  VLNK+L++ +L +V Q++FP  N
Sbjct:  627 EHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQ-----KLVQ-HPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLMKEKGQHLEPFIMSFINSCESPKPKPSRPELT--ILSPTSENNKKLFNDLFKNNANRAENTERKQNQNYFMEVMTVDGVYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNTLEMYTDYYLQCKLEQLFQEHRLVSLITLLRDAIF-----CENTEPRSLQDKQKGAKQTFEEMMNYIPDLIVKCIGEETKYESIRLLFDGLQQPVLNKQLTYVLLDIVIQELFPELN 951          

HSP 2 Score: 55.4546 bits (132), Expect = 2.647e-6
Identity = 41/185 (22.16%), Postives = 87/185 (47.03%), Query Frame = 1
Query:  292 DISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDN 846
            D+  +  +D +  EV++L+L +++  WY+ ++   +F  E+R ++         R   VD  S+IT+ L      HI +   + Q  +  +    + +  +LE    + +   +   D   E  YL  ++E +   +   +  +   L   +REIL  ++LLP+++ + DPD +N  ++    D+
Sbjct:  153 DLKVSSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLVRRIHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTE----YLQQAALEEYGPELHVALRSRRD---ELQYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVLLPSLDFLADPDTVNHLLIIFIDDS 330          
BLAST of Sorting nexin-13 vs. TrEMBL
Match: A0A564Y4Y5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2965 PE=4 SV=1)

HSP 1 Score: 472.241 bits (1214), Expect = 6.170e-147
Identity = 305/966 (31.57%), Postives = 505/966 (52.28%), Query Frame = 1
Query:  106 YNFGIVNLIYFIISLSAFLYGLLFFDPISLPYFMKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXX-XXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEP------------XXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKL----------NE-YDIF----GFDD----RLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSE-----RLLTEI----------EMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPC----------------------------------VNTSNSDS----DLYTVRIVDAVVKNNNYVLYTL-VIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQRE-WDNRQPLNRIQSIVNPIKS----MLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDS------DQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKP------------RDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQ 2676
            + +G+   +Y    L +F  GLLFF P  + +     K  IS GL+++           +   ISG    D    +++D I+ DYI  WY  ++    F  ++  +M +++   S R + +DWI  + E LPN +  H+R++R S +   R+ +  +  +FF   E E +  +CR+++CT    E D+   +++  L+ +   E++ +  +RY L+EILVN +LLPT+N++ DPDF+NQ I+ +C ++++TS YFIQ++RMS   DE++ V E++++F  +LR +DSGGDDD ++KAQI+S+ F+  VC S+I ++               +  + +S   G          +T   ++  ++ +S FLEFLTSIN Q+ +++YLN + +R N  +L          NE  D+F    G+D+     LE +  +        ++ +  Q+ +   R+  +S      R+L +I           +    + I  ++F DV ++L+ +L  +Q F AFK+S Y+ +  E       D  +       A   E+   +P                                   +N+S S +    D YTV ++   +    YV+YTL V   +   G + TW+T RRY  FD ++++I  QCG+I  L+LP+KK F +++ +F+EKR  EL +YL         + YPKL  I +NF+Q E W+ ++  +   S++NP K+    ++ + + +   F +M +   P  + +  ++   S+ SS  +    L  D+      DQN ++NIPFRILF+LVDE+F+LQ K+Q+ RRG LAILR IV+ FFG  +N+ I+EKA    S+ Q+A      +D  WPNG    +N              RDE  KLRT +LCR  M GS+++E++ +LG ETTR+GVQRVFDL Q   LN+RL H +L+ + +
Sbjct:   17 FAYGVGVFVYITCGLLSFAAGLLFFLP-EVHWVPLKRKIPISHGLVEVDDKKASMSHLKVNYAISGCHEFDVVLNQILDYIINDYIRFWYTSLTNETEFPQQLHAAMAQLMAEVSKRAQRIDWIPFMIEGLPNIVIDHLRIHRRSLERYARSSNSAVPTKFFFDEEMETEVQFCREEVCTSREKELDHFRRITDVFLFAIMPEEDYRLLTVRYLLKEILVNGVLLPTVNILADPDFVNQSIIKLCNESAFTSPYFIQSLRMSTREDELRVVKERIEIFAVKLRGRDSGGDDDTMVKAQINSLNFLENVCNSQIAEIKRGIPRKFDQRGFRRRQPKMNSAGPGSDGLGRTSIDLTFADVMSNDVAVSNFLEFLTSINEQSLLSLYLNCMAYRVNSEELMSSITSIPSTNEPEDVFDPNSGWDEMKTAELEPTPQQGGGIQEQPEVSEEDQEAMGRIREFGVSMCNLVMRILPQIPEETVKRCLKALSTPLDTIDPNVFIDVEEELIRLLSSEQCFGAFKRSPYYARAVEVFKSSPHDVFLESSRRSGANGAEDVQETPTYSSKSASSSPVSSRPESSVSITASSYSPQGSQTHLNSSPSSTSYFPDSYTVNVLSGKMAREGYVVYTLEVTCLSTITGRRSTWRTYRRYSQFDDLHSLIVEQCGRIPNLKLPAKKSFTSVSAEFIEKRRSELDDYLQILCGIDTTRRYPKLHPILSNFLQSEKWERKKGAS---SLMNPFKAVGSAIISVPDTLFDGFSKMINRRQPLDRSDVNSNSHVSVSSSSMVSRPSLLGDTSNLAILDQNDSDNIPFRILFMLVDEVFNLQRKTQLFRRGTLAILRNIVQTFFGDIMNRRIVEKAKNLISAKQMATYAGILRDVLWPNGSQVQTNGGMSKSATPENSSVRDEAMKLRTRVLCRAVMFGSVAEELASYLGQETTREGVQRVFDLLQQPCLNRRLVHCLLEAITR 978          
BLAST of Sorting nexin-13 vs. TrEMBL
Match: A0A433TXW9 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_005893 PE=4 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 1.156e-134
Identity = 283/879 (32.20%), Postives = 473/879 (53.81%), Query Frame = 1
Query:  235 GLLKIVQGMKESDK-PPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKD----LHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFR-------SNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQ-LVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFR-----QFFEESDE---------------LRDDSLISEEEAIDACLIE---------NELMSPCVNTSNSDSDLYTVRIVDAVVK-----NNNYVLYTLVIIKTDKYG-NKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQRE-WDNRQP--LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSIS-PTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQ 2715
            G++KI + M+ S K    +  ++GA  +D    EV++ ++RDYI  WY+ +S  +NF  ++ Q   K++  FS R ++V+W+   T+ L ++  SHIRLY+ + +   + K++D    L + FF +E E +   CR  +CTDP  E+ YL  +SE +L+++   E+F+  P RY +RE+LVN I LPT+++++DPD+INQYI W+C + S+T E F+  IR SD  +E+++V +K++   ++ RSKD+GG DD  IK  ++S+ F+R  C  RI +L E     E  +   +SL    L  +TLE I +  + +  F+E++T  N Q Y+  YLN+  FR       +   KL++  +   +  LE    R   +I  DQ L + A   L+   D  + +  + ++++++ S DI    FD V  ++  +LH + + D  +   Y +        +  DE                 + S+ S E+ +D+   E         +      + +   D  LY       VVK       +Y ++ + + + + Y   +E W   RRY DF  ++ I+T +  ++    LP K    N +  FL++R  +L +YL    KP+LL   P L ++   F+    W+  +     ++ +IVNP+KS      N V +     S I     K+ +   +     + + ++  K+G   D    ENIP RI+ LL+DE+FDL++K+Q +RR I+AILR+++KA  G K+N+ I E     TS++Q+AE V  F++S+WPNG LA +  PRDE TK+RT +LC+ KMLGS+ DEV   +G +  R+GV R+F +FQ + LNKR+ + +L+ V   +FP + F  L +
Sbjct:   86 GIIKIKESMEPSTKIKNFDKRMTGASVIDDVLKEVLEFVVRDYIKTWYRQLSDHDNFLMDIWQCAQKVVITFSSRSKDVNWMPYFTQRLVDDFASHIRLYKRATERVVQTKNEDNAEELEDVFFDMEVEMENKMCRDLVCTDPEVERQYLQDLSEVLLFLLLPPEDFHNKPFRYIVREVLVNGIFLPTVDLLSDPDYINQYIAWLCYETSFTRETFLTVIRSSDCMEELEAVRDKVESDIAKWRSKDTGGSDDTAIKQNLNSLMFLRDTCDMRIRRLEE-GPVSEQIIDEPESLRYQSLYVLTLEDIFNNNLALQAFIEYMTGRNGQQYLYFYLNVEGFRTAAEQQITEMQKLSQDSVTNAEPDLESL--RRAAKIIFDQYLAEKASSKLRIEPD--IVKYTVQKMKLKMMSEDI----FDVVQARVYQILHTEYYEDFLQCPAYVKLLGELGLLDNKDEEDVCCVNDVDVSIQPGSEGSMGSMEDLVDSHCDELGEDSISLDSSSSVASMGSPTGDVYLYASVSQTGVVKEPDKSGKSYAIFAVTVRRKEPYSEEEEVWDVYRRYSDFHDLHMILTEKFPELHVPHLPGKTVLKNTSQAFLDRRRKDLDKYLKGLMKPELLHNVPGLEDLINQFLHTGIWEKHKSEFSRKMDTIVNPLKSASKTMGNAVKSVPDGMSKIGDGIGKVFTSQKHIDQHRAREMMNQLKVGAGLDPEAMENIPLRIMLLLMDEVFDLKNKNQWLRRRIVAILRQLIKAMLGDKINRKIEEHVDFMTSAEQVAEYVAAFRNSFWPNGILAEARAPRDEDTKMRTRVLCKAKMLGSVPDEVRTLMGTDAVRKGVARIFQMFQYKTLNKRIVYVVLEGVLANLFPENKFQNLFR 955          
BLAST of Sorting nexin-13 vs. TrEMBL
Match: R7TMT3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_222037 PE=4 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 1.500e-133
Identity = 304/1000 (30.40%), Postives = 500/1000 (50.00%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYGLLFFDPI-----SLPYFMKSYKCQI---SKGLLKIVQGMKESD-KPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXD-------KDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRI----NKLAEPXXXXXXX-XXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLK-LNEYDIF------GFDDRLEKSVDREFYRITT------DQLVDYAQKILKDARDMKMSERLLTEIEM-----------------------RISSNDITESLFDDVLKQLLDMLH-EKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAID--------ACLIENELMSPCVNTSNSD-------------SDLYTVRIVDAVVKNNN--------YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQR-EWDNRQP--LNRIQSIVNPIKSML--------WMQENVVGNFKQMYSSI---------SPTKKLNSQNSYS------------------------GSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQ 2715
            +FG    ++ +  L  F+ G +    I     S+ +  ++    +   S GL  +V+ +++   K  ++  ++G+  +D    EV+D   RDYI+ WYK IS    F Y++R  +++++  FS R + VD I  +T +L ++  SHIRLYR +    R N+  +         + FD       K  CR  +C D   E+ YLS +SE +L+++   E+F+  P RY +RE+LV+ ILLP  N+++DPD+INQ I W+CK+ ++ +E F+  IR SDN +E++++ EK+D+  +R RS+DSGG+DD  IK Q++S+ FV+  C+SRI    + L EP+             +   KL  +  + IL+  + +S F+EF++++  Q Y+  YL I +F+S     L+ + I       G+    E+ +       TT      D + D A  I       K S  +L E+ +                        I   D ++++FD++  ++ D+L  + ++F AF +S  + +   E D LR+ S        D        A  +E+   S C + ++ D             S+ +T   V AV+ N          Y +Y + + +    G +ETW   RRY DF  ++  I ++   ++ L LPSKK FNNM  DFLEKR L L  YL    KP +L TY  L E+   F++   W+  +     ++ + VNP+KS +         M +N V    +M   I            K LN +   S                          I  S ++  S LG + +    E IP RI+ L++DE+FDL++ +Q +RR I+AILR+IVK  FG  +N+ I+E      S++QI+E ++ F+DS+WP G LA +   RD  TK+RT ++C+ KM GS++DE+   +G + ++ GV RVF++FQ Q LNKRL   IL+ +   +FP + F ++ +
Sbjct:   28 SFGATGGLWLLFYLLCFILGFILMLIIRGKQKSVSWLRETAHMTVPMPSIGLPSLVEYVRKGQQKYRMDKRMTGSSIIDDVLQEVLDYTYRDYINSWYKKISDDEQFRYDIRMMLHRVVIAFSERAKEVDLIPYLTTNLVDDFASHIRLYRRTLTKVRENQKDESKPPADIECTFFDLEKEMENKTMCRDAVCLDEDGERQYLSDLSEVLLFLLLPPEDFHNKPFRYIIREVLVSGILLPAFNLLSDPDYINQTISWLCKEQAFNNESFLTIIRSSDNVEELEAIREKIDLDIARQRSRDSGGEDDTAIKQQLNSLLFVKSTCESRILRLKDGLEEPEYSLAGGFDISKLMVPGQKLYLLPFDVILNNNVALSCFIEFMSNVGGQGYLFFYLTIERFQSASKNLLDRWRIHNACLKNGYRVSAEQQLSAVLQAGTTMEHHDVDAIRDAALSIYDQYLSEKASACVLEELWIILCLHQASPRLHLDETLVKTLLENIQHQDASDTVFDEIQAKVWDILQNDPKYFPAFCKSQLYIKLLAELDLLREGSSGENMSGGDTASGSSSRAQSVEDLATSSCESMTSLDPSIPVHSSAGRKTSESFT---VSAVIANTGICREHGKAYAVYLITVTRQYTDGRQETWDVYRRYSDFHDLHMTIQDKYESLSGLALPSKKAFNNMHKDFLEKRKLGLNAYLQALMKPSILTTYRGLPELVYGFLENLHWEREKSELARKMDTFVNPLKSSVKSVGSMVKSMPDNFVDGVAKMSGGIRSIPNNMLDGVGKILNVKGGPSTIPSLLSALIFNEQPPGALPPSIKAEIMDSGKVGASILGAEDE----EIIPLRIMLLMMDEVFDLKA-NQWMRRRIVAILRQIVKTMFGDSINRKIVEHVEWMMSAEQISEYIKTFRDSFWPTGLLAEARPKRDPSTKMRTRVVCKAKMFGSVTDELKTLIGTDNSKHGVLRVFNMFQHQALNKRLVCVILEALLLTMFPDNKFAEVFR 1019          
BLAST of Sorting nexin-13 vs. TrEMBL
Match: K1RAM8 (Sorting nexin-13 OS=Crassostrea gigas OX=29159 GN=CGI_10022616 PE=4 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.205e-130
Identity = 264/845 (31.24%), Postives = 450/845 (53.25%), Query Frame = 1
Query:  235 GLLKIVQGMKESDKPP-LESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXX-----XXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRS----NYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKE-TWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQRE-WDNRQP--LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQ-----LDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            G+L +V  M+ S K    +  ++GA  +D+A  EV+   +RDYI  WY+ +S  + F  ++RQ + K+   F+ R ++VDW+   ++ L ++  SH+RLYR +          +L++E             +KD CR  +C DP AEK YL ++SE +L+++   ++F     RY LRE+LVN I +PTI +++DPD++NQYI W+CKD S+T+E F+  I+ S    E+++V E  +   ++ RS+D+GG DDA++K +++S+ FV+ +C+ RI ++ E    + +         +  +  ++L+ I++  I +++F+EF+T++  Q Y+  YLN+  FR+      L   +  + G     +    R    I  DQ +       K +  +K+   ++     +I + +I E LFD+   ++  +LH +Q+++AF QSN + +  +E    + D    + E  D   ++  +M      S     ++ VR                    T   G++E   +T RRY DF  ++ +I  +        LP K    NM  DFLEKR   L  YL    K ++   YP ++E+   FV    W+  +     ++ +IVNPI+S          + K +  ++S    ++      G +F SD      LD  K+ +  D +  +NIP R++ LL+DE++DL+ K+  +RR I+A+L++++K  FG  +NK I++     TS++Q+AE V+KF+DS+WP G LA     RD  TK+RT +LC+ KMLGS+SD+    +G +T R G  R+FD+FQ Q LNKR  +  L+ V   +FP + F +L 
Sbjct:   72 GVLTVVNKMESSPKGKNFDRRMTGASVIDEALHEVLTYAIRDYIKSWYRQVSDHDGFVLDIRQCVQKLTITFASRTKDVDWMPFFSQRLVDDFASHLRLYRRARDGATVPPTDELYQEQVQSAFFDLEVAMEKDKCRDLVCLDPEAEKQYLQNLSEVLLFLLLPPDDFPNKTFRYILREVLVNGIFIPTIELLSDPDYLNQYIAWLCKDGSFTNESFLTVIKSSHLVGELEAVKEITEQNIAKWRSRDTGGADDAVVKQKLNSLLFVKNICEGRIRRIQEGSLDDIEEAPDICRAKNIFV--LSLDEIIENNIALAVFIEFMTNVCGQQYLFFYLNVEGFRTAAGQQILDAQQRAMNGMSTEADLESLRRAAMIIYDQYLSD-----KASSRIKLESDIVKRTLQKIKNKNIAEDLFDEAQSKVYQILHSEQYYEAFLQSNVYLKMLQEMGLSKPD----KPEDGDTSSLDEGMMKESDKNSGKTYAVFAVR-------------------ATKTSGDEEEVSETYRRYSDFHDLHMLIQEKFPDFQCPPLPGKTIVKNMNKDFLEKRKKSLNTYLMNLMKQEVWIKYPGMKELVLKFVAPGLWEKHKSELARKMDTIVNPIRS----------SVKTVGRAVSTDSLVDGL----GKVFKSDSNDRRALDSGKVADGLDGD-ADNIPLRVMLLLMDEVYDLREKNTWLRRRIVAVLKQLIKVTFGDSINKKIVDYVEFMTSAEQMAEYVRKFRDSFWPAGSLAEPRVQRDVHTKMRTRVLCKAKMLGSVSDDFRHLMGTDTIRIGTSRMFDMFQHQKLNKRFVYVFLEGVIITLFPQNKFPELF 871          
BLAST of Sorting nexin-13 vs. TrEMBL
Match: L7MIL0 (Putative sorting nexin 13 (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 5.550e-130
Identity = 286/937 (30.52%), Postives = 489/937 (52.19%), Query Frame = 1
Query:  118 IVNLIYFIISLSAFLYGLLF---------FDPISLPYFMKSYKCQISKGLLKIVQGMKESDKPPLESD----ISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKD-------KDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKL------AEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDAR---DMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRD--------------------------DSLISEEEAIDACLIENELMS----PCVNTSNSD----SDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQR---EWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQ-----MYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQ 2715
            ++ L  F+  L     G L          +DP+  P  +    C   KGL +I   +    KPP ++     ++G P +D    EV++ ILRDY+  WY  +S    FT  +R  +++++ N S+R + VDW+  +T  L ++  SH+RL+R +    +  KD        DL   FFSLE+  ++  CR  +C     E +YL  V E +LY+V   E+F    +R FLRE+LVN +LLP I++V+DPD++NQ IVWMC +N  TS+ F+  ++ +DN  E+++V E +    +  RSKD+GG+DD +IK Q++S+ +V+KV ++R+ +L       +             +    +L  +  + +L   I +S F+E++TSI AQ Y++ YL+   F     K++   +       +++ + E  R     + D        +R   D  ++++LL +  +R+ + D  E  FDD+ +++  ++ E+Q F +F +S  + +   E D L+D                          +SL  EEE I+   +  E+ S    P  N   ++    + +Y   IV     +  Y LY + + + +    +E W   RRY DFD  + ++  +  K+++L  P KK FNN++  FLE+R  +L E+L +  +P++L   P LR++  +F++    E   +Q    + S+VNP+KS +     +V N  +     +  SI    +     S    I  S+     K+G   D    +NIP RI+ LL+DE+FDL+SK+Q +RR I+ ILR+I+KA FG  +N+ I++      S+++IAE +  FKD+ WPNG  A +   RD+ TK+RT +  +  ML S++DE+   +G++TTR+G+  VF++FQ   LN+RL++ +L+     +FP + F +L +
Sbjct:   65 LLPLCIFVTILGIIFMGYLMEYQQQLEPSYDPV--PPHIPENHC--IKGLPQITTAIL---KPPKKTRYVRYLTGHPAIDDPLSEVLNYILRDYVYNWYLDLSNDEAFTDHIRDLVHQVIVNLSMRAKGVDWVQYLTIQLVDDFASHLRLFRQAQSRLKHKKDDDFGGKAPDLLTLFFSLETTMERSMCRDLVCISKERELEYLQQVGEVLLYLVLPPEDFQNKVMRIFLRELLVNTVLLPVIDLVSDPDYVNQTIVWMCSNNIPTSDEFLTVLKCTDNISELEAVKEIVLQEIAIQRSKDTGGNDDTVIKKQLNSLHYVKKVVENRLQRLYDGSLDTDSTGLPSQIDWKKLTAPGVELFQLPFDVVLANNIALSYFMEYMTSIGAQKYISFYLHAEGF-----KVSAEQLLSQAHTEDRNTNLESLREAAANIYDTYISETATSRINIDEVLAKKLLRK--LRVETPD--EFWFDDIQQKVAQIMQEEQHFPSFMKSEGYIKLLAELDLLKDFGSKSDEEDSFSGAKSAGSGDDCGSLNSLEPEEEPIE--FLNKEMPSAPPDPAANNKTAEFLLIASIYNTGIVRE--SSTTYALYAISVTRREPQSTEERWCVFRRYSDFDDFHILVLEKFPKLSKLPFPGKKTFNNLSRQFLEQRRAQLNEFLQQILQPEVLTANPGLRDMVLHFLEPGTYEKGKKQFARTMGSLVNPLKSSVRSMGTMVKNAPENLLDGLRDSIIKVLRSRPTASPVEVIQGSE-----KVGAGIDVETQDNIPLRIMLLLMDEVFDLKSKNQWLRRRIVVILRQIIKATFGDTINRKIVDYVEWMASTEKIAEYITAFKDALWPNGFPAETRPERDQNTKMRTRVAAKMIMLCSLTDELKHIIGSDTTRRGMLCVFEMFQHAPLNRRLTYVLLEGFLATLFPNNRFTELFR 976          
BLAST of Sorting nexin-13 vs. Ensembl Cavefish
Match: snx13 (sorting nexin 13 [Source:NCBI gene;Acc:103042544])

HSP 1 Score: 398.667 bits (1023), Expect = 4.595e-123
Identity = 269/912 (29.50%), Postives = 486/912 (53.29%), Query Frame = 1
Query:  112 FGIVNLIYFIISL--SAFLYGLLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHC-------RRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFR-SNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARD-MKMSERLLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIE------NELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKI-AQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYS--------GSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            F I  L ++I       F   LLF    S  +  K   SY      G+ K ++ +K E+ +  ++  ++G+  +D+   +VI   LRDYI  WY  +S   +F  E+RQ++   L  FS R + VDW    T  L ++  +H+R++R + +         +R+  ++L + FF  E E ++  CR  +CT    E+ +L  + E +LY++    +F+   +RYFLREIL   +LLP IN ++DPD+INQ+++WM +D+S   E F+  ++++D P E+++V +K+      LRS D+ GDD  +IK QI+S+ FV+KVC++RI +L       ++  +L  + +  KL  I L++IL   I +  F++++  +  Q  +  +L +  +R +   +L     +  D + + S  +   +     L  Y Q + + A   +++ E  L  +  +++  D T  +FDD+ +++ DM L +++F+ +F+Q   + +   E D L++ S    ++              N  +    N +  +S      I D  V N++   Y LY + + + +  G+++TWKT RRY DF   +  IT Q   + + L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP++S +    N V +F    +    TK  ++    S         SIF    +        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L+++++A +G  +N+ I++     TS +Q+A+ V++F+DS+WPNG LA +   RD+  ++RT +  +T +LG + DE+   +G +TTR+G+ RVF++FQ Q LN+RL++  L+   + +FP + F +L 
Sbjct:   27 FAIFYLAFYIFCFVGGGFAVTLLFGKTNSEKHLEKCEHSYLPPTPTGIAKTLEELKQETKQIKIDRRLTGSNIIDEPLQQVIQFALRDYIQYWYYTLSEDESFLLEIRQTVQNALVQFSTRSKEVDWQPYFTTRLVDDFATHLRVFRKAQERLNERDDLKQRDAPEELLDAFFEAEVEMERKICRDMVCTSHKDEEGFLRDLCEVLLYLLLPPGDFHNKNMRYFLREILARGVLLPLINQLSDPDYINQFVIWMIRDSSCNYEAFMNILKLTDKPAELEAVKDKVLEELQYLRSLDTAGDDINVIKNQINSLLFVKKVCETRIQRLQS----GKEVDALKLAANFGKLCIIPLDHILVHNIALQFFMDYMQHMGGQADLFFWLTVEGYRVTAQQQLEVMQSWQKDGKKQSSQTKGLLKAAA--LGVYEQYLSEKASPRVQVDEASLNRLAEKLNKEDPTPEIFDDIQRKVYDMMLRDERFYPSFRQHPLYVRMLAELDMLKEPSYRGSDDGDGESFNGSPTGSINLSLDDLTNAAMDESLQLHAFISDTGVCNDHGKTYALYAITVFRKNPDGSEDTWKTYRRYSDFHDFHMRITEQFENLNSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLNPEMVKGCPSLLPYIHDFLENKAYSKGKGDFARKMDTFVNPLRSSMRNVSNAVKSFPDSLAE-GMTKMSDNMGRMSERLGQDIKQSIFKVPPMLPKSDIDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDFMTSPEQVADYVKRFRDSYWPNGILAETPPRRDKSIRMRTRVAAKTNLLGIMPDELKHIIGADTTRKGILRVFEMFQHQQLNRRLAYVFLEGFLETMFPQYKFPELF 931          
BLAST of Sorting nexin-13 vs. Ensembl Cavefish
Match: snx13 (sorting nexin 13 [Source:NCBI gene;Acc:103042544])

HSP 1 Score: 398.667 bits (1023), Expect = 9.971e-123
Identity = 269/912 (29.50%), Postives = 486/912 (53.29%), Query Frame = 1
Query:  112 FGIVNLIYFIISL--SAFLYGLLFFDPISLPYFMK---SYKCQISKGLLKIVQGMK-ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHC-------RRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFR-SNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARD-MKMSERLLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIE------NELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKI-AQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYS--------GSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            F I  L ++I       F   LLF    S  +  K   SY      G+ K ++ +K E+ +  ++  ++G+  +D+   +VI   LRDYI  WY  +S   +F  E+RQ++   L  FS R + VDW    T  L ++  +H+R++R + +         +R+  ++L + FF  E E ++  CR  +CT    E+ +L  + E +LY++    +F+   +RYFLREIL   +LLP IN ++DPD+INQ+++WM +D+S   E F+  ++++D P E+++V +K+      LRS D+ GDD  +IK QI+S+ FV+KVC++RI +L       ++  +L  + +  KL  I L++IL   I +  F++++  +  Q  +  +L +  +R +   +L     +  D + + S  +   +     L  Y Q + + A   +++ E  L  +  +++  D T  +FDD+ +++ DM L +++F+ +F+Q   + +   E D L++ S    ++              N  +    N +  +S      I D  V N++   Y LY + + + +  G+++TWKT RRY DF   +  IT Q   + + L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       ++ + VNP++S +    N V +F    +    TK  ++    S         SIF    +        ++ ++    D N  +NIP R++ LL+DE+FDL+ ++Q +RR I  +L+++++A +G  +N+ I++     TS +Q+A+ V++F+DS+WPNG LA +   RD+  ++RT +  +T +LG + DE+   +G +TTR+G+ RVF++FQ Q LN+RL++  L+   + +FP + F +L 
Sbjct:   62 FAIFYLAFYIFCFVGGGFAVTLLFGKTNSEKHLEKCEHSYLPPTPTGIAKTLEELKQETKQIKIDRRLTGSNIIDEPLQQVIQFALRDYIQYWYYTLSEDESFLLEIRQTVQNALVQFSTRSKEVDWQPYFTTRLVDDFATHLRVFRKAQERLNERDDLKQRDAPEELLDAFFEAEVEMERKICRDMVCTSHKDEEGFLRDLCEVLLYLLLPPGDFHNKNMRYFLREILARGVLLPLINQLSDPDYINQFVIWMIRDSSCNYEAFMNILKLTDKPAELEAVKDKVLEELQYLRSLDTAGDDINVIKNQINSLLFVKKVCETRIQRLQS----GKEVDALKLAANFGKLCIIPLDHILVHNIALQFFMDYMQHMGGQADLFFWLTVEGYRVTAQQQLEVMQSWQKDGKKQSSQTKGLLKAAA--LGVYEQYLSEKASPRVQVDEASLNRLAEKLNKEDPTPEIFDDIQRKVYDMMLRDERFYPSFRQHPLYVRMLAELDMLKEPSYRGSDDGDGESFNGSPTGSINLSLDDLTNAAMDESLQLHAFISDTGVCNDHGKTYALYAITVFRKNPDGSEDTWKTYRRYSDFHDFHMRITEQFENLNSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLNPEMVKGCPSLLPYIHDFLENKAYSKGKGDFARKMDTFVNPLRSSMRNVSNAVKSFPDSLAE-GMTKMSDNMGRMSERLGQDIKQSIFKVPPMLPKSDIDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDFMTSPEQVADYVKRFRDSYWPNGILAETPPRRDKSIRMRTRVAAKTNLLGIMPDELKHIIGADTTRKGILRVFEMFQHQQLNRRLAYVFLEGFLETMFPQYKFPELF 966          
BLAST of Sorting nexin-13 vs. Ensembl Cavefish
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:103034035])

HSP 1 Score: 74.3294 bits (181), Expect = 4.363e-13
Identity = 69/294 (23.47%), Postives = 128/294 (43.54%), Query Frame = 1
Query: 1768 WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            W   R+  +F +++  +T     + +++LPS  K PF ++   FLEK   +L  +L +    +L+     L    +           P      +++  K   +   + +G          P    + Q   +     SD  DY    +    +  E  PF   F+L+ E+F+L+   + VR+ ++A+    V+  FG  +NK I +      S   +   +  F+D++WPNGKLA  NK R +  +  T    + K+L +I  E+   +G +  R G+ ++F+  Q+   NK 
Sbjct:  552 WSVTRKLSEFQALHRKLTECFPSLKKVQLPSLSKLPFKSIDQKFLEKSKNQLNTFLQKMLTDELMCQSEALYAFLS-----------PSPEHLKVMDIQKKSSFSFASFLGRL--------PRDFFSHQEDEADD--DSDLSDYGDDADGKKDDLAE--PF---FMLIGEVFELRGMFKWVRKTLIAL----VQVTFGRTINKQIRDTVNWIFSEQMMVYYINIFRDTFWPNGKLAPHNKSRSDSERQETKERAQQKLLDNIPVELQNLVGQQNARYGIIKIFNALQEASANKH 815          
BLAST of Sorting nexin-13 vs. Ensembl Cavefish
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:103034035])

HSP 1 Score: 73.559 bits (179), Expect = 8.654e-13
Identity = 71/297 (23.91%), Postives = 131/297 (44.11%), Query Frame = 1
Query: 1768 WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLW---MQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKR 2643
            W   R+  +F +++  +T     + +++LPS  K PF ++   FLEK   +L  +L +    +L+              Q E         + + ++P    L    +Q+    +F      + P    + Q   +     SD  DY    +    +  E  PF   F+L+ E+F+L+   + VR+ ++A+    V+  FG  +NK I +      S   +   +  F+D++WPNGKLA  NK R +  +  T    + K+L +I  E+   +G +  R G+ ++F+  Q+   NK 
Sbjct:  676 WSVTRKLSEFQALHRKLTECFPSLKKVQLPSLSKLPFKSIDQKFLEKSKNQLNTFLQKMLTDELM-------------CQSE--------ALYAFLSPSPEHLKVMDIQKKSSFSFASFLGRL-PRDFFSHQEDEADD--DSDLSDYGDDADGKKDDLAE--PF---FMLIGEVFELRGMFKWVRKTLIAL----VQVTFGRTINKQIRDTVNWIFSEQMMVYYINIFRDTFWPNGKLAPHNKSRSDSERQETKERAQQKLLDNIPVELQNLVGQQNARYGIIKIFNALQEASANKH 939          

HSP 2 Score: 55.0694 bits (131), Expect = 3.999e-7
Identity = 65/282 (23.05%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  310 NLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYE-VRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRN-KDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEK-DYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNS-------YTSEY--FIQAIRMSDNPDEIKSVLEKLDMFTSRL----------RSKDSGGDDDALIKAQ----------ISSIEFVRKVCQSRINKLAEP 1059
            N+DKA  EV D   RDYI  WY  +S      Y+ + +  ++++K   +R   VD ++V+  D    L SH    + +N       +   LH                   C   + E+  +L   S  ++     + +     LR  L E++   +L P + +++DPD+INQ ++ + +          Y   Y  F + I  S + D +K +  ++ +   R           + KDS G D A +KA           I+ +   +K C+ +I  L  P
Sbjct:  130 NMDKALKEVFDYCYRDYILSWYAPLSRDEGQLYQMLSEDFWEMIKQLRVRLSEVDVVNVVCNDTVKTLHSHFCDLKAANARQEETPRPLALHP------------------CLRSSEEELQFLRCCSRLLVLCALPARDARCRSLRLVLVEVIATKVLKPLVEVLSDPDYINQMLLALLEHREQHKKAYIYADSYEDFFKLISNSTDIDFLKQLRYQIVVEIVRATTLSSIPQFKKQKDSKGKDVAAMKADLLGTRDIKRYINQLTVAKKQCEKKIRLLEGP 393          
BLAST of Sorting nexin-13 vs. Ensembl Cavefish
Match: snx19b (sorting nexin-19 [Source:NCBI gene;Acc:103036172])

HSP 1 Score: 56.225 bits (134), Expect = 1.857e-7
Identity = 43/192 (22.40%), Postives = 82/192 (42.71%), Query Frame = 1
Query:  283 LESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVD--WISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQ--KICT------DPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIV 828
            ++SD      LD      +  I+RD++  WY  +S    F  EV  +M  +      R + VD   +++ T DL      H++ Y  + +    N+ K+            D+   R+    CT       P  E +Y  ++ + +L+++           R+ + E++   +LLP I  ++DPD++N  I+
Sbjct:   82 IQSDEESELELDHEIQNTVSKIIRDFVSSWYNTVSSEPEFEEEVHNAMISMAMELKRRAKKVDRKALTMRTLDL---CGCHLQCYLRAKEIRAENEGKE-------ESGGADESLWREYSTACTPYPALQSPAIEVNYARAIVDLLLHVLVPPPHLETRTGRFVVCELITCKVLLPLIAKLSDPDWLNMLII 263          
BLAST of Sorting nexin-13 vs. Ensembl Sea Lamprey
Match: snx13 (sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-12])

HSP 1 Score: 214.542 bits (545), Expect = 1.363e-59
Identity = 169/619 (27.30%), Postives = 312/619 (50.40%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYG----LLFFDPISLPYFMKSYKCQISKGLLKIVQG----MKESDKPP-LESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLS----NQH----CRRNKDKD-LHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLV---------DYAQKILKDARD-MKMSERLLTEIEMRISSNDIT----ESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSL----------ISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQ 1827
             FG     YFI+ +  FL G    +  +  ++    ++SY+  +   +L  ++     +++ +KP   +  ++GA  +D+   +V+  +LRDY+  WY  +S    F  EVRQ M   L     RC++V+W   +T  L ++  SH+R YR +    N+H     +++ D D + E FF+ E E +K+ CR  +CT    E+++L  +SE +L+++  S +F    +R  LREI V  ILLPT++ ++DPD+INQY+ WM  D+  T E F+  ++ S+  DE+++V EK      RLRS+D+ GD D  +K Q++S++FV+K+C+ R+++L     KE++        +  KL  I L+ IL   I +  F++++ S+ AQ  +  +L +  +R    +         D    + V    +   T  LV          Y Q + + A   +++ + +L  +  ++   D+       LFDD+ +++ D ML + +++  FKQS+++ +   E D L++ S+           S   +++  L  ++L       S  +      +I +  V N +   Y LY + + +    G++++W T RRYR  + ++  I  Q
Sbjct:   23 TFGPSAGFYFILYMVFFLAGSLGVIFIYGKLNSEKLLESYEQTVLPAVLPAIKAVAAEIRQENKPGKGDRRLTGASIIDEPLQQVLQYVLRDYVHCWYYDLSDDEGFLLEVRQIMQMALTTLFNRCKDVEWQPYLTTRLVDDFASHLRAYRKALRKVNEHDVAEAQQSDDADEIVEAFFNAEVEMEKEICRDLVCTSEQEEREFLRDLSEVLLFLLLPSNDFQSRSVRCVLREIFVMGILLPTVDTLSDPDYINQYVTWMLNDSPCTCEAFLTVLKGSELLDELEAVREKASEELQRLRSQDTIGDADVTVKGQMNSLQFVKKLCEVRMDRLR--CGKEQELECSRLPANLGKLCVIPLDDILGNNIALQYFIDYMQSMAAQALLFFWLIVEGYRVTAEQ-------QLDALHRERVGAPRHAPPTHNLVVMLRNAAIGVYEQYLGEKASPRVRVDDVMLANLREKLHREDLPPNLFPGLFDDIQRKVYDTMLRDDRYYPGFKQSSFYVKALAELDMLKEPSIREGDDSESYNGSPASSLNVSL--DDLSLTAQTPSPEEPGQLQAQITETGVGNEHGKSYTLYAITVTRRHNDGSQDSWDTFRRYRGVNDLHMRINEQ 630          
BLAST of Sorting nexin-13 vs. Ensembl Sea Lamprey
Match: snx13 (sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-12])

HSP 1 Score: 196.052 bits (497), Expect = 7.242e-54
Identity = 151/526 (28.71%), Postives = 270/526 (51.33%), Query Frame = 1
Query:  109 NFGIVNLIYFIISLSAFLYGLLFFD-------PISLPYFMKSYKCQISKGLLKIVQG----MKESDKPP-LESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLS----NQH----CRRNKDKD-LHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLV----DYAQKILKDARDMKMSER------LLTEIEMRISSNDIT----ESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSL 1578
             FG     YFI+ +  FL G             ++    ++SY+  +   +L  ++     +++ +KP   +  ++GA  +D+   +V+  +LRDY+  WY  +S    F  EVRQ M   L     RC++V+W   +T  L ++  SH+R YR +    N+H     +++ D D + E FF+ E E +K+ CR  +CT    E+++L  +SE +L+++  S +F    +R  LREI V  ILLPT++ ++DPD+INQY+ WM  D+  T E F+  ++ S+  DE+++V EK      RLRS+D+ GD D  +K Q++S++FV+K+C+ R+++L     KE++        +  KL  I L+ IL   I +  F++++ S+ AQ  +  +L +  +R    +         D    + V    +   T  LV    + A  + +     K S R      +L  +  ++   D+       LFDD+ +++ D ML + +++  FKQS+++ +   E D L++ S+
Sbjct:   23 TFGPSAGFYFILYMVFFLAGAFMVTLLLKNNWKLNSEKLLESYEQTVLPAVLPAIKAVAAEIRQENKPGKGDRRLTGASIIDEPLQQVLQYVLRDYVHCWYYDLSDDEGFLLEVRQIMQMALTTLFNRCKDVEWQPYLTTRLVDDFASHLRAYRKALRKVNEHDVAEAQQSDDADEIVEAFFNAEVEMEKEICRDLVCTSEQEEREFLRDLSEVLLFLLLPSNDFQSRSVRCVLREIFVMGILLPTVDTLSDPDYINQYVTWMLNDSPCTCEAFLTVLKGSELLDELEAVREKASEELQRLRSQDTIGDADVTVKGQMNSLQFVKKLCEVRMDRLR--CGKEQELECSRLPANLGKLCVIPLDDILGNNIALQYFIDYMQSMAAQALLFFWLIVEGYRVTAEQ-------QLDALTRERVGAPRHAPPTHNLVVMLRNAAIGVYEQYLGEKASPRVRVDDVMLANLREKLHREDLPPNLFPGLFDDIQRKVYDTMLRDDRYYPGFKQSSFYVKALAELDMLKEPSI 539          
BLAST of Sorting nexin-13 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009451.1 (pep scaffold:Pmarinus_7.0:GL485623:4095:4978:-1 gene:ENSPMAG00000008553.1 transcript:ENSPMAT00000009451.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 4.123e-17
Identity = 36/92 (39.13%), Postives = 58/92 (63.04%), Query Frame = 1
Query: 2437 KDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            +DS WP G LA +  PR+  T +RT +  + KML S+ DE+   LG ET R+G+ RVF++FQ + LN+RL +  L+ + + ++P +   +L 
Sbjct:    1 RDSLWPGGILAETPPPRNLHTHMRTRVAAQVKMLSSMPDELKHILGAETMRKGLLRVFEMFQHRQLNRRLLYVCLEGLLESLYPKNRLHQLF 92          
BLAST of Sorting nexin-13 vs. Ensembl Sea Lamprey
Match: snx14 (sorting nexin 14 [Source:NCBI gene;Acc:555970])

HSP 1 Score: 51.2174 bits (121), Expect = 1.142e-6
Identity = 45/184 (24.46%), Postives = 82/184 (44.57%), Query Frame = 1
Query:  265 ESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFIN 816
            ES +P L  D+     +D +  E+++L+L+++I  WY   +       E+R +M         R + VD  S+IT+ L      HI +   + Q  R N D  L +              R +      +E  YL +++E +L  +      +   L   +RE++  ++LLP ++ +  PDF+N
Sbjct:   94 ESMQPWL--DLKVPQKVDASLAELLELVLKNFIYPWYSDFTDDEALVDELRLTMRFAAAVLLRRTKKVDVPSLITDKLLKVAMKHIEIVVRAKQKVR-NTDA-LQQAALEEYGPDLHLALRSR-----RSELRYLRTLTEMLLPQLIPHSTADTKSLMLLVREVVSGSVLLPLLDQLASPDFVN 268          
BLAST of Sorting nexin-13 vs. Ensembl Nematostella
Match: EDO37622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFD4])

HSP 1 Score: 377.867 bits (969), Expect = 1.733e-116
Identity = 263/881 (29.85%), Postives = 455/881 (51.65%), Query Frame = 1
Query:  235 GLLKIVQGMKESDKPPLESD--ISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRR-NKDK----DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSR-----------INKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFR---SNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDS--LISEEEAIDACLIENELMS-PCVNTS--NSDSDLYTVRIVD--AVVKNNN--YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQ-----REWDN--RQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSS---ISPTKKLNSQ--------------NSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQ 2715
            GL  I++ + ES+K   + D  ++G+  +D+   EV+    RD++  WY  IS    F Y++R ++ + L  F+ R ++V+W+S +T    +++ +H++++R + Q   +  KD     D+   FF +E+E + D CR KIC     EK+YL  +SE +LY++   E+F+  PLRYF RE++   +LLPT  +V DPD+INQ +VW+CK++++T + F+  I    + D++++V  K+D+  ++LR+ DS   D A ++ Q+SS+ FV+K+C ++           +NKL  P               S  +  + L  +L   I +S F+EF+ S+N Q Y+  +L +  FR      L ++       D       D    R     + D       DA+ + + + ++ +   ++S  +     FD+  K + ++L + QF+ +F  S  + +   E D L++ S   +S+ E       +N L   P +     +SD DL     ++   + K+N   Y +Y + + +  + G   +W   RRY DFD ++  + N+ G +  L LP K+ F NM  DFLEKR   L  Y+        L  YP + E+  NF++     RE     R+  N   S+ N   ++  +   + G  ++++++   +   + L +Q               SY  +     Q+D      D D     NI  R+L LL+DEIFDL+ ++  +RR I+ +LR+I+K  +G ++N+ I+E     TS++QIAE V+ F++S+WP G LA S   R    KLRT +  +TKM GSI D++ +FLG E T  G+ RVFD FQ   LNKRL + + + + +++FP + F ++ +
Sbjct:   24 GLQTILEKVWESNKTSYKMDKRLTGSSIIDEPLQEVLQFFFRDFVHGWYYQISTDEGFLYDLRHTLQRALIAFANRSKDVEWVSFLTTRFVDDITNHLKIFRKARQRLEKLQKDGEETVDIENLFFQIEAEMENDICRDKICLADKREKEYLCDISEMLLYLLLPPEDFHNKPLRYFFREVIATCVLLPTAQLVCDPDYINQTVVWLCKESTFTKDAFLTII---SSGDDVQAVKNKVDVEIAKLRAHDSETSDVA-VRQQLSSLLFVKKLCHAKEHHLEYEDLVSVNKLFVP---------------SQPVPVLPLHILLQDNIALSYFIEFMNSMNGQVYLYFWLAVESFRVTAEQQLSVSMERQLSQDSSSSLPADLGDLRTAAKSIFDQYLSEQADAK-VDLPKDMVKKTWKKVSQEEPCPDCFDEAQKWVFEILGQDQFYTSFLNSQTYMRCLIELDVLKERSGNFMSQLE-------QNLLFGFPVLGEKLWSSDDDLRLTASINQIGLCKDNGKTYAVYAISVFRATQEGTN-SWTIYRRYSDFDDLHMHLKNKFGPLPNLLLPGKRTFRNMDKDFLEKRRAALDSYIQTLLSTDFLDKYPGMFEVVANFLEHGKYAREKGQFARKVDNMKHSVHNVSHAIKTVPLGLSGGMQKIFTNKVCLLQYRLLITQRSSFVFFRLLIPLCESYCFTPLIKPQVD------DDD-----NIALRVLLLLMDEIFDLKDRNLWLRRRIIVLLRQIIKTTYGDRINRKIVESVNWMTSAEQIAEYVKMFRESFWPGGVLAESAPERASDIKLRTRVAAKTKMYGSIPDDLKRFLGTEVTLDGICRVFDTFQYTSLNKRLMYLLCEGMLEQLFPDNKFSEIFR 865          
BLAST of Sorting nexin-13 vs. Ensembl Nematostella
Match: EDO37987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE70])

HSP 1 Score: 86.2705 bits (212), Expect = 3.748e-17
Identity = 79/313 (25.24%), Postives = 139/313 (44.41%), Query Frame = 1
Query: 1753 GNKETWKTQRRYRDFDSMNNIITNQCGKIA-QLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFP 2688
               E W   R++ DF  ++  +     K+  +L  P+KK + ++ ++FL K  L L++YL      + L     L E   +F+    ++      ++    P K   +    V+  +  + SS      ++    Y  S+ S      S L  DS        PF   + L+ E+F+L+   +++RR ++A     V+  FG  +NK I E      S   I   +  F+DS WP G+LA +   R +  KL T +     +L  I + +   +G + +R G  +VF+ FQD  +NK L + +L++    I P
Sbjct:  551 ATSEGWVVTRKFNDFKILHAKLKECSSKLPNELPAPAKKWYKSLDDEFLNKSRLALEQYLQSLLADETLC----LSEELYSFLSPSPEH------LRKQTEPAKKAGFSLMAVLKRYNDILSSHCHLPTIH----YIWSLLSF----CSSLPKDSIAE-----PF---YALIGEVFELKGVFRLLRRTLIAF----VQITFGGTINKEIQEMLEWLVSESMIVYYIHTFRDSLWPGGQLAKTAPIRTDEEKLETKIRAMDHLLKDIPEVLQNLVGKKNSRLGTIKVFEAFQDVRVNKHLFYVLLEMCIFTICP 833          

HSP 2 Score: 79.337 bits (194), Expect = 4.871e-15
Identity = 78/343 (22.74%), Postives = 151/343 (44.02%), Query Frame = 1
Query:  313 LDKAFVEVIDLILRDYIDIWYKHISLSNN-FTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYI-VWMCKDNSYTSEY------------FIQAIRMSDNPDEIKS-----VLEKLDMFT-SRLRS---KDSGGDDDAL----------IKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTS-INAQNYMTIYLNIIQFR 1239
            +D++  EV D  +RD+   W++ +      F   + + ++ I  N   R +NVD ++ ++ DL + L +H +  RL++Q   RN  +              + +      T   AE DYL  +S+ ILY   S      P +R  LREIL  ++  P  +M+ DPD+INQ + +++    + T+++            FI+ I   ++ +E+K      + E +   T + LR    ++   D+  L          +K  I+     +  C+ RI  L +P S   +      +  +     ++   I+D  +  S F+ FL +  +++N ++ ++ I   R
Sbjct:    1 IDQSIQEVFDFFVRDFCLSWFRVLGKDEAAFVDLMTEELWAITSNVVERLKNVDKVNFLSSDLVDILTNHFQSLRLADQ---RNSPE------------TAEAFVLHHCLTSKKAELDYLRKISDVILYCFLSERNSQCPEMRVLLREILAYSVFQPLADMLCDPDYINQTVLIYLEAKETLTAKHKPRYAYAETYEDFIRMINTCNSVEELKQIRYHIIAEIMQATTINNLRGIEKQNQQTDNQPLNKDAQLRTRNLKRYINQCTVAKAQCEKRIKLLGKP-STTPEQKPKPTNKVTGPTKMLSFAEIMDNSLARSFFMSFLQNHTHSRNLLSFWMAIENLR 327          
BLAST of Sorting nexin-13 vs. Ensembl Medaka
Match: snx13 (sorting nexin 13 [Source:NCBI gene;Acc:101168131])

HSP 1 Score: 409.453 bits (1051), Expect = 3.997e-127
Identity = 283/913 (31.00%), Postives = 486/913 (53.23%), Query Frame = 1
Query:  112 FGIVNLIYFIISL--SAFLYGLLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFR-SNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARD-MKMSERLLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLIS----EEEAIDACLIE--NELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN----------SYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLL 2712
            F I  L ++I       F   LL+    S  +  K   SY      G+LK +  MK   KP  ++  ++G+  +D+   +VI   LRDYI  WY  +S   +F  E+RQ++   L  FS R + VDW    T  L ++  +H+R++R +       +DK      +L + FF  E E ++  CR  +CT    E+ +L  + E +LY++    +F+   +RYFLRE+L   +LLP IN ++DPD+INQ+++WM +D+S   E F+  ++++D P E+++V +K+      LRS D+ GDD  +IK QI+S+ FV+KVC++RI +L       ++  +L  + +  KL  I LE+IL   I +  F++F+ +  AQ  +  +L +  +R +   +L        D + + S  +   +     L  Y Q + + A   +++ + L+T++  ++ ++D T  +FD++ +++ DM L +++F+ AFKQS  + +   E D L++ S       E E+ +       N  +    N+ + D       I D  V N++   Y LYT+ + + +  GN++ W T RRY DF   +  I  Q   +A  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       +I + VNP++S +    NV    K +  S++      S N           +  S+     L        ++ ++    D N  +NIP R++ LL+DE+FDL+ K+Q +RR I  +L+++++A +G  +N+ I++     TS +Q+AE V+KF+DS+WPNG LA S   RD+  ++RT +  +T +LG + DE+   +G ETTR+G+ RVFD+FQ Q +N+RL +  L+   + +FP + F +L 
Sbjct:   27 FAIFYLAFYIFCFIGGGFAVTLLYGKINSEKHLEKCEHSYLPPTQPGILKTLDEMKLELKPIKIDRRLTGSSFIDEPLQQVIQFALRDYIQYWYYTLSEDESFLLEIRQTLQNALIQFSTRSKEVDWQPYFTTRLVDDFATHLRVFRKAQDRLAEREDKQRDTTEELVDSFFEAEVEMERKVCRDMVCTSHKDEEGFLRDLCELLLYLLLPPGDFHNKNMRYFLREVLACGVLLPLINQLSDPDYINQFVIWMIRDSSCNYEAFMNILKLTDKPTELEAVKDKVLEELQYLRSLDTAGDDINVIKNQINSLLFVKKVCETRIQRLQS----GKEVDALKLAANFGKLCVIPLEHILVHNIALQFFMDFMQAAGAQAELFFWLTVEGYRVTAQQQLEAMLSCQKDGKKQPSATKGLLKAAA--LGVYEQYLSEKASPRVQVDKTLITKLGEKLQNDDPTPEIFDEIQRKVYDMMLRDERFYPAFKQSPLYVRMLAELDMLKEPSYRGSDDGEGESFNGSPTGSLNLCLDDYSNSCHEDFLQLQAFISDTGVCNDHGKTYALYTITVFRRNSDGNEDCWITYRRYSDFHDFHMRIIVQFENLASILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLNPEMVKACPTLIPYVYDFLENKAYSKGKGEFARKIDTFVNPLRSSI---RNVSSAVKSLPDSLAEGMTKVSDNMGRMSERIGQDFKQSVLKVPPLLPKSDIDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKEKNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDYLTSPEQVAEYVKKFRDSYWPNGILAESPPRRDKSIRMRTRVAAKTSLLGIMPDELKHIIGAETTRKGILRVFDMFQYQPMNRRLVYVFLEGFLETMFPQYKFPELF 930          
BLAST of Sorting nexin-13 vs. Ensembl Medaka
Match: snx13 (sorting nexin 13 [Source:NCBI gene;Acc:101168131])

HSP 1 Score: 399.438 bits (1025), Expect = 1.174e-123
Identity = 278/894 (31.10%), Postives = 477/894 (53.36%), Query Frame = 1
Query:  112 FGIVNLIYFIISL--SAFLYGLLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFR-SNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARD-MKMSERLLTEIEMRISSNDITESLFDDVLKQLLDM-LHEKQFFDAFKQSNYFRQFFEESDELRDDSLIS----EEEAIDACLIE--NELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQN----------SYSGSIFSSDQL--------DYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHS 2655
            F I  L ++I       F   LL+    S  +  K   SY      G+LK +  MK   KP  ++  ++G+  +D+   +VI   LRDYI  WY  +S   +F  E+RQ++   L  FS R + VDW    T  L ++  +H+R++R +       +DK      +L + FF  E E ++  CR  +CT    E+ +L  + E +LY++    +F+   +RYFLRE+L   +LLP IN ++DPD+INQ+++WM +D+S   E F+  ++++D P E+++V +K+      LRS D+ GDD  +IK QI+S+ FV+KVC++RI +L       ++  +L  + +  KL  I LE+IL   I +  F++F+ +  AQ  +  +L +  +R +   +L        D + + S  +   +     L  Y Q + + A   +++ + L+T++  ++ ++D T  +FD++ +++ DM L +++F+ AFKQS  + +   E D L++ S       E E+ +       N  +    N+ + D       I D  V N++   Y LYT+ + + +  GN++ W T RRY DF   +  I  Q   +A  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       +I + VNP++S +    NV    K +  S++      S N           +  S+     L        ++ ++    D N  +NIP R++ LL+DE+FDL+ K+Q +RR I  +L+++++A +G  +N+ I++     TS +Q+AE V+KF+DS+WPNG LA S   RD+  ++RT +  +T +LG + DE+   +G ETTR+G+ RVFD+FQ Q +N+RL ++
Sbjct:   27 FAIFYLAFYIFCFIGGGFAVTLLYGKINSEKHLEKCEHSYLPPTQPGILKTLDEMKLELKPIKIDRRLTGSSFIDEPLQQVIQFALRDYIQYWYYTLSEDESFLLEIRQTLQNALIQFSTRSKEVDWQPYFTTRLVDDFATHLRVFRKAQDRLAEREDKQRDTTEELVDSFFEAEVEMERKVCRDMVCTSHKDEEGFLRDLCELLLYLLLPPGDFHNKNMRYFLREVLACGVLLPLINQLSDPDYINQFVIWMIRDSSCNYEAFMNILKLTDKPTELEAVKDKVLEELQYLRSLDTAGDDINVIKNQINSLLFVKKVCETRIQRLQS----GKEVDALKLAANFGKLCVIPLEHILVHNIALQFFMDFMQAAGAQAELFFWLTVEGYRVTAQQQLEAMLSCQKDGKKQPSATKGLLKAAA--LGVYEQYLSEKASPRVQVDKTLITKLGEKLQNDDPTPEIFDEIQRKVYDMMLRDERFYPAFKQSPLYVRMLAELDMLKEPSYRGSDDGEGESFNGSPTGSLNLCLDDYSNSCHEDFLQLQAFISDTGVCNDHGKTYALYTITVFRRNSDGNEDCWITYRRYSDFHDFHMRIIVQFENLASILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLNPEMVKACPTLIPYVYDFLENKAYSKGKGEFARKIDTFVNPLRSSI---RNVSSAVKSLPDSLAEGMTKVSDNMGRMSERIGQDFKQSVLKVPPLLPKSDIDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKEKNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDYLTSPEQVAEYVKKFRDSYWPNGILAESPPRRDKSIRMRTRVAAKTSLLGIMPDELKHIIGAETTRKGILRVFDMFQYQPMNRRLVYN 911          
BLAST of Sorting nexin-13 vs. Ensembl Medaka
Match: snx13 (sorting nexin 13 [Source:NCBI gene;Acc:101168131])

HSP 1 Score: 274.633 bits (701), Expect = 6.438e-79
Identity = 209/699 (29.90%), Postives = 362/699 (51.79%), Query Frame = 1
Query:  112 FGIVNLIYFIISL--SAFLYGLLFFDPISLPYFMK---SYKCQISKGLLKIVQGMKESDKP-PLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDK------DLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFR-SNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARD-MKMSERLLTEIEMRISSNDITESLFDDVLKQLLD-MLHEKQFFDAFKQSNYFRQFFEESDELRDDSLI----SEEEAIDACLIE--NELMSPCVNTSNSDSDLYTVRIVDAVVKNNN---YVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQ-LRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQP---LNRIQSIVNPIKSMLWMQENVVGNFKQMYSSIS 2124
            F I  L ++I       F   LL+    S  +  K   SY      G+LK +  MK   KP  ++  ++G+  +D+   +VI   LRDYI  WY  +S   +F  E+RQ++   L  FS R + VDW    T  L ++  +H+R++R +       +DK      +L + FF  E E ++  CR  +CT    E+ +L  + E +LY++    +F+   +RYFLRE+L   +LLP IN ++DPD+INQ+++WM +D+S   E F+  ++++D P E+++V +K+      LRS D+ GDD  +IK QI+S+ FV+KVC++RI +L       ++  +L  + +  KL  I LE+IL   I +  F++F+ +  AQ  +  +L +  +R +   +L        D + + S  +   +     L  Y Q + + A   +++ + L+T++  ++ ++D T  +FD++ +++ D ML +++F+ AFKQS  + +   E D L++ S       E E+ +       N  +    N+ + D       I D  V N++   Y LYT+ + + +  GN++ W T RRY DF   +  I  Q   +A  L+LP KK FNNM  DFLEKR  +L  YL     P++++  P L     +F++ +  ++       +I + VNP++S +    NV    K +  S++
Sbjct:   33 FAIFYLAFYIFCFIGGGFAVTLLYGKINSEKHLEKCEHSYLPPTQPGILKTLDEMKLELKPIKIDRRLTGSSFIDEPLQQVIQFALRDYIQYWYYTLSEDESFLLEIRQTLQNALIQFSTRSKEVDWQPYFTTRLVDDFATHLRVFRKAQDRLAEREDKQRDTTEELVDSFFEAEVEMERKVCRDMVCTSHKDEEGFLRDLCELLLYLLLPPGDFHNKNMRYFLREVLACGVLLPLINQLSDPDYINQFVIWMIRDSSCNYEAFMNILKLTDKPTELEAVKDKVLEELQYLRSLDTAGDDINVIKNQINSLLFVKKVCETRIQRLQS----GKEVDALKLAANFGKLCVIPLEHILVHNIALQFFMDFMQAAGAQAELFFWLTVEGYRVTAQQQLEAMLSCQKDGKKQPSATKGLLKAAA--LGVYEQYLSEKASPRVQVDKTLITKLGEKLQNDDPTPEIFDEIQRKVYDMMLRDERFYPAFKQSPLYVRMLAELDMLKEPSYRGSDDGEGESFNGSPTGSLNLCLDDYSNSCHEDFLQLQAFISDTGVCNDHGKTYALYTITVFRRNSDGNEDCWITYRRYSDFHDFHMRIIVQFENLASILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLNPEMVKACPTLIPYVYDFLENKAYSKGKGEFARKIDTFVNPLRSSI---RNVSSAVKSLPDSLA 722          
BLAST of Sorting nexin-13 vs. Ensembl Medaka
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:101155361])

HSP 1 Score: 87.0409 bits (214), Expect = 6.020e-17
Identity = 74/310 (23.87%), Postives = 149/310 (48.06%), Query Frame = 1
Query: 1768 WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKP-KLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFP 2688
            W  QR+  +F  ++  +T     + +L++PS  K PF ++   FLEK   +L  +L       +L Q+     E+   F+    ++ + ++  +     + S L   E + G+F       S T++   ++S           D S  G+++D  K  N      F+L+ EIF+L+   + VR+ ++A+    V+  FG  +NK I +      S   +   +  F+D++WP+GKLA   + R +  +  T    + K+L +I D ++  +G +  R G+ ++F+  Q+   NK L + +++++ +++ P
Sbjct:  691 WSVQRKLSEFQILHRKLTECFPSLKKLQVPSLSKLPFKSIDQKFLEKSKTQLNAFLQRLLTDDRLCQS-----EVLYAFLSPSPEHLKVMSIQKKSSFSLASFL---ERLPGDF------FSHTEEDGDEDS-----------DLSDYGDETDGRK--NALAEPCFMLIGEIFELRGMFKWVRKTLIAL----VQVTFGRTINKQIRDTVNWIFSEQMLVCYISVFRDTFWPDGKLAPHLESRTDSERHETKERAQQKLLDNIPDALANLVGQQNARYGIIKIFNALQEANANKHLLYVLMEMLLKELCP 969          
BLAST of Sorting nexin-13 vs. Ensembl Medaka
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:101155361])

HSP 1 Score: 81.2629 bits (199), Expect = 3.760e-15
Identity = 73/296 (24.66%), Postives = 139/296 (46.96%), Query Frame = 1
Query: 1768 WKTQRRYRDFDSMNNIITNQCGKIAQLRLPS--KKPFNNMANDFLEKRSLELQEYLTECFKP-KLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRL 2646
            W  QR+  +F  ++  +T     + +L++PS  K PF ++   FLEK   +L  +L       +L Q+     E+   F+    ++ + ++  +     + S L   E + G+F       S T++   ++S           D S  G+++D  K  N      F+L+ EIF+L+   + VR+ ++A+    V+  FG  +NK I +      S   +   +  F+D++WP+GKLA   + R +  +  T    + K+L +I D ++  +G +  R G+ ++F+  Q+   NK L
Sbjct:  691 WSVQRKLSEFQILHRKLTECFPSLKKLQVPSLSKLPFKSIDQKFLEKSKTQLNAFLQRLLTDDRLCQS-----EVLYAFLSPSPEHLKVMSIQKKSSFSLASFL---ERLPGDF------FSHTEEDGDEDS-----------DLSDYGDETDGRK--NALAEPCFMLIGEIFELRGMFKWVRKTLIAL----VQVTFGRTINKQIRDTVNWIFSEQMLVCYISVFRDTFWPDGKLAPHLESRTDSERHETKERAQQKLLDNIPDALANLVGQQNARYGIIKIFNALQEANANKHL 955          
BLAST of Sorting nexin-13 vs. Planmine SMEST
Match: SMESG000002662.1 (SMESG000002662.1)

HSP 1 Score: 1722.98 bits (4461), Expect = 0.000e+0
Identity = 875/880 (99.43%), Postives = 877/880 (99.66%), Query Frame = 1
Query:  160 LYGLLFFDPISLPYFMKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQYKLCPAANGKVCNKHNLNAPEWRDWGSL 2799
            L  LLFFDPISLPYFMKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHEEFFSLESEFDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPKSKEEDSLSLGKSLSSTKLSSITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNN+ITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQV RRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRL+HSILQLVAQKIFPGHNFDKLLQYKLCPAANGKVCNKHNLNAPEWRDWGSL
Sbjct:   17 LSRLLFFDPISLPYFMKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHEEFFSLESEFDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPKSKEEDSLSLGKSLSSTKLSSITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNMITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVARRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLAHSILQLVAQKIFPGHNFDKLLQYKLCPAANGKVCNKHNLNAPEWRDWGSL 896          
BLAST of Sorting nexin-13 vs. Planmine SMEST
Match: SMESG000002662.1 (SMESG000002662.1)

HSP 1 Score: 1698.33 bits (4397), Expect = 0.000e+0
Identity = 862/865 (99.65%), Postives = 864/865 (99.88%), Query Frame = 1
Query:  205 MKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHXXXXXXXXXXDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPXXXXXXXXXXXXXXXXXXXXXITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVVRRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQYKLCPAANGKVCNKHNLNAPEWRDWGSL 2799
            MKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHEEFFSLESEFDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPKSKEEDSLSLGKSLSSTKLSSITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNN+ITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQV RRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRL+HSILQLVAQKIFPGHNFDKLLQYKLCPAANGKVCNKHNLNAPEWRDWGSL
Sbjct:    1 MKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILRDYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPNELRSHIRLYRLSNQHCRRNKDKDLHEEFFSLESEFDKDYCRQKICTDPTAEKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDPDFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRSKDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPKSKEEDSLSLGKSLSSTKLSSITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLKLNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLLTEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEESDELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKNNNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNMITNQCGKIAQLRLPSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQREWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNSYSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVARRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWPNGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQRVFDLFQDQVLNKRLAHSILQLVAQKIFPGHNFDKLLQYKLCPAANGKVCNKHNLNAPEWRDWGSL 865          
The following BLAST results are available for this feature:
BLAST of Sorting nexin-13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX131.975e-11528.90sorting nexin 13 [Source:HGNC Symbol;Acc:HGNC:2133... [more]
SNX131.372e-9728.21sorting nexin 13 [Source:HGNC Symbol;Acc:HGNC:2133... [more]
SNX254.107e-1422.68sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:2188... [more]
SNX254.107e-1422.68sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:2188... [more]
SNX256.160e-1422.68sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:2188... [more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx-137.805e-10026.92Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
snx-137.805e-10026.92Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
snx-133.952e-6126.70Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
snx-133.952e-6126.70Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
snx-133.262e-4826.95Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snz5.000e-1220.92gene:FBgn0029976 transcript:FBtr0071092[more]
snz5.000e-1220.92gene:FBgn0029976 transcript:FBtr0340148[more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx133.343e-12229.41sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-... [more]
snx137.288e-4036.93sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-... [more]
snx255.036e-1623.30sorting nexin 25 [Source:ZFIN;Acc:ZDB-GENE-121105-... [more]
snx251.517e-1528.07sorting nexin 25 [Source:ZFIN;Acc:ZDB-GENE-121105-... [more]
snx141.201e-722.12sorting nexin 14 [Source:NCBI gene;Acc:555970][more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX139.057e-11629.30sorting nexin 13 [Source:NCBI gene;Acc:100495358][more]
SNX135.827e-11529.08sorting nexin 13 [Source:NCBI gene;Acc:100495358][more]
SNX136.838e-11529.08sorting nexin 13 [Source:NCBI gene;Acc:100495358][more]
SNX132.568e-5729.45sorting nexin 13 [Source:NCBI gene;Acc:100495358][more]
SNX131.565e-5428.65sorting nexin 13 [Source:NCBI gene;Acc:100495358][more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx134.775e-11728.99sorting nexin 13 [Source:MGI Symbol;Acc:MGI:266141... [more]
Snx132.206e-7428.59sorting nexin 13 [Source:MGI Symbol;Acc:MGI:266141... [more]
Snx254.249e-1424.02sorting nexin 25 [Source:MGI Symbol;Acc:MGI:214261... [more]
Snx254.249e-1424.02sorting nexin 25 [Source:MGI Symbol;Acc:MGI:214261... [more]
Snx256.973e-1329.80sorting nexin 25 [Source:MGI Symbol;Acc:MGI:214261... [more]
back to top
BLAST of Sorting nexin-13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PHS6|SNX13_MOUSE3.040e-11629.10Sorting nexin-13 OS=Mus musculus OX=10090 GN=Snx13... [more]
sp|Q9Y5W8|SNX13_HUMAN1.668e-11228.76Sorting nexin-13 OS=Homo sapiens OX=9606 GN=SNX13 ... [more]
sp|Q9H3E2|SNX25_HUMAN1.972e-1322.68Sorting nexin-25 OS=Homo sapiens OX=9606 GN=SNX25 ... [more]
sp|Q3ZT31|SNX25_MOUSE2.972e-1324.02Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25... [more]
sp|Q8BHY8|SNX14_MOUSE8.604e-823.67Sorting nexin-14 OS=Mus musculus OX=10090 GN=Snx14... [more]
back to top
BLAST of Sorting nexin-13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y4Y56.170e-14731.57Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A433TXW91.156e-13432.20Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
R7TMT31.500e-13330.40Uncharacterized protein OS=Capitella teleta OX=283... [more]
K1RAM81.205e-13031.24Sorting nexin-13 OS=Crassostrea gigas OX=29159 GN=... [more]
L7MIL05.550e-13030.52Putative sorting nexin 13 (Fragment) OS=Rhipicepha... [more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx134.595e-12329.50sorting nexin 13 [Source:NCBI gene;Acc:103042544][more]
snx139.971e-12329.50sorting nexin 13 [Source:NCBI gene;Acc:103042544][more]
snx254.363e-1323.47sorting nexin 25 [Source:NCBI gene;Acc:103034035][more]
snx258.654e-1323.91sorting nexin 25 [Source:NCBI gene;Acc:103034035][more]
snx19b1.857e-722.40sorting nexin-19 [Source:NCBI gene;Acc:103036172][more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snx131.363e-5927.30sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-... [more]
snx137.242e-5428.71sorting nexin 13 [Source:ZFIN;Acc:ZDB-GENE-050306-... [more]
ENSPMAT00000009451.14.123e-1739.13pep scaffold:Pmarinus_7.0:GL485623:4095:4978:-1 ge... [more]
snx141.142e-624.46sorting nexin 14 [Source:NCBI gene;Acc:555970][more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin-13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO376221.733e-11629.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379873.748e-1725.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin-13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx133.997e-12731.00sorting nexin 13 [Source:NCBI gene;Acc:101168131][more]
snx131.174e-12331.10sorting nexin 13 [Source:NCBI gene;Acc:101168131][more]
snx136.438e-7929.90sorting nexin 13 [Source:NCBI gene;Acc:101168131][more]
snx256.020e-1723.87sorting nexin 25 [Source:NCBI gene;Acc:101155361][more]
snx253.760e-1524.66sorting nexin 25 [Source:NCBI gene;Acc:101155361][more]
back to top
BLAST of Sorting nexin-13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000002662.10.000e+099.43SMESG000002662.1[more]
SMESG000002662.10.000e+099.65SMESG000002662.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003796 ID=SMED30003796|Name=Sorting nexin-13|organism=Schmidtea mediterranea sexual|type=transcript|length=2925bp
TTAAAAATTGTATTATTTTTAAATTTAGTAATAATGTTCATAAAATAATA
TTTAATGGAAAAATTATTTTCATTTTTAATTTTATTTGTATCTCTATTAA
TATTTTATAATTTTGGAATCGTTAATTTAATATACTTTATAATTTCACTA
TCAGCATTTTTATATGGACTCCTATTTTTCGATCCAATTTCATTGCCATA
TTTCATGAAAAGTTACAAATGTCAAATATCAAAAGGATTGTTAAAAATTG
TGCAAGGTATGAAAGAATCTGATAAACCACCATTAGAGAGTGATATATCA
GGCGCACCAAATTTAGATAAAGCCTTTGTAGAAGTTATAGATTTGATTTT
AAGGGATTACATTGACATTTGGTACAAGCACATTTCTTTGAGTAATAATT
TTACATATGAAGTTCGTCAATCAATGTATAAAATTTTGAAAAATTTTTCC
ATAAGATGTAGAAATGTGGATTGGATATCTGTGATTACAGAAGATTTACC
GAATGAATTAAGATCACACATACGATTATATCGACTAAGTAATCAGCATT
GTCGTCGAAACAAAGATAAAGATTTACACGAGGAATTTTTCAGCTTGGAA
TCGGAATTCGATAAGGATTATTGTCGACAAAAGATTTGCACAGATCCAAC
AGCAGAGAAAGACTATTTGAGCAGTGTTTCAGAATTCATTTTGTACATCG
TGACAAGTTCTGAGGAATTTAATGTTCCCCCTCTGCGATACTTTTTAAGG
GAAATATTAGTTAATGCTATTTTACTGCCTACTATCAATATGGTGACAGA
TCCTGATTTCATCAACCAATACATTGTATGGATGTGTAAGGACAACTCAT
ATACGAGTGAGTATTTCATCCAAGCAATACGAATGTCAGATAATCCAGAT
GAAATAAAGTCTGTCTTGGAGAAACTAGATATGTTCACCAGTCGTCTTCG
CAGTAAGGACAGTGGGGGCGATGACGATGCGTTGATAAAGGCTCAAATCA
GTAGCATTGAATTCGTGCGGAAAGTTTGTCAGTCTCGAATCAATAAGCTA
GCTGAACCGAAATCTAAAGAAGAAGATAGTTTGTCCCTAGGAAAGTCATT
ATCTTCCACCAAGTTGTCTTCTATAACTCTGGAATATATTTTGGATCAGG
AAATTGGCATCAGTTTATTTTTGGAATTCCTCACGTCTATCAATGCCCAG
AATTATATGACGATCTATCTCAACATTATCCAGTTTCGGTCCAATTATCT
TAAATTGAACGAATATGACATTTTCGGTTTCGATGACCGACTAGAAAAAT
CCGTTGATCGAGAATTTTATCGCATTACAACAGACCAACTCGTAGATTAT
GCGCAGAAAATTCTGAAAGATGCTCGCGATATGAAGATGTCAGAGAGATT
ATTAACGGAAATTGAAATGAGAATCTCATCGAATGATATAACCGAGAGCT
TATTCGATGATGTTTTGAAACAATTGCTAGATATGTTACATGAAAAGCAA
TTTTTTGACGCTTTTAAGCAAAGTAATTATTTCCGTCAGTTTTTTGAAGA
AAGCGATGAATTGCGAGATGATAGCCTGATTTCGGAGGAAGAAGCCATCG
ATGCTTGTCTTATCGAAAATGAATTGATGTCACCTTGTGTGAATACTTCA
AATTCAGACTCGGACTTATACACAGTGAGAATTGTTGATGCCGTGGTAAA
GAACAATAATTACGTTCTCTATACTTTGGTCATTATCAAAACTGACAAAT
ATGGCAACAAAGAAACCTGGAAAACTCAACGACGATATCGAGATTTTGAT
TCAATGAATAATATAATAACGAATCAATGTGGCAAAATAGCTCAGTTGCG
ACTTCCATCTAAAAAGCCATTTAATAATATGGCAAATGATTTCCTTGAAA
AACGTAGTTTGGAACTTCAAGAATATTTAACAGAATGTTTCAAACCTAAA
TTATTACAAACGTATCCTAAGCTACGAGAAATAGCGACAAACTTTGTCCA
GCGAGAATGGGATAATCGCCAGCCCCTGAATCGAATTCAGTCTATTGTAA
ACCCTATCAAATCAATGTTGTGGATGCAAGAAAATGTTGTGGGCAATTTT
AAACAGATGTATTCATCCATATCTCCAACGAAAAAGTTGAATTCTCAGAA
TTCTTATTCCGGTAGTATATTCTCCTCGGATCAACTAGATTATTCTAAAC
TCGGTAATGACAGTGACCAAAATAAAACAGAAAATATTCCATTTCGAATT
CTATTTTTACTTGTCGATGAAATATTCGATTTACAAAGTAAGAGTCAAGT
TGTCAGAAGAGGAATTCTAGCAATTCTTCGTCGTATAGTCAAAGCTTTCT
TTGGAATAAAAGTTAACAAAATAATATTAGAAAAGGCGGCAAAATCAACT
TCTTCGGATCAAATAGCAGAACTAGTGCAGAAATTTAAAGATTCTTGGTG
GCCAAATGGAAAGCTGGCTAACTCAAATAAGCCAAGAGATGAAATGACAA
AGTTGCGTACATGTTTACTTTGCCGAACTAAGATGCTAGGTAGCATATCA
GACGAAGTAAGTCAGTTTCTAGGAAACGAAACTACAAGACAAGGAGTACA
GAGAGTATTTGATTTATTCCAGGATCAGGTCCTAAATAAAAGACTTTCTC
ACAGTATCCTACAATTAGTCGCACAAAAAATATTCCCTGGCCATAATTTC
GATAAATTACTGCAATATAAATTGTGCCCAGCTGCAAACGGCAAAGTTTG
CAACAAACACAACCTTAATGCTCCCGAATGGAGAGATTGGGGTTCTTTAT
AAAAGACAGATTTGTAATTTCAGCTTTTTTATGATAATTTCGATTATGGT
GATTCGAATTTTAATTAAAATTTCCATTTTTATTGCAAACTTTTATTCAA
ATAAATATAACAGAAAATAACTAAT
back to top

protein sequence of SMED30003796-orf-1

>SMED30003796-orf-1 ID=SMED30003796-orf-1|Name=SMED30003796-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=916bp
MEKLFSFLILFVSLLIFYNFGIVNLIYFIISLSAFLYGLLFFDPISLPYF
MKSYKCQISKGLLKIVQGMKESDKPPLESDISGAPNLDKAFVEVIDLILR
DYIDIWYKHISLSNNFTYEVRQSMYKILKNFSIRCRNVDWISVITEDLPN
ELRSHIRLYRLSNQHCRRNKDKDLHEEFFSLESEFDKDYCRQKICTDPTA
EKDYLSSVSEFILYIVTSSEEFNVPPLRYFLREILVNAILLPTINMVTDP
DFINQYIVWMCKDNSYTSEYFIQAIRMSDNPDEIKSVLEKLDMFTSRLRS
KDSGGDDDALIKAQISSIEFVRKVCQSRINKLAEPKSKEEDSLSLGKSLS
STKLSSITLEYILDQEIGISLFLEFLTSINAQNYMTIYLNIIQFRSNYLK
LNEYDIFGFDDRLEKSVDREFYRITTDQLVDYAQKILKDARDMKMSERLL
TEIEMRISSNDITESLFDDVLKQLLDMLHEKQFFDAFKQSNYFRQFFEES
DELRDDSLISEEEAIDACLIENELMSPCVNTSNSDSDLYTVRIVDAVVKN
NNYVLYTLVIIKTDKYGNKETWKTQRRYRDFDSMNNIITNQCGKIAQLRL
PSKKPFNNMANDFLEKRSLELQEYLTECFKPKLLQTYPKLREIATNFVQR
EWDNRQPLNRIQSIVNPIKSMLWMQENVVGNFKQMYSSISPTKKLNSQNS
YSGSIFSSDQLDYSKLGNDSDQNKTENIPFRILFLLVDEIFDLQSKSQVV
RRGILAILRRIVKAFFGIKVNKIILEKAAKSTSSDQIAELVQKFKDSWWP
NGKLANSNKPRDEMTKLRTCLLCRTKMLGSISDEVSQFLGNETTRQGVQR
VFDLFQDQVLNKRLSHSILQLVAQKIFPGHNFDKLLQYKLCPAANGKVCN
KHNLNAPEWRDWGSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR036305RGS_sf
IPR016137RGS
IPR001683Phox
IPR003114Phox_assoc
IPR013937Sorting_nexin_C
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 536..651
e-value: 1.9E-7
score: 40.7
IPR001683Phox homologous domainPFAMPF00787PXcoord: 539..641
e-value: 4.3E-13
score: 49.2
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 534..654
score: 12.333
IPR016137RGS domainSMARTSM00315RGS_3coord: 358..497
e-value: 0.0072
score: 17.8
IPR016137RGS domainPFAMPF00615RGScoord: 359..496
e-value: 8.4E-6
score: 26.1
IPR016137RGS domainPROSITEPS50132RGScoord: 358..496
score: 14.558
IPR003114Phox-associated domainSMARTSM00313PXA_3coord: 84..265
e-value: 7.4E-33
score: 125.1
IPR003114Phox-associated domainPFAMPF02194PXAcoord: 85..260
e-value: 1.5E-45
score: 155.4
IPR003114Phox-associated domainPROSITEPS51207PXAcoord: 84..265
score: 51.676
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 533..656
e-value: 4.2E-19
score: 70.6
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 537..640
NoneNo IPR availableGENE3DG3DSA:1.20.58.1850coord: 333..502
e-value: 7.0E-8
score: 34.2
NoneNo IPR availablePANTHERPTHR22775SORTING NEXINcoord: 13..883
NoneNo IPR availablePANTHERPTHR22775:SF3SORTING NEXIN-13coord: 13..883
NoneNo IPR availableTMHMMTMhelixcoord: 7..41
IPR013937Sorting nexin, C-terminalPFAMPF08628Nexin_Ccoord: 751..858
e-value: 5.5E-21
score: 75.2
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 353..498