leucine-rich repeat-containing protein 69-like

Overview
Nameleucine-rich repeat-containing protein 69-like
Smed IDSMED30003791
Length (bp)1152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of leucine-rich repeat-containing protein 69-like (SMED30003791) t-SNE clustered cells

Violin plots show distribution of expression levels for leucine-rich repeat-containing protein 69-like (SMED30003791) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of leucine-rich repeat-containing protein 69-like (SMED30003791) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for leucine-rich repeat-containing protein 69-like (SMED30003791) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003791

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003791SMESG000007767.1 dd_Smed_v6_14722_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Human
Match: LRRC69 (leucine rich repeat containing 69 [Source:HGNC Symbol;Acc:HGNC:34303])

HSP 1 Score: 109.768 bits (273), Expect = 2.156e-26
Identity = 54/159 (33.96%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  556 IEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
            I V+   + D+  LR+LD+A N IQ+ PS   ++ L EF+ E NPL   +PV S Q + V  L E+  R +  +L     +L   +  +P V+ M+ Q   C +CG  +  +W+ECVRF    PK      + K +P++  ICS  CF+ ++   +G+A
Sbjct:  188 IGVLPEELCDLKKLRILDIAGNIIQIFPSGFQDLKLREFYCEGNPLFLQQPVISTQQENVWSLQEITSRFVMNQLAENNPFLMDDIERYPQVRSMISQGKTCAICGQYFITVWLECVRFVPP-PKDWKISKNLKLVPLQVLICSYKCFTQRDPNLFGIA 345          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Human
Match: LRRC69 (leucine rich repeat containing 69 [Source:HGNC Symbol;Acc:HGNC:34303])

HSP 1 Score: 85.5001 bits (210), Expect = 6.205e-19
Identity = 41/133 (30.83%), Postives = 70/133 (52.63%), Query Frame = 1
Query:  640 SEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL 1038
            ++  ++ L EF+ E NPL   +PV S Q + V  L E+  R +  +L     +L   +  +P V+ M+ Q   C +CG  +  +W+ECVRF    PK      + K +P++  ICS  CF+ ++   +G+A +
Sbjct:   60 TQFQDLKLREFYCEGNPLFLQQPVISTQQENVWSLQEITSRFVMNQLAENNPFLMDDIERYPQVRSMISQGKTCAICGQYFITVWLECVRFVPP-PKDWKISKNLKLVPLQVLICSYKCFTQRDPNLFGIAQV 191          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Human
Match: LRRC1 (leucine rich repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:14307])

HSP 1 Score: 72.0182 bits (175), Expect = 4.169e-13
Identity = 51/127 (40.16%), Postives = 76/127 (59.84%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   EIP  I F K+L++     N L+ +  + F +L+ L  L+VN   L S+PE+I N  NL  L    N L  LP+SL+Q + L+E+  G N+I ++PE+ G L+ LK L L  NQL++LP++I 
Sbjct:   92 NEIPEIPESISFCKALQVADFSGNPLTRLPES-FPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIG 217          

HSP 2 Score: 70.8626 bits (172), Expect = 9.363e-13
Identity = 44/129 (34.11%), Postives = 71/129 (55.04%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  + +P +I  L SL  L+   N L  I   I   LKKL IL V+ N+L  +PE++  CE+L +L  + N L +LP+S+ + K L  ++A  NK+  +P+  G    L +  +  N+L  +P ++S A
Sbjct:  230 NRLERLPEEISGLTSLTDLVISQNLLETIPDGIG-KLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQA 357          

HSP 3 Score: 59.6918 bits (143), Expect = 3.884e-9
Identity = 45/122 (36.89%), Postives = 66/122 (54.10%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P  I  L  LK L    NQLS +   I  +LK L  L+V+ N+L  +PE IS   +L  L  S N L+++P+ + + K L  +    N++T +PE  GE   L  L+L +NQL  LP+ I 
Sbjct:  189 LPESIGALLHLKDLWLDGNQLSELPQEIG-NLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIG 309          

HSP 4 Score: 55.8398 bits (133), Expect = 7.680e-8
Identity = 43/123 (34.96%), Postives = 67/123 (54.47%), Query Frame = 2
Query:   20 IPIQI-QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P +I ++ +SL+ L+   NQL  +    F  L KL  L ++ N++  +P  I+N   L +L  S N +  +PES+S CK LQ      N +T +PE+F EL  L  L ++   L  LPE+I 
Sbjct:   27 VPEEIYRYARSLEELLLDANQLRELPEQFF-QLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIG 148          

HSP 5 Score: 54.299 bits (129), Expect = 2.486e-7
Identity = 42/134 (31.34%), Postives = 70/134 (52.24%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSI 406
            N   E+P +I  LK+L  L    N+L  +   I   L  L  L ++ N L +IP+ I   + L  L    N L  LPE++ +C++L E+    N++  +P++ G+L KL  L   +N+L  LP++I    S ++
Sbjct:  207 NQLSELPQEIGNLKNLLCLDVSENRLERLPEEIS-GLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTV 339          

HSP 6 Score: 50.8322 bits (120), Expect = 2.779e-6
Identity = 42/127 (33.07%), Postives = 70/127 (55.12%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            NL   +P  +  L+ L+ L   +N++ N+  +I   L  L+ L ++ N+L  +P+ I N +NL  L  S N L+ LPE +S   +L ++    N +  IP+  G+L KL IL + +N+L  LPE + 
Sbjct:  161 NLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGA-LLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVG 286          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Human
Match: LRRC2 (leucine rich repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14676])

HSP 1 Score: 67.781 bits (164), Expect = 8.133e-12
Identity = 49/127 (38.58%), Postives = 69/127 (54.33%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHN-SLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
             L + IP  IQ  ++++IL    NQ+S++   I   LK L+ LNV FN L SIP  + +CENL +L CS N  L  LP  LS  K +  +    NK + +P     +  L+ L +  N L DLP+DI
Sbjct:  131 TLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGC-LKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFELSNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDI 256          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Human
Match: LRRC2 (leucine rich repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14676])

HSP 1 Score: 67.781 bits (164), Expect = 8.133e-12
Identity = 49/127 (38.58%), Postives = 69/127 (54.33%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHN-SLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
             L + IP  IQ  ++++IL    NQ+S++   I   LK L+ LNV FN L SIP  + +CENL +L CS N  L  LP  LS  K +  +    NK + +P     +  L+ L +  N L DLP+DI
Sbjct:  131 TLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGC-LKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFELSNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDI 256          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972924:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 65.855 bits (159), Expect = 2.133e-11
Identity = 45/127 (35.43%), Postives = 71/127 (55.91%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            NL + IP+ I  L+ L+ L    N+L  +   I   L  L    V+ N L S+P+SIS C  L +L  S N +  LPE+L +  NL +++   N+I ++P +FGEL +L++L   +N L +L  +I 
Sbjct:  161 NLLRTIPLSIVELRKLEELDLGQNELEALPAEIG-KLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIG 286          

HSP 2 Score: 58.5362 bits (140), Expect = 4.301e-9
Identity = 40/137 (29.20%), Postives = 71/137 (51.82%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS 412
             N    +P  I   + L  L    NQ+  +  N+   +  L  LN++ N++  +P S    + L  L    NSL +L   + +C++L E++ G N +TD+P+T G+L +L  L +  N L+D+P+ I +  S ++ S
Sbjct:  206 INSLTSLPDSISGCRMLDQLDVSENQIIRLPENLG-RMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLS 341          

HSP 3 Score: 55.8398 bits (133), Expect = 3.263e-8
Identity = 41/126 (32.54%), Postives = 67/126 (53.17%), Query Frame = 2
Query:   11 FKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
             + IP  I   + L+ L    N +  +D+ +F  L+ L IL+V+ N+L  +P  I N   L +L+ + NS+  LP+++  CK L  ++   N  T +PET  E   + IL L++  L  LP +I S
Sbjct:   25 LQAIPSDIFRFRKLEDLNLTMNNIKELDHRLF-SLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGS 149          

HSP 4 Score: 53.1434 bits (126), Expect = 2.295e-7
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 2
Query:   17 EIPIQIQFLKSLKILICHHNQLSNIDYNI--------------FI--------DLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETF 313
            E+P     LK L++L    N L N+   I              F+        DL++L  LNV+ N L  IP++I NC++L  L    N L  LP ++ +C+NL  +    NK+  +P T 
Sbjct:  257 ELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTV 377          

HSP 5 Score: 51.2174 bits (121), Expect = 9.838e-7
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  104 FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            F +LK+L++L  + N L ++   I  C++L +L+   N L  LP+++   + L  ++   N ++DIP+T G    L +L L +N L +LP  I 
Sbjct:  262 FGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIG 355          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972934:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 65.855 bits (159), Expect = 2.242e-11
Identity = 45/127 (35.43%), Postives = 71/127 (55.91%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            NL + IP+ I  L+ L+ L    N+L  +   I   L  L    V+ N L S+P+SIS C  L +L  S N +  LPE+L +  NL +++   N+I ++P +FGEL +L++L   +N L +L  +I 
Sbjct:  161 NLLRTIPLSIVELRKLEELDLGQNELEALPAEIG-KLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIG 286          

HSP 2 Score: 58.5362 bits (140), Expect = 4.590e-9
Identity = 40/137 (29.20%), Postives = 71/137 (51.82%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS 412
             N    +P  I   + L  L    NQ+  +  N+   +  L  LN++ N++  +P S    + L  L    NSL +L   + +C++L E++ G N +TD+P+T G+L +L  L +  N L+D+P+ I +  S ++ S
Sbjct:  206 INSLTSLPDSISGCRMLDQLDVSENQIIRLPENLG-RMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLS 341          

HSP 3 Score: 55.8398 bits (133), Expect = 3.541e-8
Identity = 41/126 (32.54%), Postives = 67/126 (53.17%), Query Frame = 2
Query:   11 FKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
             + IP  I   + L+ L    N +  +D+ +F  L+ L IL+V+ N+L  +P  I N   L +L+ + NS+  LP+++  CK L  ++   N  T +PET  E   + IL L++  L  LP +I S
Sbjct:   25 LQAIPSDIFRFRKLEDLNLTMNNIKELDHRLF-SLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGS 149          

HSP 4 Score: 53.1434 bits (126), Expect = 2.144e-7
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 2
Query:   17 EIPIQIQFLKSLKILICHHNQLSNIDYNI--------------FI--------DLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETF 313
            E+P     LK L++L    N L N+   I              F+        DL++L  LNV+ N L  IP++I NC++L  L    N L  LP ++ +C+NL  +    NK+  +P T 
Sbjct:  257 ELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTV 377          

HSP 5 Score: 51.2174 bits (121), Expect = 1.011e-6
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  104 FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            F +LK+L++L  + N L ++   I  C++L +L+   N L  LP+++   + L  ++   N ++DIP+T G    L +L L +N L +LP  I 
Sbjct:  262 FGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIG 355          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 57.3806 bits (137), Expect = 8.504e-9
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N    +P  +  L+SL+ L   HN+L+ +   I+  +  LE L + +N++ ++ E I N   L  L    N ++ LP ++ +  +L      YN +T +PE  G+   L  L L  N L++LP  I 
Sbjct:  201 NALTSLPDSLASLESLETLDLRHNKLTEVPSVIY-KIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIG 326          

HSP 2 Score: 54.299 bits (129), Expect = 1.002e-7
Identity = 42/132 (31.82%), Postives = 72/132 (54.55%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNI--FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSIC 409
            IP  I+ L  L  L  + N+L+ +   I   ++LKKL    ++ N L S+P+S+++ E+L  L   HN L  +P  + +  +L+ +   YN+I  + E  G L KLK+L + +N++ +LP  I    S  +C
Sbjct:  160 IPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKL---GLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVC 288          

HSP 3 Score: 53.5286 bits (127), Expect = 1.837e-7
Identity = 38/123 (30.89%), Postives = 57/123 (46.34%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNV-----------------------NFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIP 304
            N   E+P  I  + SL+ L   +N++  +D  I  +L KL++L+V                       ++N L  +PE I +C +L +L   HN L  LP S+ +  NL  I   YNKI  IP
Sbjct:  224 NKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIG-NLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIP 345          

HSP 4 Score: 49.6766 bits (117), Expect = 2.554e-6
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 2
Query:   35 QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            QF+ ++ I +  HNQ+S I   IF    +L  LN+  N+L S+P  + +  ++ +L+ S N LK LPE + +  NL+ +    N++  +P   G
Sbjct:  398 QFVSTVTINM-EHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIG 490          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 57.3806 bits (137), Expect = 8.799e-9
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N    +P  +  L+SL+ L   HN+L+ +   I+  +  LE L + +N++ ++ E I N   L  L    N ++ LP ++ +  +L      YN +T +PE  G+   L  L L  N L++LP  I 
Sbjct:  128 NALTSLPDSLASLESLETLDLRHNKLTEVPSVIY-KIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIG 253          

HSP 2 Score: 54.299 bits (129), Expect = 7.997e-8
Identity = 42/132 (31.82%), Postives = 72/132 (54.55%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNI--FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSIC 409
            IP  I+ L  L  L  + N+L+ +   I   ++LKKL    ++ N L S+P+S+++ E+L  L   HN L  +P  + +  +L+ +   YN+I  + E  G L KLK+L + +N++ +LP  I    S  +C
Sbjct:   87 IPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKL---GLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVC 215          

HSP 3 Score: 53.1434 bits (126), Expect = 2.145e-7
Identity = 35/101 (34.65%), Postives = 50/101 (49.50%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIP 304
            +N    +  QI  L  LK+L    N++  +   I   L  L +  V++N L  +PE I +C +L +L   HN L  LP S+ +  NL  I   YNKI  IP
Sbjct:  173 YNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIG-KLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIP 272          

HSP 4 Score: 49.6766 bits (117), Expect = 2.558e-6
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 2
Query:   35 QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            QF+ ++ I +  HNQ+S I   IF    +L  LN+  N+L S+P  + +  ++ +L+ S N LK LPE + +  NL+ +    N++  +P   G
Sbjct:  325 QFVSTVTINM-EHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIG 417          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 57.3806 bits (137), Expect = 9.032e-9
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N    +P  +  L+SL+ L   HN+L+ +   I+  +  LE L + +N++ ++ E I N   L  L    N ++ LP ++ +  +L      YN +T +PE  G+   L  L L  N L++LP  I 
Sbjct:  119 NALTSLPDSLASLESLETLDLRHNKLTEVPSVIY-KIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIG 244          

HSP 2 Score: 54.299 bits (129), Expect = 8.971e-8
Identity = 42/132 (31.82%), Postives = 72/132 (54.55%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNI--FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSIC 409
            IP  I+ L  L  L  + N+L+ +   I   ++LKKL    ++ N L S+P+S+++ E+L  L   HN L  +P  + +  +L+ +   YN+I  + E  G L KLK+L + +N++ +LP  I    S  +C
Sbjct:   78 IPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKL---GLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVC 206          

HSP 3 Score: 53.1434 bits (126), Expect = 2.283e-7
Identity = 35/101 (34.65%), Postives = 50/101 (49.50%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIP 304
            +N    +  QI  L  LK+L    N++  +   I   L  L +  V++N L  +PE I +C +L +L   HN L  LP S+ +  NL  I   YNKI  IP
Sbjct:  164 YNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIG-KLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIP 263          

HSP 4 Score: 49.6766 bits (117), Expect = 2.430e-6
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 2
Query:   35 QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            QF+ ++ I +  HNQ+S I   IF    +L  LN+  N+L S+P  + +  ++ +L+ S N LK LPE + +  NL+ +    N++  +P   G
Sbjct:  316 QFVSTVTINM-EHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIG 408          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Fly
Match: CG3040 (gene:FBgn0029925 transcript:FBtr0071038)

HSP 1 Score: 57.3806 bits (137), Expect = 3.581e-9
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N F+ +P ++  L  LK L    N+L  ++  +  +L KLE+L +  N L  +P++++NC +L  ++ S+N LK  P  L   K L  +    NKITD+P   G  + +  L L++NQ++ L E+++
Sbjct:   48 NRFERVPDELGKLTLLKHLNLSGNRLVELN-EVVGELAKLEVLLLMDNMLTRLPKTLANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDLSRNKITDVPADVG-GLFVTELNLNQNQISSLAEEVA 172          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Fly
Match: Lap1 (gene:FBgn0033984 transcript:FBtr0087407)

HSP 1 Score: 57.7658 bits (138), Expect = 9.123e-9
Identity = 47/163 (28.83%), Postives = 75/163 (46.01%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNI----------------------FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS*ARKQ 427
            N F E+P  +  LKSL+ L    NQ+  +  NI                        + + +E+L++  N L + P S+   ++L    C  N L  LP+S+S  + L+E+   +NK+  +P T G L  L+ L    NQL  LP+++ S    S+ S A  Q
Sbjct:  188 NEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQ 350          

HSP 2 Score: 54.299 bits (129), Expect = 1.305e-7
Identity = 40/124 (32.26%), Postives = 73/124 (58.87%), Query Frame = 2
Query:   11 FKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
             + +P Q+ + + L++L  + N L +I   I   L++L+ L++N N + ++PE I +C++L  L  S NSL+ LP++++   +LQE+      +  +P  FG L+ L+IL L  N L  LP+ +
Sbjct:   52 LQALPPQLFYCQGLRVLHVNSNNLESIPQAIG-SLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSM 174          

HSP 3 Score: 50.447 bits (119), Expect = 2.088e-6
Identity = 31/104 (29.81%), Postives = 52/104 (50.00%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            N  +  P  +  LKSL    C  N L+ +  +I   L++LE L ++ NKL  +P +I    +L  L    N L+ LP+ L  C+ L  +    N+++ +P+  G
Sbjct:  257 NSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISY-LEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNIG 359          

HSP 4 Score: 50.447 bits (119), Expect = 2.125e-6
Identity = 42/139 (30.22%), Postives = 69/139 (49.64%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSH---SICS 412
            N  + +P  I  L SL+ L+ +   L  +  N F  L  L IL +  N L ++P+S+    NL +L    N    LPE + + K+L+E+   +N+I  +    G+L  L+    + N L  LP ++S+  +    SICS
Sbjct:  119 NSLQRLPDAITSLISLQELLLNETYLEFLPAN-FGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICS 256          

HSP 5 Score: 50.0618 bits (118), Expect = 2.667e-6
Identity = 36/127 (28.35%), Postives = 67/127 (52.76%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            NL   +P ++   +++++L    N L    +++ + LK L       N L  +P+SIS  E L +L  SHN L  LP ++   ++L+ + A  N++  +P+      +L +L +  NQL+ LP++I 
Sbjct:  234 NLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGM-LKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNIG 359          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Fly
Match: Lap1 (gene:FBgn0033984 transcript:FBtr0303759)

HSP 1 Score: 57.7658 bits (138), Expect = 9.123e-9
Identity = 47/163 (28.83%), Postives = 75/163 (46.01%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNI----------------------FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS*ARKQ 427
            N F E+P  +  LKSL+ L    NQ+  +  NI                        + + +E+L++  N L + P S+   ++L    C  N L  LP+S+S  + L+E+   +NK+  +P T G L  L+ L    NQL  LP+++ S    S+ S A  Q
Sbjct:  188 NEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQ 350          

HSP 2 Score: 54.299 bits (129), Expect = 1.305e-7
Identity = 40/124 (32.26%), Postives = 73/124 (58.87%), Query Frame = 2
Query:   11 FKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
             + +P Q+ + + L++L  + N L +I   I   L++L+ L++N N + ++PE I +C++L  L  S NSL+ LP++++   +LQE+      +  +P  FG L+ L+IL L  N L  LP+ +
Sbjct:   52 LQALPPQLFYCQGLRVLHVNSNNLESIPQAIG-SLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSM 174          

HSP 3 Score: 50.447 bits (119), Expect = 2.088e-6
Identity = 31/104 (29.81%), Postives = 52/104 (50.00%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            N  +  P  +  LKSL    C  N L+ +  +I   L++LE L ++ NKL  +P +I    +L  L    N L+ LP+ L  C+ L  +    N+++ +P+  G
Sbjct:  257 NSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISY-LEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNIG 359          

HSP 4 Score: 50.447 bits (119), Expect = 2.125e-6
Identity = 42/139 (30.22%), Postives = 69/139 (49.64%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSH---SICS 412
            N  + +P  I  L SL+ L+ +   L  +  N F  L  L IL +  N L ++P+S+    NL +L    N    LPE + + K+L+E+   +N+I  +    G+L  L+    + N L  LP ++S+  +    SICS
Sbjct:  119 NSLQRLPDAITSLISLQELLLNETYLEFLPAN-FGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICS 256          

HSP 5 Score: 50.0618 bits (118), Expect = 2.667e-6
Identity = 36/127 (28.35%), Postives = 67/127 (52.76%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            NL   +P ++   +++++L    N L    +++ + LK L       N L  +P+SIS  E L +L  SHN L  LP ++   ++L+ + A  N++  +P+      +L +L +  NQL+ LP++I 
Sbjct:  234 NLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGM-LKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNIG 359          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335521)

HSP 1 Score: 57.7658 bits (138), Expect = 1.210e-8
Identity = 42/126 (33.33%), Postives = 62/126 (49.21%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N   +IP  I+ L+SL++     N +  +    F  LK L +L +N   L ++P    +   L  L    N LK LPE++SQ   L+ +  G N+I D+P   G L  L  L L  NQL  LP ++
Sbjct:   93 NDIPDIPDDIKHLQSLQVADFSSNPIPKLPSG-FSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPEL 217          

HSP 2 Score: 54.6842 bits (130), Expect = 1.103e-7
Identity = 39/128 (30.47%), Postives = 65/128 (50.78%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            N  +E+P +I  L SL  L    N L  +   I   L +L IL ++ N+L  + +++ NCEN+ +L  + N L  LP S+ Q   L  ++   N +  +P   G+   L +L L  N+L  LP ++ +
Sbjct:  231 NRLEELPNEISGLVSLTDLDLAQNLLEALPDGI-AKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGN 357          

HSP 3 Score: 51.6026 bits (122), Expect = 1.158e-6
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  +++P  + +L  L  L   HNQL  +   + + L KL  L+V+ N+L  +P  IS   +L  L  + N L++LP+ +++   L  +    N++  + +T G    ++ LIL +N L++LP  I
Sbjct:  185 NEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGL-LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASI 309          

HSP 4 Score: 50.0618 bits (118), Expect = 3.258e-6
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLP 373
            NL + +P  I  L  L IL    N+L  ++ +   + + ++ L +  N L  +P SI     L  L+   N+L+ LP  + QC NL  +    NK+  +P   G    L +L +  NQL  LP
Sbjct:  254 NLLEALPDGIAKLSRLTILKLDQNRLQRLN-DTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLP 375          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308630)

HSP 1 Score: 57.7658 bits (138), Expect = 1.214e-8
Identity = 42/126 (33.33%), Postives = 62/126 (49.21%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N   +IP  I+ L+SL++     N +  +    F  LK L +L +N   L ++P    +   L  L    N LK LPE++SQ   L+ +  G N+I D+P   G L  L  L L  NQL  LP ++
Sbjct:   93 NDIPDIPDDIKHLQSLQVADFSSNPIPKLPSG-FSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPEL 217          

HSP 2 Score: 54.6842 bits (130), Expect = 1.107e-7
Identity = 39/128 (30.47%), Postives = 65/128 (50.78%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            N  +E+P +I  L SL  L    N L  +   I   L +L IL ++ N+L  + +++ NCEN+ +L  + N L  LP S+ Q   L  ++   N +  +P   G+   L +L L  N+L  LP ++ +
Sbjct:  231 NRLEELPNEISGLVSLTDLDLAQNLLEALPDGI-AKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGN 357          

HSP 3 Score: 51.6026 bits (122), Expect = 1.162e-6
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  +++P  + +L  L  L   HNQL  +   + + L KL  L+V+ N+L  +P  IS   +L  L  + N L++LP+ +++   L  +    N++  + +T G    ++ LIL +N L++LP  I
Sbjct:  185 NEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGL-LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASI 309          

HSP 4 Score: 50.0618 bits (118), Expect = 3.268e-6
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLP 373
            NL + +P  I  L  L IL    N+L  ++ +   + + ++ L +  N L  +P SI     L  L+   N+L+ LP  + QC NL  +    NK+  +P   G    L +L +  NQL  LP
Sbjct:  254 NLLEALPDGIAKLSRLTILKLDQNRLQRLN-DTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLP 375          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Zebrafish
Match: si:ch73-302o18.2 (si:ch73-302o18.2 [Source:ZFIN;Acc:ZDB-GENE-120215-213])

HSP 1 Score: 98.5969 bits (244), Expect = 1.027e-22
Identity = 50/149 (33.56%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  592 SLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL 1038
            +L++LDVA N + V P +   ++L E  +E N L+    + S Q  E++ L EL+ R++  E  N  S ++  L  +P +Q+ML    +C LC   +   W+ECV+F   N +      SS+++P+R  +CS  CF+  +HQ+YG+  L
Sbjct:  198 NLKILDVAGNRLSVFPFDFQFLTLDELFFEGNSLVPFSLMESIQEKEILTLKELSARLILQESTNILSAVYRSLPMYPELQDMLSHWSQCALCSQPFLTTWLECVQF--INTRKHMGMKSSQSVPVRVVLCSYDCFNRDDHQYYGLVRL 344          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Zebrafish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 72.7886 bits (177), Expect = 2.295e-13
Identity = 47/129 (36.43%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LKKL IL VN N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G  + L +L L  N+L  LP ++++A
Sbjct:  230 NRLSELPTEISGLIALTDLLLSENLLEILPDSIG-SLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLSLRDNRLGKLPPELANA 357          

HSP 2 Score: 50.0618 bits (118), Expect = 4.395e-6
Identity = 39/136 (28.68%), Postives = 71/136 (52.21%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS 412
            N    +P ++  L+ L  L    N+LS +   I   L  L  L ++ N L  +P+SI + + L  L  + N L  L +S+ +C+NL E+    N +  +P + G+L KL  L + +N+L+ +P ++   +S ++ S
Sbjct:  207 NQLSSLPPELGNLRQLVCLDVSENRLSELPTEIS-GLIALTDLLLSENLLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLS 341          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Zebrafish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 72.7886 bits (177), Expect = 2.659e-13
Identity = 47/129 (36.43%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LKKL IL VN N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G  + L +L L  N+L  LP ++++A
Sbjct:  230 NRLSELPTEISGLIALTDLLLSENLLEILPDSIG-SLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLSLRDNRLGKLPPELANA 357          

HSP 2 Score: 49.6766 bits (117), Expect = 4.906e-6
Identity = 39/136 (28.68%), Postives = 71/136 (52.21%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS 412
            N    +P ++  L+ L  L    N+LS +   I   L  L  L ++ N L  +P+SI + + L  L  + N L  L +S+ +C+NL E+    N +  +P + G+L KL  L + +N+L+ +P ++   +S ++ S
Sbjct:  207 NQLSSLPPELGNLRQLVCLDVSENRLSELPTEI-SGLIALTDLLLSENLLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLS 341          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Zebrafish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 72.7886 bits (177), Expect = 2.847e-13
Identity = 47/129 (36.43%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LKKL IL VN N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G  + L +L L  N+L  LP ++++A
Sbjct:  230 NRLSELPTEISGLIALTDLLLSENLLEILPDSIG-SLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLSLRDNRLGKLPPELANA 357          

HSP 2 Score: 49.6766 bits (117), Expect = 5.294e-6
Identity = 39/136 (28.68%), Postives = 71/136 (52.21%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS 412
            N    +P ++  L+ L  L    N+LS +   I   L  L  L ++ N L  +P+SI + + L  L  + N L  L +S+ +C+NL E+    N +  +P + G+L KL  L + +N+L+ +P ++   +S ++ S
Sbjct:  207 NQLSSLPPELGNLRQLVCLDVSENRLSELPTEI-SGLIALTDLLLSENLLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLS 341          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Zebrafish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 72.7886 bits (177), Expect = 2.868e-13
Identity = 47/129 (36.43%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LKKL IL VN N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G  + L +L L  N+L  LP ++++A
Sbjct:  230 NRLSELPTEISGLIALTDLLLSENLLEILPDSIG-SLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLSLRDNRLGKLPPELANA 357          

HSP 2 Score: 49.6766 bits (117), Expect = 5.320e-6
Identity = 39/136 (28.68%), Postives = 71/136 (52.21%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS 412
            N    +P ++  L+ L  L    N+LS +   I   L  L  L ++ N L  +P+SI + + L  L  + N L  L +S+ +C+NL E+    N +  +P + G+L KL  L + +N+L+ +P ++   +S ++ S
Sbjct:  207 NQLSSLPPELGNLRQLVCLDVSENRLSELPTEI-SGLIALTDLLLSENLLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLS 341          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Xenopus
Match: lrrc69 (leucine rich repeat containing 69 [Source:NCBI gene;Acc:100135150])

HSP 1 Score: 106.686 bits (265), Expect = 2.499e-25
Identity = 52/153 (33.99%), Postives = 91/153 (59.48%), Query Frame = 1
Query:  574 NMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
             +  ++ L++LDVA N I+  PS ++++ L+E + E NPLL   PV + Q +E++ L E+  R++   L ++ S+   ++R  P  + +L     C LCG  + D+W+ECV F     K++++ N  + LPIR  +CS  CF+ +E+  +GVA
Sbjct:  192 GICKLIKLKILDVAGNYIRSFPSAMHKVPLTELYCEENPLLEKLPVFASQQEEILTLKEITARLILNHLLSRYSFFREQVRQHPEARSVLSSRNICALCGRWFLDMWLECVTFVDVKKKMKTSSN-VQLLPIRVLLCSHRCFNQRENGIFGVA 343          

HSP 2 Score: 57.7658 bits (138), Expect = 1.141e-8
Identity = 48/126 (38.10%), Postives = 73/126 (57.94%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N F+++P +I++LKSL+ L    N+++ I   +F  L  L  LN+N N L  +P  I   E L  L  +HN LK +P+ L   +N++E+H   N++  +P+  G L  LK L L +NQL  LPE I
Sbjct:   68 NHFEKVPEEIKYLKSLERLHLFGNRITEIPAAVFDGLGNLLFLNLNNNLLEHLPREIYKLERLEMLSINHNHLKGVPKELCLLQNIKELHLADNQLDSLPDEMGYLTNLKELRLSRNQLTGLPEGI 193          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Xenopus
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:395020])

HSP 1 Score: 72.0182 bits (175), Expect = 4.023e-13
Identity = 54/127 (42.52%), Postives = 72/127 (56.69%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   EIP  I F K+L++     N L+ +  + F DL  L  L++N   L  +PE+I N  NL  L    N L  LPESL+Q   L+E+  G N++ ++PET G L KLK L L  NQLADLP +I 
Sbjct:   92 NEIPEIPESISFCKALQVADFSGNPLTRLP-DSFPDLASLTCLSINDISLQVLPENIGNLSNLVSLELRENLLTFLPESLAQLHRLEELDIGNNELYNLPETIGSLYKLKDLWLDGNQLADLPPEIG 217          

HSP 2 Score: 57.7658 bits (138), Expect = 1.544e-8
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  + +P +I  LKSL  L+  HN +  +   I   LK L IL V+ N+L  + + I  CE+L +L  + N L  LP S+ + K L  ++   NK+  +P+  G    L +  + +N+L+ +P +I+ A
Sbjct:  230 NKLERLPEEISGLKSLTDLLVSHNSIEVLPDGIG-KLKNLSILKVDQNRLMQLTDCIGECESLTELILTENQLLVLPRSIGKLKKLCNLNIDRNKLMSLPKEIGGCCGLNVFCVRENRLSRIPSEIAKA 357          

HSP 3 Score: 55.8398 bits (133), Expect = 6.421e-8
Identity = 45/122 (36.89%), Postives = 66/122 (54.10%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P  I  L  LK L    NQL+++   I   LK L  L+++ NKL  +PE IS  ++L  L  SHNS++ LP+ + + KNL  +    N++  + +  GE   L  LIL +NQL  LP  I 
Sbjct:  189 LPETIGSLYKLKDLWLDGNQLADLPPEIG-HLKNLLCLDLSENKLERLPEEISGLKSLTDLLVSHNSIEVLPDGIGKLKNLSILKVDQNRLMQLTDCIGECESLTELILTENQLLVLPRSIG 309          

HSP 4 Score: 51.6026 bits (122), Expect = 1.326e-6
Identity = 41/123 (33.33%), Postives = 67/123 (54.47%), Query Frame = 2
Query:   20 IPIQI-QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P +I ++ +SL+ L+   NQL  +    F  L KL  L ++ N++  +P  I+N   L +L  S N +  +PES+S CK LQ      N +T +P++F +L  L  L ++   L  LPE+I 
Sbjct:   27 VPEEIYRYSRSLEELLLDANQLRELPKQFF-QLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPDSFPDLASLTCLSINDISLQVLPENIG 148          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Xenopus
Match: SCRIB (scribbled planar cell polarity protein [Source:NCBI gene;Acc:100494581])

HSP 1 Score: 68.1662 bits (165), Expect = 9.813e-12
Identity = 44/129 (34.11%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  +++P +I  L SL  L+   NQLS++  ++   LK+L IL V+ N+L  + ESI +CENL ++  + N L  LP+S+     L  ++   N++  +P   G    L +L L  NQL+ LP +++ A
Sbjct:   90 NKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLG-QLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLSLRDNQLSALPPELAGA 217          

HSP 2 Score: 54.6842 bits (130), Expect = 1.945e-7
Identity = 36/105 (34.29%), Postives = 57/105 (54.29%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGE 319
            N  + +P  +  L +L+ L    NQLS++   +  +L++L  L+V+ NKL  +P  IS   +L  L  S N L SLP SL Q K L  +    N++T + E+ G+
Sbjct:   44 NDLQVLPDTLGALPNLRELWLDRNQLSSLPSELG-NLRRLVCLDVSENKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGD 147          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Xenopus
Match: SCRIB (scribbled planar cell polarity protein [Source:NCBI gene;Acc:100494581])

HSP 1 Score: 67.781 bits (164), Expect = 1.095e-11
Identity = 44/129 (34.11%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  +++P +I  L SL  L+   NQLS++  ++   LK+L IL V+ N+L  + ESI +CENL ++  + N L  LP+S+     L  ++   N++  +P   G    L +L L  NQL+ LP +++ A
Sbjct:   96 NKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLG-QLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLSLRDNQLSALPPELAGA 223          

HSP 2 Score: 54.6842 bits (130), Expect = 1.879e-7
Identity = 36/105 (34.29%), Postives = 57/105 (54.29%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGE 319
            N  + +P  +  L +L+ L    NQLS++   +  +L++L  L+V+ NKL  +P  IS   +L  L  S N L SLP SL Q K L  +    N++T + E+ G+
Sbjct:   50 NDLQVLPDTLGALPNLRELWLDRNQLSSLPSELG-NLRRLVCLDVSENKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGD 153          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Xenopus
Match: SCRIB (scribbled planar cell polarity protein [Source:NCBI gene;Acc:100494581])

HSP 1 Score: 67.781 bits (164), Expect = 1.119e-11
Identity = 44/129 (34.11%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  +++P +I  L SL  L+   NQLS++  ++   LK+L IL V+ N+L  + ESI +CENL ++  + N L  LP+S+     L  ++   N++  +P   G    L +L L  NQL+ LP +++ A
Sbjct:   33 NKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLG-QLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLSLRDNQLSALPPELAGA 160          

HSP 2 Score: 49.6766 bits (117), Expect = 5.913e-6
Identity = 32/87 (36.78%), Postives = 48/87 (55.17%), Query Frame = 2
Query:   59 LICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGE 319
            L    NQLS++   +  +L++L  L+V+ NKL  +P  IS   +L  L  S N L SLP SL Q K L  +    N++T + E+ G+
Sbjct:    5 LWLDRNQLSSLPSELG-NLRRLVCLDVSENKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGD 90          

HSP 3 Score: 49.2914 bits (116), Expect = 8.103e-6
Identity = 43/136 (31.62%), Postives = 67/136 (49.26%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS 412
            N    +P ++  L+ L  L    N+L  +   I   L  L  L ++ N+L S+P S+   + L  L    N L  L ES+  C+NL EI    N +T +P++ G L KL  L + +N+L  LP +I    S ++ S
Sbjct:   10 NQLSSLPSELGNLRRLVCLDVSENKLEQLPAEIS-GLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLS 144          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Mouse
Match: Lrrc69 (leucine rich repeat containing 69 [Source:MGI Symbol;Acc:MGI:1920564])

HSP 1 Score: 85.8853 bits (211), Expect = 3.109e-18
Identity = 46/167 (27.54%), Postives = 87/167 (52.10%), Query Frame = 1
Query:  532 QKLIKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
            Q  + +  IE +   +  +  LRVLD+A N IQ+ P+    + L+EF+ E NPL    P  + Q  ++  L E+A R +   L+     +   +  +P V++ L ++ +C +C   +   W+ECV F   +   + ++N  K +P++ ++CS  CF  ++   +G+A
Sbjct:  180 QLFLVRNNIEELPEEICHLEKLRVLDIAGNVIQIFPAGFQNLRLTEFYCEGNPLFLKRPFFAVQPKDLWTLREIAARFVLSLLEENDPLIMNVIESYPEVKDKLSKAKKCSICRKPFLTEWLECVYFVAPSKNWKISRN-LKLIPVQTSVCSYQCFDQRDPDVFGIA 345          

HSP 2 Score: 68.9366 bits (167), Expect = 1.690e-12
Identity = 46/126 (36.51%), Postives = 74/126 (58.73%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  +E+P +I++L SLK L    N++  I   +F  L +L +LN+N N+L S+P+ I    +L  L  + N+L  +P+ L   ++L E+H  YN+I  IPE    L  L+ L L +N + +LPE+I
Sbjct:   70 NHLQEVPEEIKYLTSLKNLHLFGNRICRIAPGVFNGLHRLIMLNLNDNRLTSLPQEIGRLRSLTYLSLNRNNLTVIPKELCSLEHLSELHLNYNQIVYIPEEIKFLKNLQQLFLVRNNIEELPEEI 195          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Mouse
Match: Lrrc69 (leucine rich repeat containing 69 [Source:MGI Symbol;Acc:MGI:1920564])

HSP 1 Score: 85.8853 bits (211), Expect = 3.109e-18
Identity = 46/167 (27.54%), Postives = 87/167 (52.10%), Query Frame = 1
Query:  532 QKLIKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
            Q  + +  IE +   +  +  LRVLD+A N IQ+ P+    + L+EF+ E NPL    P  + Q  ++  L E+A R +   L+     +   +  +P V++ L ++ +C +C   +   W+ECV F   +   + ++N  K +P++ ++CS  CF  ++   +G+A
Sbjct:  180 QLFLVRNNIEELPEEICHLEKLRVLDIAGNVIQIFPAGFQNLRLTEFYCEGNPLFLKRPFFAVQPKDLWTLREIAARFVLSLLEENDPLIMNVIESYPEVKDKLSKAKKCSICRKPFLTEWLECVYFVAPSKNWKISRN-LKLIPVQTSVCSYQCFDQRDPDVFGIA 345          

HSP 2 Score: 68.9366 bits (167), Expect = 1.690e-12
Identity = 46/126 (36.51%), Postives = 74/126 (58.73%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  +E+P +I++L SLK L    N++  I   +F  L +L +LN+N N+L S+P+ I    +L  L  + N+L  +P+ L   ++L E+H  YN+I  IPE    L  L+ L L +N + +LPE+I
Sbjct:   70 NHLQEVPEEIKYLTSLKNLHLFGNRICRIAPGVFNGLHRLIMLNLNDNRLTSLPQEIGRLRSLTYLSLNRNNLTVIPKELCSLEHLSELHLNYNQIVYIPEEIKFLKNLQQLFLVRNNIEELPEEI 195          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Mouse
Match: Lrrc1 (leucine rich repeat containing 1 [Source:MGI Symbol;Acc:MGI:2442313])

HSP 1 Score: 72.0182 bits (175), Expect = 1.954e-13
Identity = 51/127 (40.16%), Postives = 76/127 (59.84%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   EIP  I F K+L++     N L+ +  + F +L+ L  L+VN   L S+PE+I N  NL  L    N L  LP+SL+Q + L+E+  G N+I ++PE+ G L+ LK L L  NQL++LP++I 
Sbjct:   92 NDIPEIPESIAFCKALQVADFSGNPLTRLPES-FPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIG 217          

HSP 2 Score: 55.0694 bits (131), Expect = 6.064e-8
Identity = 42/123 (34.15%), Postives = 67/123 (54.47%), Query Frame = 2
Query:   20 IPIQI-QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P +I ++ +SL+ L+   NQL  +    F  L KL  L ++ N++  +P  I+N   L +L  S N +  +PES++ CK LQ      N +T +PE+F EL  L  L ++   L  LPE+I 
Sbjct:   27 VPEEIYRYARSLEELLLDANQLRELPEQFF-QLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIG 148          

HSP 3 Score: 53.1434 bits (126), Expect = 2.545e-7
Identity = 33/101 (32.67%), Postives = 55/101 (54.46%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPE 307
            N  + +P +I  L SL  L+   N L  I   I    K   +  ++ N+L  +PE+I +CENL +L  + N L +LP+S+ + K L  ++A  NK+  +P+
Sbjct:  230 NRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSIL-KLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPK 329          

HSP 4 Score: 51.6026 bits (122), Expect = 7.056e-7
Identity = 44/122 (36.07%), Postives = 66/122 (54.10%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P  I  L  LK L    NQLS +   I  +LK L  L+V+ N+L  +PE IS   +L  L  S N L+++PE + + K L  +    N++T +PE  G+   L  L+L +N+L  LP+ I 
Sbjct:  189 LPESIGALLHLKDLWLDGNQLSELPQEIG-NLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIG 309          

HSP 5 Score: 49.6766 bits (117), Expect = 3.427e-6
Identity = 42/125 (33.60%), Postives = 65/125 (52.00%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPED 379
            N   E+P +I  LK+L  L    N+L  +   I   L  L  L ++ N L +IPE I   + L  L    N L  LPE++  C+NL E+    N++  +P++ G+L KL  L   +N+L  LP++
Sbjct:  207 NQLSELPQEIGNLKNLLCLDVSENRLERLPEEIS-GLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKE 330          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Mouse
Match: Lrrc1 (leucine rich repeat containing 1 [Source:MGI Symbol;Acc:MGI:2442313])

HSP 1 Score: 72.0182 bits (175), Expect = 2.750e-13
Identity = 51/127 (40.16%), Postives = 76/127 (59.84%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   EIP  I F K+L++     N L+ +  + F +L+ L  L+VN   L S+PE+I N  NL  L    N L  LP+SL+Q + L+E+  G N+I ++PE+ G L+ LK L L  NQL++LP++I 
Sbjct:   47 NDIPEIPESIAFCKALQVADFSGNPLTRLPES-FPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIG 172          

HSP 2 Score: 62.003 bits (149), Expect = 5.457e-10
Identity = 41/130 (31.54%), Postives = 69/130 (53.08%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSAL 394
            N  + +P +I  L SL  L+   N L  I   I    K   +  ++ N+L  +PE+I +CENL +L  + N L +LP+S+ + K L  ++A  NK+  +P+  G    L +  +  N+L  LP ++S A+
Sbjct:  185 NRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSIL-KLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAV 313          

HSP 3 Score: 51.9878 bits (123), Expect = 7.191e-7
Identity = 43/128 (33.59%), Postives = 66/128 (51.56%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            N   E+P +I  LK+L  L    N+L  +   I   L  L  L ++ N L +IPE I   + L  L    N L  LPE++  C+NL E+    N++  +P++ G+L KL  L   +N+L  LP++I  
Sbjct:  162 NQLSELPQEIGNLKNLLCLDVSENRLERLPEEIS-GLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGG 288          

HSP 4 Score: 51.9878 bits (123), Expect = 8.282e-7
Identity = 44/122 (36.07%), Postives = 66/122 (54.10%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P  I  L  LK L    NQLS +   I  +LK L  L+V+ N+L  +PE IS   +L  L  S N L+++PE + + K L  +    N++T +PE  G+   L  L+L +N+L  LP+ I 
Sbjct:  144 LPESIGALLHLKDLWLDGNQLSELPQEIG-NLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIG 264          

HSP 5 Score: 48.521 bits (114), Expect = 9.345e-6
Identity = 34/94 (36.17%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  104 FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            F  L KL  L ++ N++  +P  I+N   L +L  S N +  +PES++ CK LQ      N +T +PE+F EL  L  L ++   L  LPE+I 
Sbjct:   10 FFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIG 103          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Mouse
Match: Lrrc1 (leucine rich repeat containing 1 [Source:MGI Symbol;Acc:MGI:2442313])

HSP 1 Score: 72.0182 bits (175), Expect = 3.395e-13
Identity = 51/127 (40.16%), Postives = 76/127 (59.84%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   EIP  I F K+L++     N L+ +  + F +L+ L  L+VN   L S+PE+I N  NL  L    N L  LP+SL+Q + L+E+  G N+I ++PE+ G L+ LK L L  NQL++LP++I 
Sbjct:   92 NDIPEIPESIAFCKALQVADFSGNPLTRLPES-FPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIG 217          

HSP 2 Score: 61.6178 bits (148), Expect = 6.267e-10
Identity = 41/130 (31.54%), Postives = 69/130 (53.08%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSAL 394
            N  + +P +I  L SL  L+   N L  I   I    K   +  ++ N+L  +PE+I +CENL +L  + N L +LP+S+ + K L  ++A  NK+  +P+  G    L +  +  N+L  LP ++S A+
Sbjct:  230 NRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSIL-KLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAV 358          

HSP 3 Score: 55.0694 bits (131), Expect = 9.960e-8
Identity = 42/123 (34.15%), Postives = 67/123 (54.47%), Query Frame = 2
Query:   20 IPIQI-QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P +I ++ +SL+ L+   NQL  +    F  L KL  L ++ N++  +P  I+N   L +L  S N +  +PES++ CK LQ      N +T +PE+F EL  L  L ++   L  LPE+I 
Sbjct:   27 VPEEIYRYARSLEELLLDANQLRELPEQFF-QLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIG 148          

HSP 4 Score: 51.9878 bits (123), Expect = 9.029e-7
Identity = 43/128 (33.59%), Postives = 66/128 (51.56%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            N   E+P +I  LK+L  L    N+L  +   I   L  L  L ++ N L +IPE I   + L  L    N L  LPE++  C+NL E+    N++  +P++ G+L KL  L   +N+L  LP++I  
Sbjct:  207 NQLSELPQEIGNLKNLLCLDVSENRLERLPEEIS-GLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGG 333          

HSP 5 Score: 51.6026 bits (122), Expect = 9.603e-7
Identity = 44/122 (36.07%), Postives = 66/122 (54.10%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P  I  L  LK L    NQLS +   I  +LK L  L+V+ N+L  +PE IS   +L  L  S N L+++PE + + K L  +    N++T +PE  G+   L  L+L +N+L  LP+ I 
Sbjct:  189 LPESIGALLHLKDLWLDGNQLSELPQEIG-NLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIG 309          
BLAST of leucine-rich repeat-containing protein 69-like vs. UniProt/SwissProt
Match: sp|Q6ZNQ3|LRC69_HUMAN (Leucine-rich repeat-containing protein 69 OS=Homo sapiens OX=9606 GN=LRRC69 PE=2 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 1.035e-25
Identity = 54/159 (33.96%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  556 IEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
            I V+   + D+  LR+LD+A N IQ+ PS   ++ L EF+ E NPL   +PV S Q + V  L E+  R +  +L     +L   +  +P V+ M+ Q   C +CG  +  +W+ECVRF    PK      + K +P++  ICS  CF+ ++   +G+A
Sbjct:  188 IGVLPEELCDLKKLRILDIAGNIIQIFPSGFQDLKLREFYCEGNPLFLQQPVISTQQENVWSLQEITSRFVMNQLAENNPFLMDDIERYPQVRSMISQGKTCAICGQYFITVWLECVRFVPP-PKDWKISKNLKLVPLQVLICSYKCFTQRDPNLFGIA 345          
BLAST of leucine-rich repeat-containing protein 69-like vs. UniProt/SwissProt
Match: sp|Q3KQF4|LRC69_XENLA (Leucine-rich repeat-containing protein 69 OS=Xenopus laevis OX=8355 GN=lrrc69 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.198e-25
Identity = 51/153 (33.33%), Postives = 92/153 (60.13%), Query Frame = 1
Query:  574 NMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
             +  ++ L++LDVA N I+  PS ++ + L+E + E NPLL  +PV +RQ +E++ L E+  R++   L+++ S+   +++  P  + +L     C LCG  + D+W+ECV F     K++++ N  + LP+R  +CS  CF+ K+   +GVA
Sbjct:  192 GICKLIKLKILDVAGNFIRSFPSAMHRVPLTELYCEENPLLEKQPVFARQQEEILTLKEITARLILNHLRSRNSFFIEQIQQHPEARSVLSSRNICALCGTWFLDMWLECVTFVDVKKKMKTSSN-LQLLPVRVLLCSYRCFNQKQAGIFGVA 343          
BLAST of leucine-rich repeat-containing protein 69-like vs. UniProt/SwissProt
Match: sp|Q9D9Q0|LRC69_MOUSE (Leucine-rich repeat-containing protein 69 OS=Mus musculus OX=10090 GN=Lrrc69 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.174e-17
Identity = 46/167 (27.54%), Postives = 87/167 (52.10%), Query Frame = 1
Query:  532 QKLIKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
            Q  + +  IE +   +  +  LRVLD+A N IQ+ P+    + L+EF+ E NPL    P  + Q  ++  L E+A R +   L+     +   +  +P V++ L ++ +C +C   +   W+ECV F   +   + ++N  K +P++ ++CS  CF  ++   +G+A
Sbjct:  180 QLFLVRNNIEELPEEICHLEKLRVLDIAGNVIQIFPAGFQNLRLTEFYCEGNPLFLKRPFFAVQPKDLWTLREIAARFVLSLLEENDPLIMNVIESYPEVKDKLSKAKKCSICRKPFLTEWLECVYFVAPSKNWKISRN-LKLIPVQTSVCSYQCFDQRDPDVFGIA 345          

HSP 2 Score: 68.9366 bits (167), Expect = 1.182e-11
Identity = 46/126 (36.51%), Postives = 74/126 (58.73%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  +E+P +I++L SLK L    N++  I   +F  L +L +LN+N N+L S+P+ I    +L  L  + N+L  +P+ L   ++L E+H  YN+I  IPE    L  L+ L L +N + +LPE+I
Sbjct:   70 NHLQEVPEEIKYLTSLKNLHLFGNRICRIAPGVFNGLHRLIMLNLNDNRLTSLPQEIGRLRSLTYLSLNRNNLTVIPKELCSLEHLSELHLNYNQIVYIPEEIKFLKNLQQLFLVRNNIEELPEEI 195          
BLAST of leucine-rich repeat-containing protein 69-like vs. UniProt/SwissProt
Match: sp|Q9BTT6|LRRC1_HUMAN (Leucine-rich repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRC1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.002e-12
Identity = 51/127 (40.16%), Postives = 76/127 (59.84%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   EIP  I F K+L++     N L+ +  + F +L+ L  L+VN   L S+PE+I N  NL  L    N L  LP+SL+Q + L+E+  G N+I ++PE+ G L+ LK L L  NQL++LP++I 
Sbjct:   92 NEIPEIPESISFCKALQVADFSGNPLTRLPES-FPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIG 217          

HSP 2 Score: 70.8626 bits (172), Expect = 4.496e-12
Identity = 44/129 (34.11%), Postives = 71/129 (55.04%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  + +P +I  L SL  L+   N L  I   I   LKKL IL V+ N+L  +PE++  CE+L +L  + N L +LP+S+ + K L  ++A  NK+  +P+  G    L +  +  N+L  +P ++S A
Sbjct:  230 NRLERLPEEISGLTSLTDLVISQNLLETIPDGIG-KLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQA 357          

HSP 3 Score: 59.6918 bits (143), Expect = 1.865e-8
Identity = 45/122 (36.89%), Postives = 66/122 (54.10%), Query Frame = 2
Query:   20 IPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P  I  L  LK L    NQLS +   I  +LK L  L+V+ N+L  +PE IS   +L  L  S N L+++P+ + + K L  +    N++T +PE  GE   L  L+L +NQL  LP+ I 
Sbjct:  189 LPESIGALLHLKDLWLDGNQLSELPQEIG-NLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIG 309          

HSP 4 Score: 55.8398 bits (133), Expect = 3.688e-7
Identity = 43/123 (34.96%), Postives = 67/123 (54.47%), Query Frame = 2
Query:   20 IPIQI-QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +P +I ++ +SL+ L+   NQL  +    F  L KL  L ++ N++  +P  I+N   L +L  S N +  +PES+S CK LQ      N +T +PE+F EL  L  L ++   L  LPE+I 
Sbjct:   27 VPEEIYRYARSLEELLLDANQLRELPEQFF-QLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIG 148          

HSP 5 Score: 54.299 bits (129), Expect = 1.194e-6
Identity = 42/134 (31.34%), Postives = 70/134 (52.24%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSI 406
            N   E+P +I  LK+L  L    N+L  +   I   L  L  L ++ N L +IP+ I   + L  L    N L  LPE++ +C++L E+    N++  +P++ G+L KL  L   +N+L  LP++I    S ++
Sbjct:  207 NQLSELPQEIGNLKNLLCLDVSENRLERLPEEIS-GLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTV 339          
BLAST of leucine-rich repeat-containing protein 69-like vs. UniProt/SwissProt
Match: sp|Q4H4B6|SCRIB_DANRE (Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.150e-12
Identity = 47/129 (36.43%), Postives = 73/129 (56.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LKKL IL VN N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G  + L +L L  N+L  LP ++++A
Sbjct:  230 NRLSELPTEISGLIALTDLLLSENLLEILPDSIG-SLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLSLRDNRLGKLPPELANA 357          
BLAST of leucine-rich repeat-containing protein 69-like vs. TrEMBL
Match: V3ZVB5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_221760 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.766e-33
Identity = 69/167 (41.32%), Postives = 110/167 (65.87%), Query Frame = 1
Query:  538 LIKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRF--EKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
            L+K ++ E+ + ++     LR+LD+AAN +++ P+E+  + L E H E NPLL   PV S Q +EV+ L E+  R +  EL+++ SYL  ++RH+P +++ML QS +C LCG ++ + W+ECV+F   K+N K+   KN S  +P+RA +CS  CF+S  H +YGVA
Sbjct:  181 LLKNKIRELPE-SIGKCYKLRILDIAANELRIFPTEIANLPLKELHCEENPLLQHVPVHSVQEEEVLALKEITARFVMKELKDRWSYLRKRIRHYPDIRDMLSQSSKCALCGESFLNTWLECVQFISTKQNIKV---KNMSGLVPVRALLCSYKCFNSPGHDYYGVA 343          

HSP 2 Score: 61.6178 bits (148), Expect = 9.767e-7
Identity = 48/143 (33.57%), Postives = 72/143 (50.35%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSICS*ARKQQR 433
            N F+EIP  + FL SL  +    N++ +I+ + F  L+ L  LN+N N+L  +P  I    NL  L   +N ++ LP       +L E+H   N+I  +P  FG L  L+ L L KN++ +LPE I       I   A  + R
Sbjct:   68 NEFEEIPECVLFLTSLTKIHLFGNKIYSINPSFFDSLENLTFLNLNGNELTQVPPEICRLGNLQFLSIDNNKIEELPVEFCALTHLIEVHLAGNRIHSLPLEFGFLNNLERLYLLKNKIRELPESIGKCYKLRILDIAANELR 210          
BLAST of leucine-rich repeat-containing protein 69-like vs. TrEMBL
Match: K1RBW9 (Leucine-rich repeat-containing protein 69 OS=Crassostrea gigas OX=29159 GN=CGI_10022885 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 7.141e-33
Identity = 67/173 (38.73%), Postives = 108/173 (62.43%), Query Frame = 1
Query:  517 ILLGIQKL-IKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
             L+ ++KL ++K  I  +  ++     LR +D+AAN +++ P+E++ + L E H E NPLL   PV S Q +EV+ L E+  R +  EL+++ SYL   +RH+P ++EML QS +C +CG ++ + W+ECVRF      ++   N S  +P+RA +CS  CF+S  H +YGVA
Sbjct:  172 FLVNLEKLYLQKNKIRELPESLGKCYKLRTVDIAANELRIFPTELSALPLKELHCEENPLLQHIPVHSVQEEEVLSLKEIGARYIMKELKDRWSYLRKAIRHYPQIKEMLAQSSKCAVCGESFLNTWLECVRFVDAREDLK-LNNLSGLIPVRALLCSYRCFNSSGHDYYGVA 343          
BLAST of leucine-rich repeat-containing protein 69-like vs. TrEMBL
Match: C3XTT2 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_122525 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.025e-32
Identity = 62/164 (37.80%), Postives = 103/164 (62.80%), Query Frame = 1
Query:  541 IKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
            +++  I+ +   +  ++ L  LDVA N +++ P+E+ ++ L E + E NPLL+  PV S Q +EV+ L E+A R +  EL+++ SY+   +RH+P ++EML Q+  C +C  A+ + W+ECV F      ++ TKN    +P+RA +CS  CF+ K+H FYGVA
Sbjct:  181 LQRNRIKELPEGLGKLLKLTYLDVAGNELRIFPTELGKLPLREMYCEENPLLSFAPVHSVQEEEVLALKEIAARFVMNELKDRFSYMRKAIRHYPAIREMLAQASRCAMCDEAFLNTWLECVHFIDVRKDLK-TKNFVGTIPVRALLCSYKCFNRKDHHFYGVA 343          
BLAST of leucine-rich repeat-containing protein 69-like vs. TrEMBL
Match: A0A210QXU2 (Leucine-rich repeat-containing protein 69 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14594 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.044e-32
Identity = 66/173 (38.15%), Postives = 110/173 (63.58%), Query Frame = 1
Query:  517 ILLGIQKL-IKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
             L+ ++KL ++K  I  +  ++     LRV+D+AAN +++ P+E+ ++ L E + E NPLL   PV S Q +EV+ L E+  R +  EL+++ SYL   +RH+P +++ML Q+ +C +CG ++ + W+ECVRF      +  T N +  +P+RA +CS  CF+S  HQ+YGVA
Sbjct:  172 FLVNLEKLYLQKNKIRELPESLGKCYKLRVIDIAANELRIFPTELGDLPLKEMYCEENPLLQHIPVHSVQEEEVLSLKEITARYVMKELKDRWSYLRRAIRHYPQIKDMLAQASKCSVCGESFLNTWLECVRFVDAKSDLHLT-NITGLVPVRALLCSYKCFNSAGHQYYGVA 343          
BLAST of leucine-rich repeat-containing protein 69-like vs. TrEMBL
Match: A0A0B7BZT4 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF218680 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 5.417e-31
Identity = 61/153 (39.87%), Postives = 96/153 (62.75%), Query Frame = 1
Query:  574 NMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
             +     LR LDVAAN +++ P+E+  + L E + E NPLL   PV S Q +EV+ L EL  R +  EL+++ SY+   +R +P +Q ML QS +C +CG ++ + W+ECV+F +    ++ T + S  +P+RA +CS  CF+S  H++YGVA
Sbjct:    5 GLGKCYRLRYLDVAANELRIFPTELANIPLQELYCEENPLLQNVPVYSVQEEEVLSLKELCARYVMKELKDRLSYMRRVIRFYPDIQSMLAQSSKCAVCGDSFLNTWLECVQFVEARKDLKLT-SMSGTVPVRALLCSYKCFNSAGHRYYGVA 156          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Cavefish
Match: ENSAMXT00000048449.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:21401329:21420788:1 gene:ENSAMXG00000044068.1 transcript:ENSAMXT00000048449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 1.586e-24
Identity = 54/149 (36.24%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  592 SLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL 1038
            +L+ LDVA N++ + P++   ++L E  +E N  +  E   S ++ EV  L ELA R++  E  NK S L   L  +P +Q ML + G C LC   +   W+ECV+F   N +   +  SS+ +P+R  +CS +CFS   H +YGVA +
Sbjct:   89 NLKTLDVAGNHLSMFPADFQFLALEELFFEGNNFVQFELFESFRVQEVFSLKELAARLILKEGMNKLSVLSRALPLYPDLQTMLSRWGRCALCFQRFLTTWLECVQF--INLRKDMSLKSSQIVPVRVLLCSYSCFSKSGHSYYGVAKV 235          

HSP 2 Score: 47.7506 bits (112), Expect = 6.568e-6
Identity = 31/88 (35.23%), Postives = 46/88 (52.27%), Query Frame = 2
Query:   50 LKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETF 313
            L+I    HNQL  I   + + L KL  +N+  NKL  IP+ + +   L KL  + NSLK LPE +   +NL+ +    N ++  P  F
Sbjct:   21 LEIFSVTHNQLEEIPAELGL-LTKLTEINLANNKLTQIPQQLYDLIQLRKLCLARNSLKDLPEGILGWENLKTLDVAGNHLSMFPADF 107          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Cavefish
Match: ENSAMXT00000032777.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:21401329:21420788:1 gene:ENSAMXG00000044068.1 transcript:ENSAMXT00000032777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.056e-14
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  592 SLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRF 912
            +L+ LDVA N++ + P++   ++L E  +E N  +  E   S ++ EV  L ELA R++  E  NK S L   L  +P +Q ML + G C LC   +   W+ECV+F
Sbjct:   89 NLKTLDVAGNHLSMFPADFQFLALEELFFEGNNFVQFELFESFRVQEVFSLKELAARLILKEGMNKLSVLSRALPLYPDLQTMLSRWGRCALCFQRFLTTWLECVQF 195          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Cavefish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 69.3218 bits (168), Expect = 2.660e-12
Identity = 43/129 (33.33%), Postives = 71/129 (55.04%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LK+L I  V+ N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G    L +L L  N++  LP ++++A
Sbjct:  230 NRLTELPSEISGLIALTDLLLSQNHLDVVPDSIG-SLKQLSIFKVDQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRVSSVPAELGGCASLNVLSLRDNRVGKLPAELANA 357          

HSP 2 Score: 65.4698 bits (158), Expect = 4.310e-11
Identity = 51/135 (37.78%), Postives = 73/135 (54.07%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSIC 409
            N   EIP  I+F K+L+I     N LS +  + F  L+ L  L +N   L S+P  I N  NL  L    N LKSLP SLS    L+++  G N++  +P+T G L  L+ L L +NQL+ LP ++ + L   +C
Sbjct:   92 NDIPEIPESIKFCKALEIADFSGNPLSRLP-DGFTQLRALAHLALNDVSLQSLPNDIGNLANLVTLELRENLLKSLPTSLSFLVKLEQLDLGSNQLEVLPDTLGALPNLRELWLDRNQLSSLPPELGN-LRRLVC 224          

HSP 3 Score: 48.9062 bits (115), Expect = 9.079e-6
Identity = 37/126 (29.37%), Postives = 63/126 (50.00%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  + +P  +  L +L+ L    NQLS++   +  +L++L  L+V+ N+L  +P  IS    L  L  S N L  +P+S+   K L       N++  + ++ GE   L  L+L +N L  LP  +
Sbjct:  184 NQLEVLPDTLGALPNLRELWLDRNQLSSLPPELG-NLRRLVCLDVSENRLTELPSEISGLIALTDLLLSQNHLDVVPDSIGSLKQLSIFKVDQNRLVHLTDSIGECENLTELMLTENLLQSLPRSL 308          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Cavefish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 69.3218 bits (168), Expect = 2.739e-12
Identity = 43/129 (33.33%), Postives = 71/129 (55.04%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LK+L I  V+ N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G    L +L L  N++  LP ++++A
Sbjct:  230 NRLTELPSEISGLIALTDLLLSQNHLDVVPDSIG-SLKQLSIFKVDQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRVSSVPAELGGCASLNVLSLRDNRVGKLPAELANA 357          

HSP 2 Score: 65.4698 bits (158), Expect = 4.432e-11
Identity = 51/135 (37.78%), Postives = 73/135 (54.07%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSIC 409
            N   EIP  I+F K+L+I     N LS +  + F  L+ L  L +N   L S+P  I N  NL  L    N LKSLP SLS    L+++  G N++  +P+T G L  L+ L L +NQL+ LP ++ + L   +C
Sbjct:   92 NDIPEIPESIKFCKALEIADFSGNPLSRLP-DGFTQLRALAHLALNDVSLQSLPNDIGNLANLVTLELRENLLKSLPTSLSFLVKLEQLDLGSNQLEVLPDTLGALPNLRELWLDRNQLSSLPPELGN-LRRLVC 224          

HSP 3 Score: 48.9062 bits (115), Expect = 9.265e-6
Identity = 37/126 (29.37%), Postives = 63/126 (50.00%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  + +P  +  L +L+ L    NQLS++   +  +L++L  L+V+ N+L  +P  IS    L  L  S N L  +P+S+   K L       N++  + ++ GE   L  L+L +N L  LP  +
Sbjct:  184 NQLEVLPDTLGALPNLRELWLDRNQLSSLPPELG-NLRRLVCLDVSENRLTELPSEISGLIALTDLLLSQNHLDVVPDSIGSLKQLSIFKVDQNRLVHLTDSIGECENLTELMLTENLLQSLPRSL 308          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Cavefish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 69.3218 bits (168), Expect = 2.790e-12
Identity = 43/129 (33.33%), Postives = 71/129 (55.04%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N   E+P +I  L +L  L+   N L  +  +I   LK+L I  V+ N+L  + +SI  CENL +L  + N L+SLP SL + K L  ++   N+++ +P   G    L +L L  N++  LP ++++A
Sbjct:  230 NRLTELPSEISGLIALTDLLLSQNHLDVVPDSIG-SLKQLSIFKVDQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRVSSVPAELGGCASLNVLSLRDNRVGKLPAELANA 357          

HSP 2 Score: 65.4698 bits (158), Expect = 4.435e-11
Identity = 51/135 (37.78%), Postives = 73/135 (54.07%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSIC 409
            N   EIP  I+F K+L+I     N LS +  + F  L+ L  L +N   L S+P  I N  NL  L    N LKSLP SLS    L+++  G N++  +P+T G L  L+ L L +NQL+ LP ++ + L   +C
Sbjct:   92 NDIPEIPESIKFCKALEIADFSGNPLSRLP-DGFTQLRALAHLALNDVSLQSLPNDIGNLANLVTLELRENLLKSLPTSLSFLVKLEQLDLGSNQLEVLPDTLGALPNLRELWLDRNQLSSLPPELGN-LRRLVC 224          

HSP 3 Score: 48.9062 bits (115), Expect = 9.351e-6
Identity = 37/126 (29.37%), Postives = 63/126 (50.00%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            N  + +P  +  L +L+ L    NQLS++   +  +L++L  L+V+ N+L  +P  IS    L  L  S N L  +P+S+   K L       N++  + ++ GE   L  L+L +N L  LP  +
Sbjct:  184 NQLEVLPDTLGALPNLRELWLDRNQLSSLPPELG-NLRRLVCLDVSENRLTELPSEISGLIALTDLLLSQNHLDVVPDSIGSLKQLSIFKVDQNRLVHLTDSIGECENLTELMLTENLLQSLPRSL 308          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Sea Lamprey
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 68.5514 bits (166), Expect = 7.728e-13
Identity = 41/128 (32.03%), Postives = 73/128 (57.03%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            N  + +   +Q L +L +L  H NQL+ +   +  +L  L+ LNV+ NKL ++PES+    +L  LH  HN L+ +  ++     L+E+    N++T +P T G+L ++  L + +N+L +LP +I S
Sbjct:   94 NRLRALSDDLQLLPALTVLDVHDNQLTELP-QVLGELVNLQKLNVSHNKLQTLPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKS 220          

HSP 2 Score: 48.1358 bits (113), Expect = 2.459e-6
Identity = 33/123 (26.83%), Postives = 56/123 (45.53%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNI----------------------FIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPE 307
            N  + +P  +  + SL  L   HN+L  I  NI                         L ++  LNV  NKL  +P  I + + L +L  +HN L+S+P +L    +LQ+++  +N++  +PE
Sbjct:  140 NKLQTLPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHNRLKSLPE 262          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005304.1 (pep scaffold:Pmarinus_7.0:GL487827:697:5444:1 gene:ENSPMAG00000004832.1 transcript:ENSPMAT00000005304.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.972e-10
Identity = 32/92 (34.78%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  113 LKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            LKKL+ L V+ NKL  +P +I     L +  CS+N L +LP ++    ++  + A +N +T +P   G    ++++ L  NQLA LP ++SS
Sbjct:    3 LKKLKTLKVDGNKLTELPGTIGGLLLLEEFDCSYNELVTLPRTIGHLHHMHTLLADFNSLTHLPPEVGSCRAVRVVSLASNQLAWLPSEMSS 94          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 60.4622 bits (145), Expect = 3.231e-10
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  + +P  I  L +L   +   N L  +   +   LK L IL  + N+L  +PE+I +CENL +L  + N L +LP S+ +   L  ++   N++  IP   G    L +L L  N+L  +P +IS A
Sbjct:  177 NRLERLPDAIGGLAALTDFLASQNHLEELPEELG-KLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDNRLTQVPGEISGA 304          

HSP 2 Score: 56.6102 bits (135), Expect = 5.026e-9
Identity = 41/127 (32.28%), Postives = 67/127 (52.76%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N  + +P  +  L +++ L    NQL  +   I  +L++L  L+++ N+L  +P++I     L     S N L+ LPE L + K+L  + A  N++T +PE  G+   L  LIL +NQL  LP  I 
Sbjct:  131 NELETLPGSLGSLPNVRELWLDGNQLEALPSEIG-ELRRLVCLDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIG 256          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004940.1 (pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-1 gene:ENSPMAG00000004448.1 transcript:ENSPMAT00000004940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.753e-9
Identity = 37/131 (28.24%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALS 397
            N    +P  +  L SL++L   HN+L +I   ++  L  L +L + FN++  + + I N   L  L    N +K LP  + + ++L  +   +N++  +PE  G  +++  L L  N+L DLP+ I +  S
Sbjct:  105 NSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVY-RLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLAS 234          

HSP 2 Score: 57.7658 bits (138), Expect = 2.056e-9
Identity = 43/128 (33.59%), Postives = 69/128 (53.91%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            N    +P+ I   KS+  L    NQL+ I  +I  +L  LEIL ++ N L  +P  + N   L +L    N L+SLP  ++  K+LQ++    N++T +P   G L  L  L++ +NQL  +PE+I +
Sbjct:  338 NQLTSLPLDIGTWKSMVELNLATNQLTKIPDDIS-ELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGT 464          

HSP 3 Score: 53.5286 bits (127), Expect = 4.944e-8
Identity = 38/125 (30.40%), Postives = 62/125 (49.60%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPE 376
            FN   ++   I  L  L +L    N++  +   I  +L+ L  L+V  N+L  +PE I NC  +  L   HN L  LP+S+    +L  +   YN+++ +P T     +L+ L L  N ++ LPE
Sbjct:  150 FNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIG-ELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPE 273          

HSP 4 Score: 48.521 bits (114), Expect = 1.919e-6
Identity = 37/121 (30.58%), Postives = 64/121 (52.89%), Query Frame = 2
Query:   23 PIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            P Q   + SL +    HN +  I + IF   K L  LN+  N+L S+P  I   +++ +L+ + N L  +P+ +S+  +L+ +    N +  +P   G L KL+ L L +N+L  LP +I+
Sbjct:  300 PSQFTTVYSLNM---EHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIA 417          

HSP 5 Score: 46.595 bits (109), Expect = 6.055e-6
Identity = 43/128 (33.59%), Postives = 63/128 (49.22%), Query Frame = 2
Query:    5 NLFKEIPIQI-QFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   +IP  I    K+L  L    NQL+++  +I    K +  LN+  N+L  IP+ IS   +L  L  S+N L+ LP  L   + L+E+    NK+  +P     L  L+ L+L  NQL  LP  I 
Sbjct:  314 NHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGT-WKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIG 440          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005730.1 (pep scaffold:Pmarinus_7.0:GL476660:169414:193269:1 gene:ENSPMAG00000005127.1 transcript:ENSPMAT00000005730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 2.913e-9
Identity = 42/127 (33.07%), Postives = 74/127 (58.27%), Query Frame = 2
Query:   11 FKEIPIQIQFLKSLKILICHHNQLSNIDYNIF--IDLKKLEILNVNFNKLCSIPESI-SNCENLGKLHCSHNSLKSLPE--SLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPE 376
               +P +I    + KIL  + NQ++ ++  +F  IDL +L +L+++ N+L ++PE +     NL KL  + N L SLP   +  +  NLQE++   NK T++P    +L +L+ L L++NQL  +P+
Sbjct:   20 LASVPAEIP--TTTKILRLYINQITKLEPGVFDTIDLTRLTVLDLSGNQLQALPEGVFDRLVNLQKLWLNSNQLTSLPAGGAFDRLGNLQELYMCCNKFTELPRGIDKLTQLRRLSLNQNQLKSIPD 144          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 51.2174 bits (121), Expect = 1.810e-7
Identity = 31/96 (32.29%), Postives = 57/96 (59.38%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKI 292
            N  +++P  I  L +L IL    N+L ++    F++LK L++L+++ NK    PE I+ C NL ++  S+N ++SLP+S      L +++  +NK+
Sbjct:  873 NFIRKVPNSIMKLSNLTILNLQCNELESLPAG-FVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKL 967          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Yeast
Match: CCR4 (Component of the CCR4-NOT transcriptional complex; CCR4-NOT is involved in regulation of gene expression; component of the major cytoplasmic deadenylase, which is involved in mRNA poly(A) tail shortening [Source:SGD;Acc:S000000019])

HSP 1 Score: 48.521 bits (114), Expect = 1.122e-6
Identity = 32/80 (40.00%), Postives = 39/80 (48.75%), Query Frame = 2
Query:   77 QLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            Q+ NI  NIF     L  L +N N L  +P  I N  NL  L  SHN L SLP  L  C  L+  +   N +T +P  FG
Sbjct:  345 QIFNISANIF-KYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFG 423          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Nematostella
Match: EDO36580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI63])

HSP 1 Score: 127.872 bits (320), Expect = 1.075e-33
Identity = 59/165 (35.76%), Postives = 101/165 (61.21%), Query Frame = 1
Query:  538 LIKKRMIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVA 1032
             ++K  IE +   +A    L  LD++AN +++ P+E++ + L E + E N LL   PV S+Q DEV+ L EL  R +   L++  SY+   +RH+P +QEML  + EC +CG ++ + W+ECV F      ++ TK +++ +P+R  +CS  CF+S+ H ++G+A
Sbjct:  180 FVQKNYIEELPEGLAKCTRLSTLDISANRLRIFPAELSHLPLKELYCEENNLLRHIPVHSQQEDEVLSLKELTARCVLKGLKDGRSYIRRTIRHYPKIQEMLQYASECAVCGESFLNTWLECVHFVDARKTLK-TKTNTRIIPVRGLLCSYKCFNSEGHDYFGIA 343          

HSP 2 Score: 65.0846 bits (157), Expect = 1.069e-11
Identity = 47/127 (37.01%), Postives = 70/127 (55.12%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N  +E+P  + FL+SL+ L    N L +++  +   L+KL  LN+N N+L S+P  I+   +L  L    N LKSLP  +    NL E HA  N+IT +PE    L  L  L + KN + +LPE ++
Sbjct:   68 NRLQELPEVLCFLESLQKLHLFKNLLQDLNPIVLSGLQKLTFLNLNGNRLVSLPGEINRLVSLQFLSLDGNQLKSLPTEICHLINLTEFHAADNQITSLPEDIAFLRNLSKLFVQKNYIEELPEGLA 194          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Nematostella
Match: EDO46974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNR2])

HSP 1 Score: 63.929 bits (154), Expect = 3.247e-11
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 2
Query:   44 KSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETF 313
            K+L+ +    NQL ++   +F +L+ L++L ++ N+L  +P  +SN  NL  L  S N +  +PE++  CKNLQEI A  N I  IPETF
Sbjct:   25 KALEEVYLDANQLRDLPRGLF-NLQNLQVLGLSDNELTILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPETF 113          

HSP 2 Score: 49.2914 bits (116), Expect = 1.533e-6
Identity = 40/127 (31.50%), Postives = 72/127 (56.69%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N  +++P  +  L++L++L    N+L+ I  ++  +L  L IL+ + N +  IPE+I +C+NL ++  S N +  +PE+     NL  ++     +  +P  FG LI L+IL L +N L  LP+ +S
Sbjct:   35 NQLRDLPRGLFNLQNLQVLGLSDNELT-ILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLRVLPKSMS 160          

HSP 3 Score: 48.9062 bits (115), Expect = 1.782e-6
Identity = 40/123 (32.52%), Postives = 63/123 (51.22%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLP 373
            NL  EIP QI  L  L+ L    N L  +  +I   L +LE L +  N+L S+P S+     L  L+   N L+S+P  L  C  +  +    N++  +P++ G + KL+++ L  N+L  LP
Sbjct:  242 NLLIEIPEQIGALGKLQTLKLEENHLGELPNSIG-KLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLP 363          

HSP 4 Score: 48.1358 bits (113), Expect = 3.678e-6
Identity = 34/111 (30.63%), Postives = 56/111 (50.45%), Query Frame = 2
Query:   50 LKILICHHNQLSNIDYNIFI--DLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPE 376
            + +L   H+ L+ + +++F   + K LE + ++ N+L  +P  + N +NL  L  S N L  LP  LS   NL+ +    N I DIPET      L+ +    N +  +PE
Sbjct:    1 MSVLELRHSNLTTVSHDLFKSKEGKALEEVYLDANQLRDLPRGLFNLQNLQVLGLSDNELTILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPE 111          

HSP 5 Score: 47.7506 bits (112), Expect = 5.100e-6
Identity = 38/127 (29.92%), Postives = 69/127 (54.33%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N F E+P+ +  L +L  L    N +  +   I + L++L  L+V+ N+L  +P  I + ++L  L+ S+N L  +PE +     LQ +    N + ++P + G+L++L+ LIL  N+L  LP  + 
Sbjct:  173 NEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGL-LRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVELEELILTCNELVSLPPSLG 298          

HSP 6 Score: 47.3654 bits (111), Expect = 6.473e-6
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETF 313
            N   E+P  I  L  L+ LI   N+L ++  ++   L+KL +LN++ N L SIP  + +C  +  L    N L  LP+S+ +   LQ I+   N++  +P +F
Sbjct:  265 NHLGELPNSIGKLVELEELILTCNELVSLPPSLGY-LRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLPYSF 366          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Nematostella
Match: EDO48217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKB1])

HSP 1 Score: 61.2326 bits (147), Expect = 2.970e-10
Identity = 45/128 (35.16%), Postives = 73/128 (57.03%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDI-PETFGEXXXXXXXXXXXNQLADLPEDI 382
            +N+   +P  +  LK L+ L   +N L  +    F  L+ L+ LN++ NK+C+ P  + N ++L +L C  N L S+P S+ QC +L+E++  YNKI ++  + F     L +L LH N L  +PEDI
Sbjct:  178 YNMVSSLP-SLAGLKHLRTLNLSNNALEMLPPE-FDHLQALDDLNISSNKICNFPGKLYNMKSLRRLDCRQNHLTSVP-SVGQCPSLKELYLAYNKIAELDSKVFAGYSGLTVLDLHDNLLTSIPEDI 302          

HSP 2 Score: 54.299 bits (129), Expect = 4.810e-8
Identity = 36/104 (34.62%), Postives = 54/104 (51.92%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            N   EI   +  L +L +L  H N L+ +   I   L  L+ LN+  NK+ S+P S++  E+L  L   HNS KSL   L   +NL+E+   YN ++ +P   G
Sbjct:   87 NSLTEISGDVFNLPALVLLDIHDNSLTTLPEEIG-SLSCLQKLNLGHNKISSLPMSMAQLESLCSLKLEHNSFKSLECWLGSLRNLEELDVSYNMVSSLPSLAG 189          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Nematostella
Match: EDO38205 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDM2])

HSP 1 Score: 55.0694 bits (131), Expect = 9.491e-10
Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = 2
Query:   50 LKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPE 307
            LK L      L++I   +F  L  LE L++N N+L SIPESI+   +L KL  ++N L S+PES++Q   L  ++  +N I+++PE
Sbjct:    1 LKSLSLTKGNLTSIPEEVF-RLVSLEKLDLNNNELTSIPESIAQLVSLEKLDLNNNKLTSIPESIAQLNKLTNLNLAHNNISEVPE 85          

HSP 2 Score: 49.2914 bits (116), Expect = 8.626e-8
Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 2
Query:   11 FKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYN 286
               IP ++  L SL+ L  ++N+L++I  +I   L  LE L++N NKL SIPESI+    L  L+ +HN++  +PE + Q   L+E+   +N
Sbjct:   11 LTSIPEEVFRLVSLEKLDLNNNELTSIPESI-AQLVSLEKLDLNNNKLTSIPESIAQLNKLTNLNLAHNNISEVPEYVWQIGCLRELFLSHN 101          

HSP 3 Score: 48.521 bits (114), Expect = 1.916e-7
Identity = 32/85 (37.65%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  122 LEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPE 376
            L+ L++    L SIPE +    +L KL  ++N L S+PES++Q  +L+++    NK+T IPE+  +L KL  L L  N ++++PE
Sbjct:    1 LKSLSLTKGNLTSIPEEVFRLVSLEKLDLNNNELTSIPESIAQLVSLEKLDLNNNKLTSIPESIAQLNKLTNLNLAHNNISEVPE 85          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Nematostella
Match: EDO37499 (Leucine-rich repeat protein soc-2 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7SFP1])

HSP 1 Score: 56.6102 bits (135), Expect = 7.463e-9
Identity = 34/104 (32.69%), Postives = 56/104 (53.85%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            N   ++P  IQ+L +L++LI  +N L  +   I   L+KL +L++  NKL SIP  I    +L +L    N L SLP S+    ++  +  G N++  +P+  G
Sbjct:  398 NQISKLPEDIQWLVNLEVLILSNNLLKKLPRGIGA-LRKLRVLDIEENKLESIPTEIEYLRSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIG 500          

HSP 2 Score: 50.0618 bits (118), Expect = 9.958e-7
Identity = 34/131 (25.95%), Postives = 65/131 (49.62%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSAL 394
            FN    +   I  LK L+ L    N++  I   +   L  L  L+++ N + ++P  I NC ++  L   HN + SLP+S+ +   +  +   YN+++ +P++      +    +  N +A+LPE + S+L
Sbjct:  187 FNRISVVESGIGNLKLLERLSLRENKI-KILPRVIGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSL 316          

HSP 3 Score: 47.3654 bits (111), Expect = 7.949e-6
Identity = 38/127 (29.92%), Postives = 66/127 (51.97%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            F +F   P + QF + +   I  HN++  I + +F   K L  LNV  N+L S+P    +  +L +L+ + N +  LPE +    NL+ +    N +  +P   G L KL++L + +N+L  +P +I
Sbjct:  329 FEVFPAGPPK-QFCQ-VNTFIMEHNRMQKIPFGVFNKAKYLSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIPTEI 453          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Medaka
Match: lrrc8ab (volume-regulated anion channel subunit LRRC8A [Source:NCBI gene;Acc:101162605])

HSP 1 Score: 68.5514 bits (166), Expect = 4.466e-12
Identity = 48/128 (37.50%), Postives = 71/128 (55.47%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            +N    IPIQI  L +L+ L  + N++  I   +F   +KL IL+++ N L SIP  I   +NL  L  + N ++SLP  L QCK L+ ++ G N +  +P  FGEL  L  L L  N+L  LP ++ 
Sbjct:  633 YNQIAYIPIQIGTLNNLEKLYLNRNKIEKIPSQLFY-CRKLRILDLSHNNLTSIPADIGFLQNLHYLAVTANRIESLPNELFQCKKLRTLNLGNNCLQSLPSRFGELTALTQLELRGNRLECLPVELG 759          

HSP 2 Score: 51.2174 bits (121), Expect = 1.443e-6
Identity = 32/105 (30.48%), Postives = 56/105 (53.33%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGE 319
            N  ++IP Q+ + + L+IL   HN L++I  +I   L+ L  L V  N++ S+P  +  C+ L  L+  +N L+SLP    +   L ++    N++  +P   GE
Sbjct:  657 NKIEKIPSQLFYCRKLRILDLSHNNLTSIPADIGF-LQNLHYLAVTANRIESLPNELFQCKKLRTLNLGNNCLQSLPSRFGELTALTQLELRGNRLECLPVELGE 760          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Medaka
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:101169728])

HSP 1 Score: 63.929 bits (154), Expect = 8.635e-11
Identity = 41/129 (31.78%), Postives = 74/129 (57.36%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSA 391
            N  + +P ++  L++L  L+   N +  +  +I   L+KL IL V+ N+L  +PESI +CE+L +L  + N +KSLP S+ + K L  ++   N++T +P+  G    L +  +  N+L  +P ++S A
Sbjct:  180 NKLEGLPQELGGLENLTDLLVSQNSIEALPESIG-KLQKLSILKVDQNRLNCLPESIGSCESLAELILTENQIKSLPRSIGKLKKLFNLNCDRNQLTSLPKEIGGCCSLNVFCMRDNRLTRIPAELSQA 307          

HSP 2 Score: 53.5286 bits (127), Expect = 1.802e-7
Identity = 42/122 (34.43%), Postives = 64/122 (52.46%), Query Frame = 2
Query:   17 EIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDI 382
            EIP  I   K+L++     N L+ +    F DL+ L  L++N   L  +P+   N  NL  L    N L  LP+SLS+   L+ +  G N++ ++P++ G L  LK L L  NQL +LP  +
Sbjct:   46 EIPESISHCKALQVADFSGNPLTRLPAT-FPDLQSLVCLSINDISLQRLPDDFGNLSNLVSLELRENILTFLPDSLSELHKLEGLDLGSNELEELPKSIGNLSNLKELWLDGNQLVELPATL 166          

HSP 3 Score: 52.7582 bits (125), Expect = 3.089e-7
Identity = 42/134 (31.34%), Postives = 69/134 (51.49%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSI 406
            N   E+P  +  +++L  L    N+L  +   +   L+ L  L V+ N + ++PESI   + L  L    N L  LPES+  C++L E+    N+I  +P + G+L KL  L   +NQL  LP++I    S ++
Sbjct:  157 NQLVELPATLCRIRNLVCLDVSENKLEGLPQELG-GLENLTDLLVSQNSIEALPESIGKLQKLSILKVDQNRLNCLPESIGSCESLAELILTENQIKSLPRSIGKLKKLFNLNCDRNQLTSLPKEIGGCCSLNV 289          

HSP 4 Score: 48.521 bits (114), Expect = 7.789e-6
Identity = 42/128 (32.81%), Postives = 68/128 (53.12%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISS 388
            N+   +P  +  L  L+ L    N+L  +  +I  +L  L+ L ++ N+L  +P ++    NL  L  S N L+ LP+ L   +NL ++    N I  +PE+ G+L KL IL + +N+L  LPE I S
Sbjct:  111 NILTFLPDSLSELHKLEGLDLGSNELEELPKSIG-NLSNLKELWLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQELGGLENLTDLLVSQNSIEALPESIGKLQKLSILKVDQNRLNCLPESIGS 237          

HSP 5 Score: 48.1358 bits (113), Expect = 9.207e-6
Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 2
Query:  110 DLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALSHSI 406
            +L KLE L++  N+L  +P+SI N  NL +L    N L  LP +L + +NL  +    NK+  +P+  G L  L  L++ +N +  LPE I      SI
Sbjct:  122 ELHKLEGLDLGSNELEELPKSIGNLSNLKELWLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQELGGLENLTDLLVSQNSIEALPESIGKLQKLSI 220          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Medaka
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:101159973])

HSP 1 Score: 63.5438 bits (153), Expect = 1.367e-10
Identity = 39/127 (30.71%), Postives = 69/127 (54.33%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N  +EIP  +  L SL  L    N+++ ++ +I  +L KL +L++  NK+  +P  I    NL  L  +HN L+ LP+ +  C  +  +   +N++ D+PET G L  +  L L  N+L+ +P  ++
Sbjct:  179 NKLREIPAVVYRLTSLTTLYLRFNRITTVEKDIR-NLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLASINRLGLRYNRLSAIPRSLA 304          

HSP 2 Score: 56.225 bits (134), Expect = 2.854e-8
Identity = 38/131 (29.01%), Postives = 64/131 (48.85%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALS 397
            N    +P  +  LK L++L   HN+L  I   ++  L  L  L + FN++ ++ + I N   L  L    N +K LP  + +  NL  +   +N++  +P+  G   ++  L L  N+L DLPE I +  S
Sbjct:  156 NSLTSLPDSLDSLKKLRMLDLRHNKLREIPAVVY-RLTSLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLAS 285          

HSP 3 Score: 50.447 bits (119), Expect = 2.091e-6
Identity = 34/104 (32.69%), Postives = 56/104 (53.85%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFG 316
            N   +IP  +  L SL++LI  +N L  + + I  +L+KL  L++  NKL  +P  I+  ++L KL  ++N L +LP  +    NL  +  G N +  +PE  G
Sbjct:  412 NQLAKIPEDVCGLVSLEVLILSNNLLKKLPHGIG-NLRKLRELDLEENKLECLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIG 514          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Medaka
Match: lrrc47 (leucine rich repeat containing 47 [Source:NCBI gene;Acc:101157366])

HSP 1 Score: 63.1586 bits (152), Expect = 1.613e-10
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 2
Query:   11 FKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIP 304
              EI   IQ L +L+ LI   N+L++I + +   LK L++L+V+ N L ++PE I+    L  L+ S NSL+ LP+ LS+C  L  I+   N++T  P
Sbjct:   59 LTEIHADIQLLTNLQSLILCRNKLASIPH-VIGRLKALKVLDVSVNNLTAVPEEITQLPELRTLNASCNSLELLPDGLSRCSKLSTINVSKNRLTAFP 155          
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Medaka
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:101158008])

HSP 1 Score: 62.7734 bits (151), Expect = 2.490e-10
Identity = 42/127 (33.07%), Postives = 73/127 (57.48%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N   +I   I+ L +L  L  H NQL+ + ++   +L++L+ L ++ N+L S+P  +    NL  L    N L++LPE   Q +NL E+    N++TD+P++ G L  L+ + L  N+L+ LP+ +S
Sbjct:   87 NQISQISEDIRLLPALVTLDLHDNQLNTL-HSAIGELQELQTLRLSHNQLSSLPVEVCMLRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLS 212          

HSP 2 Score: 61.2326 bits (147), Expect = 7.821e-10
Identity = 43/122 (35.25%), Postives = 69/122 (56.56%), Query Frame = 2
Query:   32 IQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALS 397
            I  L+ L+ L   HNQLS++   + + L+ L  L +  N L ++PE     ENL +L  S N L  LP+SL +   LQ+I   +NK++ +P+   +L  +K+L    NQL+D+P  ++  LS
Sbjct:  119 IGELQELQTLRLSHNQLSSLPVEVCM-LRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLSQLTNVKLLDCSNNQLSDVPASLAHMLS 239          

HSP 3 Score: 60.077 bits (144), Expect = 1.799e-9
Identity = 40/130 (30.77%), Postives = 72/130 (55.38%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSAL 394
            N    +P+++  L++L+ L    N L N+    F  L+ L  L+++ N+L  +P+S+     L K+  SHN L  LP+ LSQ  N++ +    N+++D+P +   ++ L+ L L  N+L  LP+  + AL
Sbjct:  133 NQLSSLPVEVCMLRNLRSLTLQQNLLENLPEE-FGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLSQLTNVKLLDCSNNQLSDVPASLAHMLSLEQLHLRHNRLQRLPQLHAPAL 261          
BLAST of leucine-rich repeat-containing protein 69-like vs. Planmine SMEST
Match: SMESG000007767.1 (SMESG000007767.1)

HSP 1 Score: 319.316 bits (817), Expect = 4.858e-110
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 1
Query:  577 MADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL 1038
            MADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL
Sbjct:    1 MADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL 154          
BLAST of leucine-rich repeat-containing protein 69-like vs. Planmine SMEST
Match: SMESG000007767.1 (SMESG000007767.1)

HSP 1 Score: 323.939 bits (829), Expect = 5.468e-109
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 1
Query:  574 NMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL 1038
            NMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL
Sbjct:  196 NMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNLEPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQSGECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFSSKEHQFYGVANL 350          

HSP 2 Score: 224.172 bits (570), Expect = 4.830e-70
Identity = 124/132 (93.94%), Postives = 129/132 (97.73%), Query Frame = 2
Query:    2 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALS 397
            FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENL KLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPE+FGELIKLKILILHKNQLADLPE+++  +S
Sbjct:   71 FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLRKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPESFGELIKLKILILHKNQLADLPENMADMVS 202          
BLAST of leucine-rich repeat-containing protein 69-like vs. Planmine SMEST
Match: SMESG000020939.1 (SMESG000020939.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.985e-10
Identity = 46/121 (38.02%), Postives = 68/121 (56.20%), Query Frame = 2
Query:   41 LKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHC------SHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            L +L+IL+  HN+ + +D      LKKLE L V  NKL       S  ++LGKLHC      S N +  +P  L +C  L+ ++  YNKI ++PET G L +L+ + +  NQL  +PE +S
Sbjct:  183 LVNLRILLITHNKFTRLDG--IGRLKKLETLTVKGNKLEG-----SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLS 296          

HSP 2 Score: 48.1358 bits (113), Expect = 9.567e-6
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  119 KLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIP 304
            KL+ LN  +NK+  +PE+I N + L  +   +N L+ +PESLS C  L+E++   N I +IP
Sbjct:  254 KLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELNIESNSIEEIP 315          
BLAST of leucine-rich repeat-containing protein 69-like vs. Planmine SMEST
Match: SMESG000016748.1 (SMESG000016748.1)

HSP 1 Score: 62.003 bits (149), Expect = 4.161e-10
Identity = 43/123 (34.96%), Postives = 70/123 (56.91%), Query Frame = 2
Query:   29 QIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDISSALS 397
            +I  L  L+    + N L  I+ N+F   + L+ L+V+ NKL  IP  I+N  +L   +CSHN LK+LP ++     LQ ++  +N+I DIPE  G L  L+  +++ N++  +P  IS+  S
Sbjct:   70 EIIALSKLRHFFVNGNMLRTINVNLFYA-RGLQSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLKLQYMNLSHNQIQDIPEEIGNLKSLQTFLINSNEIVLIPSSISTITS 191          
BLAST of leucine-rich repeat-containing protein 69-like vs. Planmine SMEST
Match: SMESG000072843.1 (SMESG000072843.1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.841e-10
Identity = 44/127 (34.65%), Postives = 65/127 (51.18%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            N  K +P  + FL SL+ L   HN L  +  ++   +  L +L  + N L S+PE I  C NL  L    N L  LP+S+ QC  L E+ A  N++  +P   G+L +L  L +  NQL  LP+ + 
Sbjct:  165 NDIKSLPQNMGFLVSLQYLDVGHNDLKELPESL-CKMTHLTVLTADKNNLASLPEKIGLCSNLQVLEIQQNCLSFLPDSVCQCSLLSELIASNNQLQSLPAMIGQLSRLTNLRVDNNQLNRLPDSLG 290          

HSP 2 Score: 49.2914 bits (116), Expect = 4.060e-6
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = 2
Query:   44 KSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLPEDIS 385
            K+LK LI   N+L+NI   I  +L  L  LN++ N L  +P+++ NC +L  L  S N    LP+ L +   LQE+ A    +T +P+    L  L  L + +N +  LP+++ 
Sbjct:   63 KALKELILCDNELTNIPDAIG-NLTNLTSLNISKNNLQQLPDTLGNCSHLAFLDASGNVFDELPDGLCRMTMLQELIANTAFLTGLPQNINRLTNLSHLEIRENDIKSLPQNMG 175          

HSP 3 Score: 48.9062 bits (115), Expect = 5.181e-6
Identity = 36/123 (29.27%), Postives = 61/123 (49.59%), Query Frame = 2
Query:    5 NLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNKLCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDIPETFGEXXXXXXXXXXXNQLADLP 373
            N  KE+P  +  +  L +L    N L+++   I +    L++L +  N L  +P+S+  C  L +L  S+N L+SLP  + Q   L  +    N++  +P++ G+L  L  L    N L  LP
Sbjct:  188 NDLKELPESLCKMTHLTVLTADKNNLASLPEKIGL-CSNLQVLEIQQNCLSFLPDSVCQCSLLSELIASNNQLQSLPAMIGQLSRLTNLRVDNNQLNRLPDSLGQLDSLIQLYASSNHLVHLP 309          
The following BLAST results are available for this feature:
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC692.156e-2633.96leucine rich repeat containing 69 [Source:HGNC Sym... [more]
LRRC696.205e-1930.83leucine rich repeat containing 69 [Source:HGNC Sym... [more]
LRRC14.169e-1340.16leucine rich repeat containing 1 [Source:HGNC Symb... [more]
LRRC28.133e-1238.58leucine rich repeat containing 2 [Source:HGNC Symb... [more]
LRRC28.133e-1238.58leucine rich repeat containing 2 [Source:HGNC Symb... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-4132.133e-1135.43pep chromosome:WBcel235:V:7972924:7977774:-1 gene:... [more]
let-4132.242e-1135.43pep chromosome:WBcel235:V:7972934:7977774:-1 gene:... [more]
soc-28.504e-929.13Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-28.799e-929.13Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-29.032e-929.13Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG30403.581e-932.28gene:FBgn0029925 transcript:FBtr0071038[more]
Lap19.123e-928.83gene:FBgn0033984 transcript:FBtr0087407[more]
Lap19.123e-928.83gene:FBgn0033984 transcript:FBtr0303759[more]
scrib1.210e-833.33gene:FBgn0263289 transcript:FBtr0335521[more]
scrib1.214e-833.33gene:FBgn0263289 transcript:FBtr0308630[more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-302o18.21.027e-2233.56si:ch73-302o18.2 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
scrib2.295e-1336.43scribble planar cell polarity protein [Source:NCBI... [more]
scrib2.659e-1336.43scribble planar cell polarity protein [Source:NCBI... [more]
scrib2.847e-1336.43scribble planar cell polarity protein [Source:NCBI... [more]
scrib2.868e-1336.43scribble planar cell polarity protein [Source:NCBI... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc692.499e-2533.99leucine rich repeat containing 69 [Source:NCBI gen... [more]
lrrc14.023e-1342.52leucine rich repeat containing 1 [Source:NCBI gene... [more]
SCRIB9.813e-1234.11scribbled planar cell polarity protein [Source:NCB... [more]
SCRIB1.095e-1134.11scribbled planar cell polarity protein [Source:NCB... [more]
SCRIB1.119e-1134.11scribbled planar cell polarity protein [Source:NCB... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc693.109e-1827.54leucine rich repeat containing 69 [Source:MGI Symb... [more]
Lrrc693.109e-1827.54leucine rich repeat containing 69 [Source:MGI Symb... [more]
Lrrc11.954e-1340.16leucine rich repeat containing 1 [Source:MGI Symbo... [more]
Lrrc12.750e-1340.16leucine rich repeat containing 1 [Source:MGI Symbo... [more]
Lrrc13.395e-1340.16leucine rich repeat containing 1 [Source:MGI Symbo... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZNQ3|LRC69_HUMAN1.035e-2533.96Leucine-rich repeat-containing protein 69 OS=Homo ... [more]
sp|Q3KQF4|LRC69_XENLA5.198e-2533.33Leucine-rich repeat-containing protein 69 OS=Xenop... [more]
sp|Q9D9Q0|LRC69_MOUSE2.174e-1727.54Leucine-rich repeat-containing protein 69 OS=Mus m... [more]
sp|Q9BTT6|LRRC1_HUMAN2.002e-1240.16Leucine-rich repeat-containing protein 1 OS=Homo s... [more]
sp|Q4H4B6|SCRIB_DANRE2.150e-1236.43Protein scribble homolog OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZVB53.766e-3341.32Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
K1RBW97.141e-3338.73Leucine-rich repeat-containing protein 69 OS=Crass... [more]
C3XTT21.025e-3237.80Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A210QXU22.044e-3238.15Leucine-rich repeat-containing protein 69 OS=Mizuh... [more]
A0A0B7BZT45.417e-3139.87Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048449.11.586e-2436.24pep primary_assembly:Astyanax_mexicanus-2.0:23:214... [more]
ENSAMXT00000032777.11.056e-1436.45pep primary_assembly:Astyanax_mexicanus-2.0:23:214... [more]
scrib2.660e-1233.33scribble planar cell polarity protein [Source:NCBI... [more]
scrib2.739e-1233.33scribble planar cell polarity protein [Source:NCBI... [more]
scrib2.790e-1233.33scribble planar cell polarity protein [Source:NCBI... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc407.728e-1332.03leucine rich repeat containing 40 [Source:NCBI gen... [more]
ENSPMAT00000005304.11.972e-1034.78pep scaffold:Pmarinus_7.0:GL487827:697:5444:1 gene... [more]
scrib3.231e-1031.78scribble planar cell polarity protein [Source:NCBI... [more]
ENSPMAT00000004940.11.753e-928.24pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-... [more]
ENSPMAT00000005730.12.913e-933.07pep scaffold:Pmarinus_7.0:GL476660:169414:193269:1... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CYR11.810e-732.29Adenylate cyclase; required for cAMP production an... [more]
CCR41.122e-640.00Component of the CCR4-NOT transcriptional complex;... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO365801.075e-3335.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469743.247e-1140.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482172.970e-1035.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382059.491e-1039.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374997.463e-932.69Leucine-rich repeat protein soc-2 homolog [Source... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc8ab4.466e-1237.50volume-regulated anion channel subunit LRRC8A [Sou... [more]
lrrc18.635e-1131.78leucine rich repeat containing 1 [Source:NCBI gene... [more]
shoc21.367e-1030.71SHOC2 leucine rich repeat scaffold protein [Source... [more]
lrrc471.613e-1037.76leucine rich repeat containing 47 [Source:NCBI gen... [more]
lrrc402.490e-1033.07leucine rich repeat containing 40 [Source:NCBI gen... [more]
back to top
BLAST of leucine-rich repeat-containing protein 69-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007767.14.858e-110100.00SMESG000007767.1[more]
SMESG000007767.15.468e-109100.00SMESG000007767.1[more]
SMESG000020939.11.985e-1038.02SMESG000020939.1[more]
SMESG000016748.14.161e-1034.96SMESG000016748.1[more]
SMESG000072843.14.841e-1034.65SMESG000072843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003791 ID=SMED30003791|Name=leucine-rich repeat-containing protein 69-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1152bp
TTTCAATTTGTTTAAAGAAATTCCAATACAAATTCAGTTTCTAAAATCAC
TTAAAATTTTAATATGCCATCATAATCAATTGTCAAATATCGATTATAAT
ATATTTATTGATCTGAAAAAATTGGAAATTTTAAATGTCAATTTTAATAA
GCTTTGCAGTATTCCTGAATCAATATCAAACTGTGAAAATTTGGGAAAGC
TTCACTGTTCCCATAATTCATTAAAAAGTCTTCCGGAATCTTTGTCTCAG
TGTAAAAATCTACAAGAAATTCATGCAGGGTATAATAAAATAACCGACAT
TCCAGAAACATTCGGAGAACTGATTAAACTGAAAATATTAATTTTGCATA
AAAATCAATTGGCAGATCTACCAGAAGATATTTCAAGCGCATTATCACAT
TCCATATGTTCATGAGCAAGAAAGCAGCAAAGATGAAAATTCTGAAAATG
ATGATATATTACCGGAAATTATGGATACATAGAAGAAAGCATTGAAAAAC
GTTATTTATAAGTGAAATTCTTTTAGGTATTCAGAAATTGATAAAAAAAA
GAATGATCGAAGTTATGAAACTGAACATGGCTGATATGGTCAGTCTTCGG
GTGCTAGATGTTGCAGCAAACAATATACAAGTTATGCCAAGTGAAGTTAA
TGAAATGTCTTTATCAGAATTCCATTATGAATCAAATCCTTTGTTAAATC
TTGAACCTGTTTGTTCTCGACAAATCGATGAAGTGATGCCTTTATCAGAA
CTTGCACTCAGAGTTTTAGCAATCGAACTCCAAAACAAAGGATCATATTT
GCATGTAAAATTGAGGCATTTTCCTTTAGTTCAAGAAATGTTACTTCAAT
CCGGTGAATGTGTTTTATGTGGTGGAGCTTACCGAGATATATGGATAGAA
TGCGTTAGATTTGAAAAGAGAAATCCTAAAATTAGAAGCACAAAAAACAG
TTCAAAGAATTTACCAATAAGAGCAGCAATTTGTAGTCAAACCTGCTTTA
GTAGCAAGGAACACCAATTTTATGGAGTTGCTAATTTATAAAATAATTGT
TTTAATAAGATTATTTTCTCATCTTTTATAACTAATAGCAACCGTTATTA
GACACCATATAATTTATAATAGACCATTTTTATGAAAACAAATATTTTGA
CG
back to top

protein sequence of SMED30003791-orf-1

>SMED30003791-orf-1 ID=SMED30003791-orf-1|Name=SMED30003791-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
MIEVMKLNMADMVSLRVLDVAANNIQVMPSEVNEMSLSEFHYESNPLLNL
EPVCSRQIDEVMPLSELALRVLAIELQNKGSYLHVKLRHFPLVQEMLLQS
GECVLCGGAYRDIWIECVRFEKRNPKIRSTKNSSKNLPIRAAICSQTCFS
SKEHQFYGVANL*
back to top

protein sequence of SMED30003791-orf-2

>SMED30003791-orf-2 ID=SMED30003791-orf-2|Name=SMED30003791-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=138bp
FNLFKEIPIQIQFLKSLKILICHHNQLSNIDYNIFIDLKKLEILNVNFNK
LCSIPESISNCENLGKLHCSHNSLKSLPESLSQCKNLQEIHAGYNKITDI
PETFGELIKLKILILHKNQLADLPEDISSALSHSICS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR025875Leu-rich_rpt_4
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process