Glycerate kinase

Overview
NameGlycerate kinase
Smed IDSMED30003793
Length (bp)1628
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycerate kinase (SMED30003793) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycerate kinase (SMED30003793) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycerate kinase (SMED30003793) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycerate kinase (SMED30003793) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003793

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003793SMESG000044626.1 SMESG000044616.1 SMESG000044604.1 Contig3163newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003793SMESG000044626.1 SMESG000044616.1 SMESG000044604.1 Contig3163uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003793SMESG000049007.1 Contig3163newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003793SMESG000049007.1 Contig3163uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycerate kinase vs. Ensembl Human
Match: GLYCTK (glycerate kinase [Source:HGNC Symbol;Acc:HGNC:24247])

HSP 1 Score: 233.802 bits (595), Expect = 1.925e-69
Identity = 155/490 (31.63%), Postives = 246/490 (50.20%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLL-----TSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS---SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQL----LEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMD 1535
            ++LF + + +V P  ++H            K+ + +  +  N+Y+VGFGKA LG      +LL     + + SVP        +R  + +  ++ +LL       ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    ++SLILSDV+GD + +IASGPTV   +     L I+++Y  L    P  +K + S   S P+    +  +V N +IG+N +AL     +AE     +  +LS  + GD +  +                 +    +E    L+  A +L    L L   LE  A       +CLL GGE  V L+    +G GGR   +AL +   L    L    +  L G +DG DG T+ +GA +  ++ S +  + +D   +LA+ DS+ FF     G + L TGMTGTNVMD
Sbjct:   39 RQLFESAVGAVLPGPMLHRALSLDPGGRQLKVRDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKG------IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYG-LRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNVLALAEAQRQAEAL-GYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGP--VCLLAGGEPTVQLQG---SGRGGRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMD 514          
BLAST of Glycerate kinase vs. Ensembl Human
Match: GLYCTK (glycerate kinase [Source:HGNC Symbol;Acc:HGNC:24247])

HSP 1 Score: 128.642 bits (322), Expect = 2.186e-33
Identity = 75/204 (36.76%), Postives = 120/204 (58.82%), Query Frame = 3
Query:  402 IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS--SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDG 1007
            ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    ++SLILSDV+GD + +IASGPTV   +     L I+++Y L   +  +V  +L    S P+    +  +V N +IG+N +AL     +AE     +  +LS  + G
Sbjct:   11 VFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNVLALAEAQRQAEAL-GYQAVVLSAAMQG 212          
BLAST of Glycerate kinase vs. Ensembl Human
Match: GLYCTK (glycerate kinase [Source:HGNC Symbol;Acc:HGNC:24247])

HSP 1 Score: 129.413 bits (324), Expect = 3.866e-33
Identity = 75/204 (36.76%), Postives = 120/204 (58.82%), Query Frame = 3
Query:  402 IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS--SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDG 1007
            ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    ++SLILSDV+GD + +IASGPTV   +     L I+++Y L   +  +V  +L    S P+    +  +V N +IG+N +AL     +AE     +  +LS  + G
Sbjct:   54 VFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNVLALAEAQRQAEAL-GYQAVVLSAAMQG 255          
BLAST of Glycerate kinase vs. Ensembl Human
Match: GLYCTK (glycerate kinase [Source:HGNC Symbol;Acc:HGNC:24247])

HSP 1 Score: 69.3218 bits (168), Expect = 7.914e-13
Identity = 40/159 (25.16%), Postives = 79/159 (49.69%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLL-----TSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADIT 563
            ++LF + + +V P  ++H            K+ + +  +  N+Y+VGFGKA LG      +LL     + + SVP        +R  + +  ++ +LL       ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+  G  L C+P + ++
Sbjct:   39 RQLFESAVGAVLPGPMLHRALSLDPGGRQLKVRDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKG------IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISEVGVQLCCLPPSHLS 191          
BLAST of Glycerate kinase vs. Ensembl Human
Match: GLYCTK (glycerate kinase [Source:HGNC Symbol;Acc:HGNC:24247])

HSP 1 Score: 66.2402 bits (160), Expect = 7.707e-12
Identity = 38/148 (25.68%), Postives = 74/148 (50.00%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLL-----TSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGS 530
            ++LF + + +V P  ++H            K+ + +  +  N+Y+VGFGKA LG      +LL     + + SVP        +R  + +  ++ +LL       ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+G G+
Sbjct:   39 RQLFESAVGAVLPGPMLHRALSLDPGGRQLKVRDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKG------IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGWGT 180          
BLAST of Glycerate kinase vs. Ensembl Celegans
Match: C13B9.2 (pep chromosome:WBcel235:III:6620254:6622265:1 gene:WBGene00015733.1 transcript:C13B9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C13B9.2)

HSP 1 Score: 162.155 bits (409), Expect = 6.790e-44
Identity = 143/504 (28.37%), Postives = 243/504 (48.21%), Query Frame = 3
Query:   93 MNTNVILKKLFNAGIESVKPVTLIHNVFQNNH--FKLGNTDVTVSDNVYIV--GFGKAALGFLNPLYKLLKSKF-RRAIFSVPMHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSL-IVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKY---NLLHKVSPNVIKL-------LKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGA-SDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            M T   ++  F   + +V+P +++ N    N    K+ + + ++S++  IV   FGKA++         LKS   ++ I   P   +           +  EL   T I YG+R N+P+ +++ A+ ++   ++  +   ++ + +I+GGGSALL  P A + + + +E   ++   GA+I ELNT+R  +  +KGG L R  K    I+LI+SDVIG+ + +IASGPTV        P    DK+   N+L  +  N ++L       L++ +     ++     N++I +N  AL A + E    +   + I++++L G++                       EI +    +AE +   S+  ++LL+     I    I LL GGE  V+L +    G GGR   M L+  CL        +       A +DG DG TD +GAII  +    + + N  S  +L N DSYNF+++F  G   + TG +GTNVMD  I+++
Sbjct:    1 MATRKAVRTAFEKCLLAVEPRSIVRNAISLNPSLLKIADYNYSLSNSTKIVVIAFGKASILMAKGARDQLKSSLLQKTIVIAPEQQKG----------IENELENDTEILYGARDNLPDEKSVFATRKVISEIRDFDSESTIFLFLISGGGSALLTSPSAPLDLAEKLETIRIMQAHGATIQELNTIRQNLSDVKGGKLLREIKKGCSIALIISDVIGNPVELIASGPTV-------IPAHQQDKFIISNILESLKINKLELPVNVKNVLENHEKEQLPENTSRFQNFIISSNNFALRA-AAEYLTSSGYNSTIVTSSLSGNAA----------------------EIGKK---FAEIITEKSITSSHLLKNSNLTIENYPIALLFGGETTVHLSE--NPGKGGRNQEMVLS--CLDALKTRVPAHNFTFLSAGTDGQDGPTDAAGAIISNEDLPLNSLLN--SSEFLQNSDSYNFWRQFKGGANHILTGPSGTNVMDIQILLL 455          
BLAST of Glycerate kinase vs. Ensembl Fly
Match: CG9886 (gene:FBgn0031428 transcript:FBtr0335462)

HSP 1 Score: 192.971 bits (489), Expect = 6.500e-55
Identity = 139/448 (31.03%), Postives = 229/448 (51.12%), Query Frame = 3
Query:  231 YIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRN-IISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGA-----IIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIP 1556
            +IVGFGKA LG  N + + L +     + SVP++T         L Q  + +     ++ G+ +N+P+   LKA+ EI  L + +   D L V I+GGGSALL +P + +T+ D   +++ L K GASI E+N VR     +KGG LAR A     +++ +LSD+IGD + +IA GPT+ +     SP DI+ K+++  ++SP + ++ +  +      S+     +V+G+N IA +  + EAE    +   +LS  + GD    + +  R L  +    Q+ +L+ +       EK  F              +++      LI G  PV   K S  G+GGR  H+AL ++  L           +  G +DG+DG TD +GA     ++ + +  H+  +  ++   L N DSYNF+K    G++ + TG TGTNVMD   +++P
Sbjct:   63 HIVGFGKAVLGMANKVQQDLGATSAGGVLSVPVNT---------LKQFQQPVAPGLVVHEGAANNLPDENALKAAREIKQLAEKMTAQDILFVFISGGGSALLPLPRSPLTLEDKRSIADKLMKRGASIQEINAVRIACSDIKGGRLARLAGQAGLLVTFVLSDIIGDPLELIACGPTI-QPEAAASPSDILKKHHVWEELSPEIRRVFEQPEEQKNT-SLPEHKVFVVGSNVIATSTAAHEAERLGYIPC-VLSCAVQGDVAQVAGDYQRLLHGIQEAKQHGILDPQ-----LREKYAFGERSYPTFRRALEDHMSSKKPLFLICGGEPV--IKVSGHGLGGRSQHLALLMSQALHRDEAMRDCTFLSAG-TDGIDGPTDAAGAFGDSSVVESYLGDHTLDELAET---LRNCDSYNFYKNLAQGEHHVLTGHTGTNVMDLHFLVVP 487          
BLAST of Glycerate kinase vs. Ensembl Fly
Match: CG9886 (gene:FBgn0031428 transcript:FBtr0077770)

HSP 1 Score: 192.971 bits (489), Expect = 6.500e-55
Identity = 139/448 (31.03%), Postives = 229/448 (51.12%), Query Frame = 3
Query:  231 YIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRN-IISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGA-----IIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIP 1556
            +IVGFGKA LG  N + + L +     + SVP++T         L Q  + +     ++ G+ +N+P+   LKA+ EI  L + +   D L V I+GGGSALL +P + +T+ D   +++ L K GASI E+N VR     +KGG LAR A     +++ +LSD+IGD + +IA GPT+ +     SP DI+ K+++  ++SP + ++ +  +      S+     +V+G+N IA +  + EAE    +   +LS  + GD    + +  R L  +    Q+ +L+ +       EK  F              +++      LI G  PV   K S  G+GGR  H+AL ++  L           +  G +DG+DG TD +GA     ++ + +  H+  +  ++   L N DSYNF+K    G++ + TG TGTNVMD   +++P
Sbjct:   63 HIVGFGKAVLGMANKVQQDLGATSAGGVLSVPVNT---------LKQFQQPVAPGLVVHEGAANNLPDENALKAAREIKQLAEKMTAQDILFVFISGGGSALLPLPRSPLTLEDKRSIADKLMKRGASIQEINAVRIACSDIKGGRLARLAGQAGLLVTFVLSDIIGDPLELIACGPTI-QPEAAASPSDILKKHHVWEELSPEIRRVFEQPEEQKNT-SLPEHKVFVVGSNVIATSTAAHEAERLGYIPC-VLSCAVQGDVAQVAGDYQRLLHGIQEAKQHGILDPQ-----LREKYAFGERSYPTFRRALEDHMSSKKPLFLICGGEPV--IKVSGHGLGGRSQHLALLMSQALHRDEAMRDCTFLSAG-TDGIDGPTDAAGAFGDSSVVESYLGDHTLDELAET---LRNCDSYNFYKNLAQGEHHVLTGHTGTNVMDLHFLVVP 487          
BLAST of Glycerate kinase vs. Ensembl Zebrafish
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:570678])

HSP 1 Score: 239.965 bits (611), Expect = 4.852e-72
Identity = 167/522 (31.99%), Postives = 271/522 (51.92%), Query Frame = 3
Query:   69 FISMSKLTMNT-NVILKKLFNAGIESVKPVTLIHNVFQNNHFKL--GNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS-----IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLD---IIDKYNLLHKVSPNVIKLL------KSSKPNNTIQSI-DNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCAT-NI-------NYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIP 1556
              S+S  +M++ N   + +F+A +E V P  ++    + +  KL  G    T+++N+Y+VGFGKA LG      +++     + + SVP   ++       L    +E +LL S     +  G++ N+P+++  K++  I  L  SL   D L+V+I+GGGSALL  P   +++ +  +V+  L+ +GA+I ELNTVR  + LLKGGGLA+ A    +++L+LSDVIGD + +IASGPTV     D SP +   I+D Y L   +  +V ++L      + S+  N  Q + DNV N VIG+N IAL   S +A ++  L+  ILS  + GD    +              +    E+   +     ++  +S       +LC T N+        +   CLL GGE  V L   S  G GGR   +A+ +   L    + +  + +  G +DG DG T+ +GA+   ++   +  Q +D+  +LAN DS+ FF K   G+  L  G+TGTNVMD  ++++P
Sbjct:   21 LASVSARSMSSLNTRARAVFSAAVEGVHPDMVVRRGLERHGDKLHVGGQSFTLTNNLYLVGFGKAVLGMAAEAERIVGDHLIKGVVSVPHGIQN------TLRSHGKEKMLLESNSRITVMEGAKHNLPDTDAQKSAECIRDLASSLTEKDLLLVLISGGGSALLPAPAPPMSLQEKQDVTRKLAAAGATIQELNTVRRALSLLKGGGLAQCASPAKVVALVLSDVIGDPLDLIASGPTVRS---DSSPEEVWAILDNYKLSDSLPSSVKEVLSKSMSGQGSRVKNQPQEVKDNVLNVVIGSNTIALECASRKA-SELGLRPVILSPGVCGDVRSVARLYGLLSSFACSPGKEPPPELAAEILKLGPEVGIES------WDLCRTMNVLVGERKEGWGATCLLAGGEPTVKL---SGKGRGGRNQELAMRVGLELSQGEVKSGAVFLS-GGTDGQDGPTEAAGAVADGELKEEAASQGLDTDSFLANNDSFTFFSKLSEGRRLLNPGLTGTNVMDVHVMLLP 522          
BLAST of Glycerate kinase vs. Ensembl Zebrafish
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:570678])

HSP 1 Score: 239.965 bits (611), Expect = 4.852e-72
Identity = 167/522 (31.99%), Postives = 271/522 (51.92%), Query Frame = 3
Query:   69 FISMSKLTMNT-NVILKKLFNAGIESVKPVTLIHNVFQNNHFKL--GNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS-----IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLD---IIDKYNLLHKVSPNVIKLL------KSSKPNNTIQSI-DNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCAT-NI-------NYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIP 1556
              S+S  +M++ N   + +F+A +E V P  ++    + +  KL  G    T+++N+Y+VGFGKA LG      +++     + + SVP   ++       L    +E +LL S     +  G++ N+P+++  K++  I  L  SL   D L+V+I+GGGSALL  P   +++ +  +V+  L+ +GA+I ELNTVR  + LLKGGGLA+ A    +++L+LSDVIGD + +IASGPTV     D SP +   I+D Y L   +  +V ++L      + S+  N  Q + DNV N VIG+N IAL   S +A ++  L+  ILS  + GD    +              +    E+   +     ++  +S       +LC T N+        +   CLL GGE  V L   S  G GGR   +A+ +   L    + +  + +  G +DG DG T+ +GA+   ++   +  Q +D+  +LAN DS+ FF K   G+  L  G+TGTNVMD  ++++P
Sbjct:   21 LASVSARSMSSLNTRARAVFSAAVEGVHPDMVVRRGLERHGDKLHVGGQSFTLTNNLYLVGFGKAVLGMAAEAERIVGDHLIKGVVSVPHGIQN------TLRSHGKEKMLLESNSRITVMEGAKHNLPDTDAQKSAECIRDLASSLTEKDLLLVLISGGGSALLPAPAPPMSLQEKQDVTRKLAAAGATIQELNTVRRALSLLKGGGLAQCASPAKVVALVLSDVIGDPLDLIASGPTVRS---DSSPEEVWAILDNYKLSDSLPSSVKEVLSKSMSGQGSRVKNQPQEVKDNVLNVVIGSNTIALECASRKA-SELGLRPVILSPGVCGDVRSVARLYGLLSSFACSPGKEPPPELAAEILKLGPEVGIES------WDLCRTMNVLVGERKEGWGATCLLAGGEPTVKL---SGKGRGGRNQELAMRVGLELSQGEVKSGAVFLS-GGTDGQDGPTEAAGAVADGELKEEAASQGLDTDSFLANNDSFTFFSKLSEGRRLLNPGLTGTNVMDVHVMLLP 522          
BLAST of Glycerate kinase vs. Ensembl Zebrafish
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:570678])

HSP 1 Score: 145.591 bits (366), Expect = 1.652e-39
Identity = 89/249 (35.74%), Postives = 144/249 (57.83%), Query Frame = 3
Query:   69 FISMSKLTMNT-NVILKKLFNAGIESVKPVTLIHNVFQNNHFKL--GNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS-----IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSP 791
              S+S  +M++ N   + +F+A +E V P  ++    + +  KL  G    T+++N+Y+VGFGKA LG      +++     + + SVP   ++ L          +E +LL S     +  G++ N+P+++  K++  I  L  SL   D L+V+I+GGGSALL  P   +++ +  +V+  L+ +GA+I ELNTVR  + LLKGGGLA+ A    +++L+LSDVIGD + +IASGPTV     D SP
Sbjct:   21 LASVSARSMSSLNTRARAVFSAAVEGVHPDMVVRRGLERHGDKLHVGGQSFTLTNNLYLVGFGKAVLGMAAEAERIVGDHLIKGVVSVPHGIQNTL------RSHGKEKMLLESNSRITVMEGAKHNLPDTDAQKSAECIRDLASSLTEKDLLLVLISGGGSALLPAPAPPMSLQEKQDVTRKLAAAGATIQELNTVRRALSLLKGGGLAQCASPAKVVALVLSDVIGDPLDLIASGPTVRS---DSSP 260          
BLAST of Glycerate kinase vs. Ensembl Zebrafish
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:570678])

HSP 1 Score: 113.62 bits (283), Expect = 3.031e-28
Identity = 71/213 (33.33%), Postives = 120/213 (56.34%), Query Frame = 3
Query:   69 FISMSKLTMNT-NVILKKLFNAGIESVKPVTLIHNVFQNNHFKL--GNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS-----IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFA 683
              S+S  +M++ N   + +F+A +E V P  ++    + +  KL  G    T+++N+Y+VGFGKA LG      +++     + + SVP   ++       L    +E +LL S     +  G++ N+P+++  K++  I  L  SL   D L+V+I+GGGSALL  P   +++ +  +V+  L+ +GA+I ELNTVR  + LLKGGGLA+ A
Sbjct:   21 LASVSARSMSSLNTRARAVFSAAVEGVHPDMVVRRGLERHGDKLHVGGQSFTLTNNLYLVGFGKAVLGMAAEAERIVGDHLIKGVVSVPHGIQN------TLRSHGKEKMLLESNSRITVMEGAKHNLPDTDAQKSAECIRDLASSLTEKDLLLVLISGGGSALLPAPAPPMSLQEKQDVTRKLAAAGATIQELNTVRRALSLLKGGGLAQCA 227          
BLAST of Glycerate kinase vs. Ensembl Zebrafish
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:570678])

HSP 1 Score: 51.9878 bits (123), Expect = 1.526e-7
Identity = 35/135 (25.93%), Postives = 70/135 (51.85%), Query Frame = 3
Query:   75 SMSKLTMNT-NVILKKLFNAGIESVKPVTLIHNVFQNNHFKL--GNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS-----IYYGSRSNVPNSETLKAS 455
            S+S  +M++ N   + +F+A +E V P  ++    + +  KL  G    T+++N+Y+VGFGKA LG      +++     + + SVP   ++       L    +E +LL S     +  G++ N+P+++  K++
Sbjct:   23 SVSARSMSSLNTRARAVFSAAVEGVHPDMVVRRGLERHGDKLHVGGQSFTLTNNLYLVGFGKAVLGMAAEAERIVGDHLIKGVVSVPHGIQN------TLRSHGKEKMLLESNSRITVMEGAKHNLPDTDAQKSA 151          
BLAST of Glycerate kinase vs. Ensembl Xenopus
Match: mtmr7 (myotubularin related protein 7 [Source:Xenbase;Acc:XB-GENE-1008662])

HSP 1 Score: 65.0846 bits (157), Expect = 5.916e-12
Identity = 42/155 (27.10%), Postives = 76/155 (49.03%), Query Frame = 3
Query:   93 MNTNVILKKLFNAGIESVKPVTLI-HNVFQNNH-----FKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLT-----SIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGG 524
            M+     K++F   + +V P  ++  NV   ++      + G  ++ + +N+Y+VGFGKA LG    + K++     R + S+P   E        L Q  +  +LL+      +  G+  N+P+   L+A+ EI  L + L   D L+V+I+GG
Sbjct:    2 MSLQTDAKQIFWKAVSAVLPPNMLGRNVAVKDNGDASVLQCGGKELPLHNNLYLVGFGKAVLGMAAAVEKIVGKHLLRGVISIPRGMEE------TLKQAGKREMLLSPDSRIRVMEGAEHNMPDKAALEAAREIQSLAEKLTEQDILLVLISGG 150          
BLAST of Glycerate kinase vs. Ensembl Mouse
Match: Glyctk (glycerate kinase [Source:MGI Symbol;Acc:MGI:2444085])

HSP 1 Score: 234.187 bits (596), Expect = 8.690e-70
Identity = 162/497 (32.60%), Postives = 252/497 (50.70%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLT-----SIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS---SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQL----LEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDG-ICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            ++LF++ + +V+P  ++             K+ +    + +N+Y+VGFGKA LG      +LL     + + SVP        +R  +    ++ +LL       ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    +ISLILSDVIGD + +IASGPTV   +     L I++ Y  L    P  +K + S   S P+    +  +V N +IG+N +AL     +AE        +LST + GD +  +            +    L    LE    L+  A +L    L L   LE     +   G +CLL GGE  V L+    +G GGR   +AL +   L    L    +  L G +DG DG T  +GA + + + S +  +++D    LAN DSY FF +F  G + L TG+TGTNVMD  ++I+
Sbjct:   39 RQLFDSAVGAVQPGPMLQRTLSLDPSGRQLKVRDRTFQLRENLYLVGFGKAVLGMAAAAEELLAQHLVQGVISVPKG------IRAAMEHAGKKEMLLKPHSRIQVFEGAEDNLPDRDALRAALTIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQMLTKLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVISLILSDVIGDPLEVIASGPTVASTHSVQDCLHILNHYG-LRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNSLALAEAQRQAEVL-GYHAMVLSTAMQGDVKRVARFYGLLARVAAAHLTPSLAERPLEEEAELHQLAAELQLPDLQLEEALEAV---VKAKGPVCLLAGGEPTVQLQG---SGKGGRNQELALHVGVELGRQPLGPIDVLFLSGGTDGQDGPTKVAGAWVMSDLISQASAESLDIATSLANNDSYTFFCRFRGGTHLLHTGLTGTNVMDVHLLIL 520          
BLAST of Glycerate kinase vs. Ensembl Mouse
Match: Glyctk (glycerate kinase [Source:MGI Symbol;Acc:MGI:2444085])

HSP 1 Score: 234.187 bits (596), Expect = 8.690e-70
Identity = 162/497 (32.60%), Postives = 252/497 (50.70%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLT-----SIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS---SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQL----LEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDG-ICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            ++LF++ + +V+P  ++             K+ +    + +N+Y+VGFGKA LG      +LL     + + SVP        +R  +    ++ +LL       ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    +ISLILSDVIGD + +IASGPTV   +     L I++ Y  L    P  +K + S   S P+    +  +V N +IG+N +AL     +AE        +LST + GD +  +            +    L    LE    L+  A +L    L L   LE     +   G +CLL GGE  V L+    +G GGR   +AL +   L    L    +  L G +DG DG T  +GA + + + S +  +++D    LAN DSY FF +F  G + L TG+TGTNVMD  ++I+
Sbjct:   39 RQLFDSAVGAVQPGPMLQRTLSLDPSGRQLKVRDRTFQLRENLYLVGFGKAVLGMAAAAEELLAQHLVQGVISVPKG------IRAAMEHAGKKEMLLKPHSRIQVFEGAEDNLPDRDALRAALTIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQMLTKLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVISLILSDVIGDPLEVIASGPTVASTHSVQDCLHILNHYG-LRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNSLALAEAQRQAEVL-GYHAMVLSTAMQGDVKRVARFYGLLARVAAAHLTPSLAERPLEEEAELHQLAAELQLPDLQLEEALEAV---VKAKGPVCLLAGGEPTVQLQG---SGKGGRNQELALHVGVELGRQPLGPIDVLFLSGGTDGQDGPTKVAGAWVMSDLISQASAESLDIATSLANNDSYTFFCRFRGGTHLLHTGLTGTNVMDVHLLIL 520          
BLAST of Glycerate kinase vs. UniProt/SwissProt
Match: sp|Q0VGK3|GLCTK_RAT (Glycerate kinase OS=Rattus norvegicus OX=10116 GN=Glyctk PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 6.612e-72
Identity = 159/497 (31.99%), Postives = 249/497 (50.10%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVP--------MHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS--SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXX----XXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVI 1550
            ++LF++ + +V+P  ++             K+ +    + +N+Y+VGFGKA LG      +LL     + + SVP        +  + E++L+P              ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    ++SLILSDVIGD + +IASGPTV   +     L I++ Y L   +  +V  +L    S P+    +  +V N +IG+N +AL     +AE        +LST + GD    +             L   +  + LE    L+  A +L    L L   LE  A       +CLL GGE  V L+    +G GGR   +AL +   L    L    +  L G +DG DG T  +GA + + + S +  +N+D   +L N DSY FF  F  G + L TG+TGTNVMD  +++
Sbjct:   39 RQLFDSAVGAVQPGPMLQRTLSLDPSGKQLKVRDRTFQLQENLYLVGFGKAVLGMAAAADELLGQHLVQGVISVPKGIRAAVELAGKQEMLLKPHSH---------IQVFEGAEDNLPDRDALRAAQAIQQLAERLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTKLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVIGDPLEVIASGPTVASTHSVQDCLHILNHYGLRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNSLALAEAQRQAEVL-GYHAMVLSTAMQGDVRRVAQFYGLLARVAAACLTSSTAERPLEEEAKLHQLAAELQLPDLQLEEALEAVAKAKGP--VCLLAGGEPTVQLQG---SGKGGRNQELALRVGAELGKQPLGPVDVLFLSGGTDGQDGPTKVAGAWVMSDLVSQASAENLDFATFLDNNDSYTFFCSFQGGTHLLHTGLTGTNVMDVHLLV 519          
BLAST of Glycerate kinase vs. UniProt/SwissProt
Match: sp|Q08BL7|GLCTK_DANRE (Glycerate kinase OS=Danio rerio OX=7955 GN=glyctk PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.397e-70
Identity = 165/510 (32.35%), Postives = 263/510 (51.57%), Query Frame = 3
Query:  102 NVILKKLFNAGIESVKPVTLIHNVFQNNHFKL--GNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS-----IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLD---IIDKYNLLHKVSPNVIKLL------KSSKPNNTIQSI-DNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCAT-NI-------NYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIP 1556
            N   + +F+A +E V P  ++    + +  KL  G    T+++N+Y+VGFGKA LG      +++     + + SVP   ++       L    +E +LL S     +  G++ N+P+++  K++  I  L  SL   D L+V+I+GGGSALL  P   +++ +  +V+  L+ +GA+I ELNTVR  + LLKGGGLA+ A    +++LILSDVIGD + +IASGPTV     D SP +   I+D Y L   +  +V ++L      + S   N  Q + DNV N VIG+N IAL   S +A ++  L+  ILS  + GD    +              +    E+   +     ++  +S       +LC T N+        +   CLL GGE  V L   S  G GGR   +A+ +   L    + +  + +  G +DG DG T+ +GA+   ++   +  Q +D+  +LAN DS+ FF K   G+  L  G+TGTNVMD  ++++P
Sbjct:    5 NTRARAVFSAAVEGVHPDMVVRRGLERHGDKLHVGGQSFTLTNNLYLVGFGKAVLGMAAEAERIVGDHLIKGVVSVPHGIQN------TLRSHGKEKMLLESNSRITVMEGAKHNLPDTDAQKSAECIRDLASSLTEKDLLLVLISGGGSALLPAPAPPMSLQEKQDVTRKLAAAGATIQELNTVRRALSLLKGGGLAQCASPAKVVALILSDVIGDPLDLIASGPTVRS---DSSPEEVWAILDNYKLSDSLPSSVKEVLSKSISGQGSGVKNQPQEVKDNVLNVVIGSNTIALECASRKA-SELGLRPVILSPGVCGDVRSVARLYGLLSSFACSPGKEPPPELAAEILKLGPEVGIES------WDLCRTMNVLVGERKEGWGATCLLAGGEPTVKL---SGKGRGGRNQELAMRVGLELSQGEVKSGAVFLS-GGTDGQDGPTEAAGAVADGELKEEAASQGLDTDSFLANNDSFTFFSKLSEGRRLLNPGLTGTNVMDVHVMLLP 494          
BLAST of Glycerate kinase vs. UniProt/SwissProt
Match: sp|Q8QZY2|GLCTK_MOUSE (Glycerate kinase OS=Mus musculus OX=10090 GN=Glyctk PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 6.079e-69
Identity = 162/499 (32.46%), Postives = 250/499 (50.10%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPM-------HT-ESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS---SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQL----LEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            ++LF++ + +V+P  ++             K+ +    + +N+Y+VGFGKA LG      +LL     + + SVP        H  + E++L+P              ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    +ISLILSDVIGD + +IASGPTV   +     L I++ Y  L    P  +K + S   S P+    +  +V N +IG+N +AL     +AE        +LST + GD +  +            +    L    LE    L+  A +L    L L   LE  A       +CLL GGE  V L+    +G GGR   +AL +   L    L    +  L G +DG DG T  +GA + + + S +  +++D    L N DSY FF +F  G + L TG+TGTNVMD  ++I+
Sbjct:   39 RQLFDSAVGAVQPGPMLQRTLSLDPSGRQLKVRDRTFQLRENLYLVGFGKAVLGMAAAAEELLAQHLVQGVISVPKGIRAAMEHAGKKEMLLKPHSR---------VQVFEGAEDNLPDRDALRAALTIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQMLTKLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVISLILSDVIGDPLEVIASGPTVASAHSVQDCLHILNHYG-LRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNSLALAEAQRQAEVL-GYHAMVLSTAMQGDVKRVARFYGLLARVAAAHLTPSLAERPLEEEAELHQLAAELQLPDLQLEEALEAVAKAKGP--VCLLAGGEPTVQLQG---SGKGGRNQELALHVGVELGRQPLGPIDVLFLSGGTDGQDGPTKVAGAWVMSDLISQASAESLDIATSLTNNDSYTFFCRFRGGTHLLHTGLTGTNVMDVHLLIL 520          
BLAST of Glycerate kinase vs. UniProt/SwissProt
Match: sp|Q8IVS8|GLCTK_HUMAN (Glycerate kinase OS=Homo sapiens OX=9606 GN=GLYCTK PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 9.244e-69
Identity = 155/490 (31.63%), Postives = 246/490 (50.20%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLL-----TSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKS---SKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQL----LEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMD 1535
            ++LF + + +V P  ++H            K+ + +  +  N+Y+VGFGKA LG      +LL     + + SVP        +R  + +  ++ +LL       ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    ++SLILSDV+GD + +IASGPTV   +     L I+++Y  L    P  +K + S   S P+    +  +V N +IG+N +AL     +AE     +  +LS  + GD +  +                 +    +E    L+  A +L    L L   LE  A       +CLL GGE  V L+    +G GGR   +AL +   L    L    +  L G +DG DG T+ +GA +  ++ S +  + +D   +LA+ DS+ FF     G + L TGMTGTNVMD
Sbjct:   39 RQLFESAVGAVLPGPMLHRALSLDPGGRQLKVRDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKG------IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYG-LRAALPRSVKTVLSRADSDPHGP-HTCGHVLNVIIGSNVLALAEAQRQAEAL-GYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGP--VCLLAGGEPTVQLQG---SGRGGRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMD 514          
BLAST of Glycerate kinase vs. UniProt/SwissProt
Match: sp|Q2KJF7|GLCTK_BOVIN (Glycerate kinase OS=Bos taurus OX=9913 GN=GLYCTK PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 7.053e-68
Identity = 153/490 (31.22%), Postives = 247/490 (50.41%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ----NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLT-----SIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIK--LLKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXX----XXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDG-ICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMD 1535
            ++LF + + +V P  L+         +   K+ +    +  N+Y+VGFGKA LG      +LL     + + SVP        +R  +    ++ +LL       ++ G+  N+P+ + L+A+  I  L + L  +D L+V+I+GGGSALL  P   +T+ +   ++ LL+  GA+I ELNT+R  +  LKGGGLA+ A    ++SLILSDV+GD + +IASGPTV   +     L I+++Y  L    P  +K  L ++    +   +  +V N ++G+N +AL     +AE     +  +LST + GD +  +             L +      ++  + LY  A  L    L L   LE     +   G +CLL GGE  V L+    +G GGR   +AL +   L    L    +  L G +DG DG T+ +GA +  ++ S +  + +D   +LA+ DS+ FF +F  G + L TG+TGTNV D
Sbjct:   39 RQLFESTVGAVLPGPLLQRALSLDPDSGELKVRDRSFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKG------IRAAMEHAGKQEMLLKPHSRIQVFEGAEDNLPDRDALRAALAIRQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTKLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASIHSVQDCLYILNRYG-LRTALPRSVKTVLARADSDPHGPHTCGHVLNVILGSNALALAEAQKQAEAL-GYRAVVLSTAIQGDVKSVAQFYGLLARVAGAHLALPGAGASVQEDERLYELAADLQLPDLQLKEALEAV---VGAPGPVCLLAGGEPTVRLQG---SGKGGRNQELALRVGVELGQWPLGTVDVLFLSGGTDGQDGPTEAAGAWVRPELTSQAAAEGLDVATFLAHNDSHTFFCRFQGGAHLLHTGLTGTNVTD 514          
BLAST of Glycerate kinase vs. TrEMBL
Match: A0A226MS82 (Uncharacterized protein OS=Callipepla squamata OX=9009 GN=ASZ78_006913 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 8.060e-78
Identity = 170/500 (34.00%), Postives = 265/500 (53.00%), Query Frame = 3
Query:  120 LFNAGIESVKPVTLIHNVF-----QNNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLL----LTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSS--KPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQN-----QLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXF------GASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            LF + + +V+P  ++         +     + +    +  ++Y+VGFGKA LG      ++L     R I SVP+  + E + R  +    +E+LL       ++ G+R+N+P+SE LK +N I  L + L  +D L+V+I+GGGSALL  P   I + +  +++ +L+  GA+I ELNTVR  + LLKGGGLAR A    ++SLILSDVIGD + IIASGPT    +     L I+ KYNLLH +  +V  +L SS  KP  + +   +VCN +IG+N +AL     +AE      T ILS  + GD    +    + +  L +++       Q  E+R NL   A +L+   L +   L+          +C+L GGE  V L+    TG GGR   +AL +   L  +    +            G +DG DG T+ +GA    ++ + +  + +D++ +L+N DSY FF  F  G++ L TG+TGTNVMD  +++I
Sbjct:   53 LFRSAVGTVRPAPMLKRALKLQGEECPQLLVNSRAFPLKRDLYLVGFGKAVLGMAAAAEEILGDHLVRGIVSVPLGIQ-ESLQRAGM----QEMLLKPHSRIQVFEGARNNLPDSEALKGANAIRELAEGLTADDLLLVLISGGGSALLPAPIPPILLEEKEQLTKMLASRGAAIQELNTVRKMLSLLKGGGLARLAYPAQVVSLILSDVIGDPLDIIASGPTAASSHSVQDCLQILTKYNLLHSLPRSVQTVLSSSATKPTAS-EHYSHVCNVIIGSNTLALAEAKRQAEGL-GYATLILSAAVCGDVGCVAELYCQLIRLLCLHTAGPAEGPQGTEVRGNLLQLAAELDIPGLNMAEFLQALQGLEPQKPLCILAGGETTVQLQG---TGKGGRNQELALRVGLGLHRARGVEASSLGRCDVIFLSGGTDGQDGPTEAAGAFCSPELVAEALQEGLDAETFLSNNDSYAFFSHFQRGRHLLVTGLTGTNVMDVQVILI 542          
BLAST of Glycerate kinase vs. TrEMBL
Match: A0A226NQI7 (Uncharacterized protein OS=Colinus virginianus OX=9014 GN=H355_005781 PE=4 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.387e-76
Identity = 166/459 (36.17%), Postives = 249/459 (54.25%), Query Frame = 3
Query:  225 NVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLT----SIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNT-IQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQN-----QLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXF------GASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            ++Y+VGFGKA LG      ++L     R I SVP+  + E + R  +    +E+LL +     ++ G+R+N+P+SE LK +N I  L + L  +D L+V+I+GGGSALL  P   I + +  +++ +L+  GA+I ELNTVR  + LLKGGGLAR A    ++SLILSDVIGD + IIASGPT    +     L I+ KYNLLH +  +V  +L SS    T  +   +VCN VIG+N +AL     +AE      T ILS  + GD    +    + +  L +++       Q  E+R NL   A +L+   L +   L           +C+L GGE  V L+    TG GGR   +AL +   L  +    +            G +DG DG T+ +GA    ++ + +    +D++ +L+N DSY FF  F +G++ L TG+TGTNVMD  +++I
Sbjct:   28 DLYLVGFGKAVLGMAAAAEEILGDHLVRGIISVPVGIQ-ESLQRAGM----QEMLLKSHSRIQVFEGARNNLPDSEALKGANAIRELAEGLTADDLLLVLISGGGSALLPAPIPPILLEEKEQLTKMLASRGAAIQELNTVRKMLSLLKGGGLARLAYPAQVVSLILSDVIGDPLDIIASGPTAASSHSIQDCLQILTKYNLLHSLPRSVQTVLSSSATKPTAAEHHSHVCNVVIGSNALALAEAKRQAEGL-GYATLILSAAVCGDVGCVAELYCQLIRLLCLHTAGPAEGPQGTEVRGNLLQLAAELDIPGLNMAEFLRALQGLEPQKPLCILAGGETTVQLQG---TGKGGRNQELALRVGLGLHRARGVEASSLGRCDVIFLSGGTDGQDGPTEAAGAFCSPELVAEALQDGLDAETFLSNNDSYAFFSHFQHGRHLLVTGLTGTNVMDVQVILI 477          
BLAST of Glycerate kinase vs. TrEMBL
Match: A0A4Y2JVU8 (Glycerate kinase OS=Araneus ventricosus OX=182803 GN=GLYCTK PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.375e-73
Identity = 173/487 (35.52%), Postives = 264/487 (54.21%), Query Frame = 3
Query:  114 KKLFNAGIESVKPVTLIHNVFQ--NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVP--MHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTI-QSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDG--ICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            + +F    +SV+P+ LI+   +  +N  ++      +  NVYIVGFGKA LG    L   L+      I SVP  M T  E  LR  +   S        +Y G+ +N+P+  +L A+ +I  LV SL  +D LIV+I+GGGSALL  P   +T+ +  +V +LL+  GA I ELN VR Q+ +LKGG LA  AK   +ISLILSD+IGD I +IASGPTV   +    PL II+KYN+ H++    I++L  +   + I +S  NV N+++GNN+ AL A + +A++    ++ IL+  L G            +    + S       ++ L    ++L   S +   LLE   + +   G  +CLL GGE  V +K     G+GGR   ++L+ A  L      N+ + +  G +DG+DG T  +GAI    +   ++ + ++   YL N DSY F+ + ++G + +KTG TGTNVMD  I++I
Sbjct:   11 RAIFETAYKSVQPLNLINKEVEINSNSLQIQGKSFQIFKNVYIVGFGKAVLGMATALETKLQENLVSGIISVPDGMLTTLETKLRDHITTKS-----CIQVYEGASNNIPDENSLLAATKISELVTSLKESDLLIVLISGGGSALLPAPKPPLTLKEKQKVISLLASRGADIEELNAVRKQLSMLKGGKLALLAKPAKVISLILSDIIGDPIGMIASGPTVQNSDNLSYPLSIIEKYNITHELPKTAIQILTEAANQSEINESFSNVSNFILGNNETALQAAAEKAKDL-EYQSIILTNRLRG---------IASIIGTKLISLVTAAVNKKCLDEIIKELELPSHIKETLLE-TTSQLQSHGKKVCLLFGGETTVEVKG---DGLGGRNQELSLSAALELYTQKPQNNIMLLSAG-TDGIDGPTCAAGAIASISLIEEAKRKGLNPSSYLLNNDSYTFYSQVNDGWWLVKTGHTGTNVMDIAIILI 477          
BLAST of Glycerate kinase vs. TrEMBL
Match: A0A493TN99 (Glycerate kinase OS=Anas platyrhynchos platyrhynchos OX=8840 GN=GLYCTK PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.233e-73
Identity = 173/512 (33.79%), Postives = 260/512 (50.78%), Query Frame = 3
Query:  120 LFNAGIESVKPVTLIHNV--FQNN---HFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTES--------ELILRP-DLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIQSID--NVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXI----YSQNQLL-EIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXF-------GASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII-PNEKS 1568
            LF + + +V+P  ++      Q +      +      V  N+Y+VGFGKA LG      ++L     R I SVP+  +         E++L+P    QV E          G+R+N+P+ E L+ +  I  L Q L  +D L+V+I+GGGSALL  P   I + +  +++ +L+  GA+I ELNTVR  + LLKGGGLAR A    ++SLILSDVIGD + IIASGPT    +     L ++ KYNLL  + P  ++ + SS P       D  +VCN +IG+N +AL+    +AE    +   ILS  + GD    +    + +  L +      +  L  E+R NL   A +L+   L L   LE          +C+L GGE  V L+    TG GGR   +AL +   L  +  + +   +         G +DG DG T  +GA    ++   +  + +D++ +L N DSY FF  F  G++ L TG+TGTNVMD   V+I P ++S
Sbjct:   10 LFRSAVGTVRPAPMLKRAVKLQGDGCPQLIVKGRAFPVKRNLYLVGFGKAVLGMAAAAEEILGDHLIRGIVSVPLGIQESLQRAGMQEMLLKPHSRIQVIE----------GARNNLPDPEALRGAGAIQELAQGLTADDLLLVLISGGGSALLPAPIPPILLEEKEKLTKMLASRGAAIQELNTVRKTLSLLKGGGLARLAYPAQVVSLILSDVIGDPLDIIASGPTAASSHSVQDCLQVLAKYNLLQSL-PESVETVLSSSPTKRAAPEDYSHVCNVIIGSNALALDEAKRQAEGLGYV-ALILSAAVCGDIGHVAALYCQLIRLLCLGFAGLGEGPLGNEVRGNLLQLAAELDIPGLNLAEFLEALRGLGPEKPVCILAGGETTVQLR---GTGKGGRNQELALRVGLGLHRAQGAEASSPLGRCEIIFLSGGTDGQDGPTGAAGAFCSPELVDEAFQEGLDAEAFLNNNDSYTFFSHFQRGRHLLVTGLTGTNVMDIQTVLIRPKDRS 506          
BLAST of Glycerate kinase vs. TrEMBL
Match: A0A2P6KIN0 (Glyctk OS=Nephila clavipes OX=2585209 GN=NCL1_38760 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 9.466e-73
Identity = 189/515 (36.70%), Postives = 284/515 (55.15%), Query Frame = 3
Query:   48 FFMILNKFISMSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNH--FKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTV-NERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLN--FDSLVLNNLLELCATNINY--------DGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            F  I NKF+++S   M  +   + +F A  +SV+P+ LI    + N    ++     T+S NV+I+GFGKA LG    L   LK      I SVP   +S L  +   F  ++  +    IY G+  N+P+  +L  +++I  LV +LN +D LIV+I+GGGSALL  P   +T+ D  +V  LL+  GA I ELN VR ++ +LKGG LA  AK   +ISL+LSD+IGD + +IASGPTV N  NP L+ + II+KY L +++  +VI++L ++   N  +S  +V N++IGNNK ALNA +  AE+  +  +FIL+  L G +                  +N +L I   L +  E  N  ++ L L++ L+   T  NY          +CLL+GGE  V +     +G+GGR   +AL  A  L  +   N+   +  G +DG+DG T  +GAI        ++ + +D   +L N DSY FF +  N ++ +KTG TGTNVMD II++I
Sbjct:   17 FLRISNKFVTISSNNMCQDA--RIIFEAAYKSVQPLNLISEQIKVNGDILEIQGKRFTISKNVHIIGFGKAVLGMAATLETKLKENLVSGILSVPEGIQSALQTKLQNFLEAKSCI---QIYEGASKNIPDDNSLLTASKITDLVSTLNESDLLIVLISGGGSALLPAPKPPLTLKDKQKVIQLLASRGAEIEELNAVRKRLSMLKGGKLAILAKPAEVISLVLSDIIGDPLGMIASGPTVQNTDNPSLA-MSIIEKYKLHNQLPESVIQILTNTSVENQNESFSHVSNFIIGNNKTALNAAAKIAEDL-DYDSFILTNKLTGIASNT--------------GRNLILLITAALQNKFEFFNDIYEQLDLHSHLK--ETLFNYLNNFQNQNKKLCLLLGGETTVTV---YGSGVGGRNQELALAAALELHKNKPDNNITLLSAG-TDGIDGPTCAAGAIATISEIEEAKSKGLDPSAFLNNNDSYTFFSQL-NEQWLVKTGHTGTNVMDVIIILI 503          
BLAST of Glycerate kinase vs. Ensembl Cavefish
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:570678])

HSP 1 Score: 219.935 bits (559), Expect = 1.696e-64
Identity = 152/464 (32.76%), Postives = 245/464 (52.80%), Query Frame = 3
Query:  216 VSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS----IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTV-NERNPDLSPLDIIDKYNLLHKVSPNVIKLL----------KSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELC--ATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIP 1556
            +S+N+++VG GKA LG      +++     + + SVP   +  L          + +LL +S    +  G++ N+P++   K++  I  LV SL   D L+V+I+GGGSALL  P   IT+ +  +V+  L+ +GA+I ELNTVR  + LLKGGGLAR A    ++SL+LSDVIGD + +IASGPTV +E +P+     I+++YNL   +  +V + L          +S K      + D+V N VIG+N IAL      A  +  L+T +LS  + GD    +       +      +   LE+++ +     +   +S  L   ++L        +   CLL GGE  V L   +  G GGR   +AL +   L    + N  + +  G +DG DG TD +GA+   ++ + ++ Q +D   +L+N DS+ FF +  +G+  L  G+TGTNVMD  ++++P
Sbjct:   62 LSNNLHLVGCGKAVLGMAAEAERIVGDHLVQGLISVPHGIQETL-----QHHGKQNMLLGSSSRIKVMEGAKHNLPDANAQKSAESIRELVSSLTERDLLLVLISGGGSALLPAPVPPITLQEKQDVTRRLAAAGATIQELNTVRRALSLLKGGGLARCAYPAQVVSLVLSDVIGDPLDLIASGPTVQSEVHPE-EVWSILERYNLSVSLPSSVKEALNKSSSSQGEGESGKRTQDSTAGDHVLNSVIGSNTIALECAGRRA-RELGLRTVVLSPGVCGDVRTVARMYGLLSQYACSPGKEPPLELQEQILKVGPEAGVESWDLCRTMKLLEEGREEGWCATCLLAGGEPTVQL---TGKGRGGRNQELALRVGLELSAGSMKNPAVFLS-GGTDGQDGPTDAAGAVSDAELEAEAKNQGLDINSFLSNNDSFTFFSRLSDGRRLLLPGLTGTNVMDVHVMLLP 514          
BLAST of Glycerate kinase vs. Ensembl Sea Lamprey
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:570678])

HSP 1 Score: 191.045 bits (484), Expect = 1.377e-54
Identity = 154/521 (29.56%), Postives = 255/521 (48.94%), Query Frame = 3
Query:  117 KLFNAGIESVKPVTLIHNVFQ---NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTE--------SELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSP---LDIIDKYNLLHKVSPNVIKLLK--SSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXX--XXXXXXXXXXIYSQN------------------QLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDG--ICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXF----GASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            +LF + + +V P+ ++    +    +    G     +  NV +VGFGKAALG      +LL     R   SVP+  +        +E++L+PD             ++ G+ +N+P+  +L+A+  I  LV+ L  +D L+++I+GGGSALL  P   +++ +  EV+ LL+  GA+I ELN VR  + LLKGGGLAR A+   +++LILSDV+GD +  IASGPTV  RNP  +P   LD++ +Y LL +V+P+V+  L    S  ++    + +V N V+G++ +AL      A  +   +   LS ++ GD    +             + S+                   + +E  + L   A +     L +  L    A   +  G  +C+  GGE  V+++     G GGR   +AL +A  L     +    SI        +DG DG T  +GA+ +  + + ++    D +  L   DS+ F+     G+  + TG+TGTNVMD  +V++
Sbjct:    1 ELFRSAVSAVLPLGMVRRSLRVEGGDTLSAGGRRFPLRRNVTVVGFGKAALGMGRAAEELLGRHVVRGALSVPVGAQESLRQAGKTEMLLQPDTK---------LRVFEGALNNLPDEGSLEAARYIQRLVEPLRPSDLLLILISGGGSALLPAPVPPVSLQEKQEVTRLLATRGAAIGELNAVRRGLSLLKGGGLARLARPAQVVTLILSDVVGDPLEAIASGPTV--RNPT-TPSDCLDVLGRYELLGRVAPSVLHHLSHLPSPRSDDDDDLSHVLNLVVGSSGLALEEACAHAA-RLGYEPLALSRSVTGDVADAAEFYSRLIAYACRRLRSRGGPTGGGDAEGAEDEVDEVEEVEEAERLKEAATRCGVGDLSMEALAGTVAIAAHRRGGRLCVACGGETTVSVRG---DGRGGRNQELALRVARRLGGLRQTQPIQSINLLSLSAGTDGQDGPTPAAGALAWPSLVAEARAAGADVEDALRRNDSFGFYSAL--GEGLVVTGLTGTNVMDVQLVLV 503          
BLAST of Glycerate kinase vs. Ensembl Nematostella
Match: EDO37891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK0])

HSP 1 Score: 187.193 bits (474), Expect = 5.213e-53
Identity = 150/500 (30.00%), Postives = 251/500 (50.20%), Query Frame = 3
Query:  120 LFNAGIESVKPVTLIHNVFQ--NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTS---IYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLK--SSKPNNTIQ---SIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLL---ELCATNI------NYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXF---GASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII 1553
            +F + +++V P  ++ N         ++  ++  V  NVY+V FGKA LG    +  +L     R + S+P   +  +    +   +   LL   S   I  G++ N+P+     A+ +I ++   +  ND L+V+I+GGGSALL  P   IT+ + ++    ++ SG +IV+LNTVR  +  LKGG LA+ A    +++LILSDVIGD + IIASGPTV +++     L+I  K     KV  +V++ L+  + +P    Q      NV N ++G N+IA+ A + EA N       I STTL+G++                    ++ +   NL S A  L  + +  N+ +   +L + N+          +C++  GE  V +K    TG GGR   M L+ A L++ +    SK   +      +DG DG T  +GA+      + +    + ++ ++ N DSY F+  F NG+  + TG+TGTNVMD  ++++
Sbjct:   27 IFRSALKAVTPQEMVKNALSLSKTRLRVQGSEYMVYKNVYVVAFGKAVLGMARAVEDVLGHNIIRGVASIPCGLQDAIKESGNEDFIKSTLLRPGSPIHIIEGAKHNLPDDRAQYAATQIQNIATQVTENDILLVLISGGGSALLPSPIDAITLQEKLKTIKAVASSGGTIVDLNTVRKNLSKLKGGKLAQLAYPAKVVTLILSDVIGDPLDIIASGPTVPDQSNPRDCLEIFRKLKAEEKVPKSVMQYLQGMADQPKPESQNNREFANVHNVLVGTNRIAVKAAAAEAANL-GYTPIIASTTLEGEA-------------------GEVGKSFANLASIA--LTGNPIPGNSPVADKDLTSENVINQIKGAQKPLCVIGAGETTVTIKG---TGKGGRNQEMVLSSALLMQQAQQIFSKEDGVVFLSAGTDGQDGPTPAAGALATPSQVNEATKHGLSAQEFIDNNDSYTFYSNFLNGRDHVVTGLTGTNVMDIQVLLV 501          
BLAST of Glycerate kinase vs. Ensembl Medaka
Match: glyctk (glycerate kinase [Source:NCBI gene;Acc:101170508])

HSP 1 Score: 228.409 bits (581), Expect = 2.471e-67
Identity = 154/509 (30.26%), Postives = 262/509 (51.47%), Query Frame = 3
Query:   87 LTMNTNVILKKLFNAGIESVKPVTLIHNVFQ--NNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVP--------MHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIQSID---NVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVL-NNLLEL----CATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIPN 1559
            ++M++ V  +++F A +E+V+P  ++    +  ++   +G    T+  N+++VGFGKA LG    + +++       + SVP         H +S L+ + +  Q+         +  G++ N+P+ + L+A+ +I  L + L   D L+V+I+GGGSALL  P   +++ + ++V+  L+ +GA+I ELNTVR  + +LKGGGLA++A    +++LILSDVIGD + +IASGPTV         L I+++Y LLH +  +V  +++     + +   D   +V N VIG+N  AL    + A  +      +LS  + GD      +L+  L       +    E+   + +   ++   S  L   + EL     A        CLL GGE  V L   +  G GGR   +AL +        L  +    L G +DG DG T+ +GA+    + + +Q Q +D + +L N DSY FF    +GK+ L  G+T TNVMD  +++ P+
Sbjct:   69 MSMDSRV--REVFAAAVEAVQPDAVVRQSVERKDDSVAIGGRRFTLKHNLHLVGFGKAVLGMAAEVERMMGDHLVDGVISVPHGIQQTMRQHGKSHLLPKEN-GQIE--------VMEGAKHNLPDEDALRAAEKIKQLAKRLTEKDLLLVLISGGGSALLPAPLPPVSLQEKLDVTRRLAAAGATIQELNTVRRALSVLKGGGLAKYAHPAQVVALILSDVIGDPLDLIASGPTVRSEVWPEEILSILERYKLLHCIPTSVKDVIQRQSRKDNVDESDTAGHVQNVVIGSNSTALERARLRA-RELGFHPVVLSPGVCGD-VRSVSKLYGLLTLFACSPEEPPAEVAAEVLALGPEVGVASWDLCRTMRELGERRRAAAGGLAATCLLAGGEPTVEL---TGKGRGGRNQELALRVGLEWRGLELPPNGPIFLSGGTDGQDGPTEAAGAVTDAGLYAEAQAQGLDIEKFLINNDSYTFFSSLSSGKHLLVPGLTCTNVMDVHVLLFPS 561          
BLAST of Glycerate kinase vs. Planmine SMEST
Match: SMESG000044604.1 (SMESG000044604.1)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 493/498 (99.00%), Postives = 495/498 (99.40%), Query Frame = 3
Query:   78 MSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIPNEKSS 1571
            MSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDV VSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELIL+PDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTI SIDNVCNYVIGNNKIALNAISIEAENK NLKTFILSTTLDGDSELRSLELFRFLEALFIYSQNQLLEIRQN+YSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACLLENSILSNSKLSILFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIPNEKSS
Sbjct:    1 MSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDVIVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILKPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIHSIDNVCNYVIGNNKIALNAISIEAENKYNLKTFILSTTLDGDSELRSLELFRFLEALFIYSQNQLLEIRQNIYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACLLENSILSNSKLSILFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIPNEKSS 498          
BLAST of Glycerate kinase vs. Planmine SMEST
Match: SMESG000044604.1 (SMESG000044604.1)

HSP 1 Score: 910.983 bits (2353), Expect = 0.000e+0
Identity = 488/493 (98.99%), Postives = 490/493 (99.39%), Query Frame = 3
Query:   93 MNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIEAENKNNLKTFILSTTLDGDXXXXXXXXXXXXXXXXIYSQNQLLEIRQNLYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACXXXXXXXXXXXXXXXFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIPNEKSS 1571
            MNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDV VSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELIL+PDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTI SIDNVCNYVIGNNKIALNAISIEAENK NLKTFILSTTLDGDSELRSLELFRFLEALFIYSQNQLLEIRQN+YSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACLLENSILSNSKLSILFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIPNEKSS
Sbjct:    1 MNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDVIVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELILKPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNVIKLLKSSKPNNTIHSIDNVCNYVIGNNKIALNAISIEAENKYNLKTFILSTTLDGDSELRSLELFRFLEALFIYSQNQLLEIRQNIYSYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIGGRCSHMALTIACLLENSILSNSKLSILFGASDGMDGATDCSGAIIYTQMCSHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVIIPNEKSS 493          
BLAST of Glycerate kinase vs. Planmine SMEST
Match: SMESG000044626.1 (SMESG000044626.1)

HSP 1 Score: 330.872 bits (847), Expect = 4.066e-112
Identity = 167/172 (97.09%), Postives = 170/172 (98.84%), Query Frame = 3
Query:  327 MHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNV 842
            MHTESELIL+PDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKV  ++
Sbjct:    1 MHTESELILKPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVDKSI 172          
BLAST of Glycerate kinase vs. Planmine SMEST
Match: SMESG000044616.1 (SMESG000044616.1)

HSP 1 Score: 330.872 bits (847), Expect = 4.066e-112
Identity = 167/172 (97.09%), Postives = 170/172 (98.84%), Query Frame = 3
Query:  327 MHTESELILRPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVSPNV 842
            MHTESELIL+PDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKV  ++
Sbjct:    1 MHTESELILKPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSLIVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDLLKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDIIDKYNLLHKVDKSI 172          
BLAST of Glycerate kinase vs. Planmine SMEST
Match: SMESG000044604.1 (SMESG000044604.1)

HSP 1 Score: 129.413 bits (324), Expect = 3.740e-36
Identity = 64/65 (98.46%), Postives = 64/65 (98.46%), Query Frame = 3
Query:   78 MSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDVTVSDNVYIVGFGKAALGFLN 272
            MSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDV VSDNVYIVGFGKAALGFLN
Sbjct:    1 MSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGNTDVIVSDNVYIVGFGKAALGFLN 65          
The following BLAST results are available for this feature:
BLAST of Glycerate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLYCTK1.925e-6931.63glycerate kinase [Source:HGNC Symbol;Acc:HGNC:2424... [more]
GLYCTK2.186e-3336.76glycerate kinase [Source:HGNC Symbol;Acc:HGNC:2424... [more]
GLYCTK3.866e-3336.76glycerate kinase [Source:HGNC Symbol;Acc:HGNC:2424... [more]
GLYCTK7.914e-1325.16glycerate kinase [Source:HGNC Symbol;Acc:HGNC:2424... [more]
GLYCTK7.707e-1225.68glycerate kinase [Source:HGNC Symbol;Acc:HGNC:2424... [more]
back to top
BLAST of Glycerate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C13B9.26.790e-4428.37pep chromosome:WBcel235:III:6620254:6622265:1 gene... [more]
back to top
BLAST of Glycerate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG98866.500e-5531.03gene:FBgn0031428 transcript:FBtr0335462[more]
CG98866.500e-5531.03gene:FBgn0031428 transcript:FBtr0077770[more]
back to top
BLAST of Glycerate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glyctk4.852e-7231.99glycerate kinase [Source:NCBI gene;Acc:570678][more]
glyctk4.852e-7231.99glycerate kinase [Source:NCBI gene;Acc:570678][more]
glyctk1.652e-3935.74glycerate kinase [Source:NCBI gene;Acc:570678][more]
glyctk3.031e-2833.33glycerate kinase [Source:NCBI gene;Acc:570678][more]
glyctk1.526e-725.93glycerate kinase [Source:NCBI gene;Acc:570678][more]
back to top
BLAST of Glycerate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mtmr75.916e-1227.10myotubularin related protein 7 [Source:Xenbase;Acc... [more]
back to top
BLAST of Glycerate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Glyctk8.690e-7032.60glycerate kinase [Source:MGI Symbol;Acc:MGI:244408... [more]
Glyctk8.690e-7032.60glycerate kinase [Source:MGI Symbol;Acc:MGI:244408... [more]
back to top
BLAST of Glycerate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VGK3|GLCTK_RAT6.612e-7231.99Glycerate kinase OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q08BL7|GLCTK_DANRE2.397e-7032.35Glycerate kinase OS=Danio rerio OX=7955 GN=glyctk ... [more]
sp|Q8QZY2|GLCTK_MOUSE6.079e-6932.46Glycerate kinase OS=Mus musculus OX=10090 GN=Glyct... [more]
sp|Q8IVS8|GLCTK_HUMAN9.244e-6931.63Glycerate kinase OS=Homo sapiens OX=9606 GN=GLYCTK... [more]
sp|Q2KJF7|GLCTK_BOVIN7.053e-6831.22Glycerate kinase OS=Bos taurus OX=9913 GN=GLYCTK P... [more]
back to top
BLAST of Glycerate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A226MS828.060e-7834.00Uncharacterized protein OS=Callipepla squamata OX=... [more]
A0A226NQI71.387e-7636.17Uncharacterized protein OS=Colinus virginianus OX=... [more]
A0A4Y2JVU81.375e-7335.52Glycerate kinase OS=Araneus ventricosus OX=182803 ... [more]
A0A493TN994.233e-7333.79Glycerate kinase OS=Anas platyrhynchos platyrhynch... [more]
A0A2P6KIN09.466e-7336.70Glyctk OS=Nephila clavipes OX=2585209 GN=NCL1_3876... [more]
back to top
BLAST of Glycerate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glyctk1.696e-6432.76glycerate kinase [Source:NCBI gene;Acc:570678][more]
back to top
BLAST of Glycerate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glyctk1.377e-5429.56glycerate kinase [Source:NCBI gene;Acc:570678][more]
back to top
BLAST of Glycerate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycerate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO378915.213e-5330.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycerate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glyctk2.471e-6730.26glycerate kinase [Source:NCBI gene;Acc:101170508][more]
back to top
BLAST of Glycerate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044604.10.000e+099.00SMESG000044604.1[more]
SMESG000044604.10.000e+098.99SMESG000044604.1[more]
SMESG000044626.14.066e-11297.09SMESG000044626.1[more]
SMESG000044616.14.066e-11297.09SMESG000044616.1[more]
SMESG000044604.13.740e-3698.46SMESG000044604.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003793 ID=SMED30003793|Name=Glycerate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1628bp
CATTTTAAAAATTATTACAAATAAATTTATTAAAATGTTTATTAGCTTTT
TTTATGATATTAAATAAATTTATTTCAATGAGTAAATTAACAATGAATAC
AAATGTTATTTTAAAAAAATTATTTAATGCTGGAATTGAAAGCGTGAAAC
CTGTTACTCTAATCCATAACGTCTTTCAGAATAATCATTTTAAATTGGGA
AATACAGATGTTACAGTCTCTGACAATGTATATATTGTTGGTTTTGGAAA
GGCAGCTTTAGGATTTTTAAATCCATTGTATAAGCTATTGAAATCTAAAT
TTCGGCGAGCTATATTTTCTGTTCCAATGCATACTGAATCGGAGTTAATT
CTTAGACCTGATTTATTTCAAGTATCAGAAGAACTATTGCTATTGACATC
TATATATTATGGCAGCAGATCAAATGTTCCAAATTCCGAGACACTTAAAG
CTTCTAACGAAATTTTTCACCTTGTTCAATCACTCAATGGAAATGATTCA
TTAATAGTTGTTATTACTGGTGGTGGTTCCGCATTATTATGCATGCCATA
TGCAGACATTACTATATTAGATATTATAGAAGTTTCTAATCTGTTATCTA
AATCTGGTGCAAGTATTGTCGAATTAAATACGGTTCGTAGTCAGATTGAT
TTACTAAAAGGAGGAGGACTGGCACGCTTCGCAAAATCTCGGAATATAAT
CAGTTTGATTTTATCTGATGTTATTGGTGATGATATATCAATAATTGCCA
GCGGTCCTACGGTGAATGAAAGAAATCCCGATTTATCTCCTCTTGATATA
ATCGATAAATATAATCTGCTACACAAGGTTTCTCCAAACGTTATAAAACT
ATTGAAATCTTCCAAACCGAATAATACTATCCAATCGATCGATAATGTTT
GCAATTACGTAATCGGCAACAACAAAATTGCACTCAATGCGATTTCAATC
GAAGCTGAAAACAAAAACAATTTGAAAACATTTATTTTATCCACTACACT
CGATGGAGATTCTGAATTGAGGAGTTTGGAACTATTTCGGTTTTTGGAAG
CGTTATTTATTTACAGCCAAAATCAATTATTGGAAATACGCCAAAATTTA
TATTCTTATGCTGAAAAGTTAAATTTTGATTCATTGGTGTTAAATAATCT
TTTGGAATTGTGTGCAACTAATATAAATTATGACGGAATCTGCTTGCTAA
TTGGGGGTGAAATGCCAGTGAACCTTAAAAAGCCTTCTACTACAGGGATT
GGTGGGAGATGTAGCCACATGGCTTTAACAATTGCATGCCTGTTGGAAAA
CTCTATTCTATCAAATTCAAAACTGAGTATATTATTTGGAGCATCCGACG
GAATGGATGGTGCAACCGACTGCTCCGGTGCAATCATCTATACGCAAATG
TGCTCCCATTCACAAATGCAGAATATCGATTCCAAACACTATTTAGCTAA
TTATGATTCTTACAACTTTTTTAAAAAATTTCATAACGGAAAATACTTTT
TGAAAACCGGCATGACAGGGACAAATGTCATGGATTTTATTATCGTCATT
ATTCCCAATGAAAAATCTAGTTGAAAAATCTAGTAACATTTTTGATTGAA
AATAAAACTTTTTAATTTTTAAAAAAAA
back to top

protein sequence of SMED30003793-orf-1

>SMED30003793-orf-1 ID=SMED30003793-orf-1|Name=SMED30003793-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MILNKFISMSKLTMNTNVILKKLFNAGIESVKPVTLIHNVFQNNHFKLGN
TDVTVSDNVYIVGFGKAALGFLNPLYKLLKSKFRRAIFSVPMHTESELIL
RPDLFQVSEELLLLTSIYYGSRSNVPNSETLKASNEIFHLVQSLNGNDSL
IVVITGGGSALLCMPYADITILDIIEVSNLLSKSGASIVELNTVRSQIDL
LKGGGLARFAKSRNIISLILSDVIGDDISIIASGPTVNERNPDLSPLDII
DKYNLLHKVSPNVIKLLKSSKPNNTIQSIDNVCNYVIGNNKIALNAISIE
AENKNNLKTFILSTTLDGDSELRSLELFRFLEALFIYSQNQLLEIRQNLY
SYAEKLNFDSLVLNNLLELCATNINYDGICLLIGGEMPVNLKKPSTTGIG
GRCSHMALTIACLLENSILSNSKLSILFGASDGMDGATDCSGAIIYTQMC
SHSQMQNIDSKHYLANYDSYNFFKKFHNGKYFLKTGMTGTNVMDFIIVII
PNEKSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008887glycerate kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR039760MOFRL_protein
IPR025286MOFRL_assoc_dom
IPR007835MOFRL
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007835MOFRL domainPFAMPF05161MOFRLcoord: 371..486
e-value: 4.3E-27
score: 94.5
IPR025286MOFRL-associated domainPFAMPF13660DUF4147coord: 12..259
e-value: 3.6E-59
score: 200.1
IPR039760MOFRL domain-containing proteinPANTHERPTHR12227GLYCERATE KINASEcoord: 5..493
NoneNo IPR availableSUPERFAMILYSSF82544GckA/TtuD-likecoord: 7..492