AGAP000218-PA

Overview
NameAGAP000218-PA
Smed IDSMED30003775
Length (bp)2753
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AGAP000218-PA (SMED30003775) t-SNE clustered cells

Violin plots show distribution of expression levels for AGAP000218-PA (SMED30003775) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AGAP000218-PA (SMED30003775) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AGAP000218-PA (SMED30003775) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003775

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003775SMESG000053076.1 SMESG000053066.1 SmedASXL_008437SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003775SMESG000053076.1 SMESG000053066.1 dd_Smed_v6_26658_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30003775SMESG000053066.1 OX_Smed_1.0.09710ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AGAP000218-PA vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 75.485 bits (184), Expect = 3.583e-13
Identity = 51/174 (29.31%), Postives = 76/174 (43.68%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             SC  TGNP   I W K  SG   ++L+ + +  L+     D G+Y C A+ P      + V +   GPP I  +    +   +  ++ C IRS P P      W  N        R   +      GVI TL I  +   DF  +YNC+ +  +GSD   I L + E++ M +
Sbjct:  354 FSCAWTGNPSLTIVWMKRGSG---VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAV 524          
BLAST of AGAP000218-PA vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 74.7146 bits (182), Expect = 7.520e-13
Identity = 65/222 (29.28%), Postives = 104/222 (46.85%), Query Frame = 1
Query: 1246 NSDIGNTPDCAVLPVTIASK---EIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQPSFILQMSTH-NDYGEYQCHAL-SPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            N+D+G+T +   +   IA K   E  L+++ PP+I+    ++ I   L KS  L CIA G P P+I W K   +++G        +  F+   S H  D G Y C A  + G DR  +R+ +    PP I   P   + ++     L C    IP PS   I W +N  +++V D+       +  G   +L+I++ S +D   Y C+V    G D  ++ L
Sbjct: 3681 NADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQSLVIL--LNKSTVLECIAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGRYLCMATNAAGTDR--RRIDLQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPS---INWRKNGHLLNV-DQNQNSYRLLSSG---SLVIISPSVDDTATYECTVTNGAGDDKRTVDL 3891          

HSP 2 Score: 59.3066 bits (142), Expect = 4.423e-8
Identity = 56/200 (28.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDI-LLTRQPSFILQMSTHNDYGEYQCHAL-SPGFDRAVKRVIVGTPGPPKIYGS-PKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            + I+L +  PPS+ED    +     +   + L C A GNP P I W+K   ++SG   +  L R     ++ +  +D G Y+C A+ S G       + V     P I GS   +   +  P++L C  R IPAPS   + W ++   V         ++ + GG I+ L    +S  D G Y C      G     I L
Sbjct: 1909 QHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQIIDIESAQISDAGIYKCVAINSAGATELFYSLQVHV--APSISGSNNMVAVVVNNPVRLECEARGIPAPS---LTWLKDGSPV---SSFSNGLQVLSGGRILALTSAQIS--DTGRYTCVAVNAAGEKQRDIDL 2098          

HSP 3 Score: 58.151 bits (139), Expect = 9.862e-8
Identity = 50/198 (25.25%), Postives = 86/198 (43.43%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVS--GKQDILLTRQPSFILQM--STHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS---PKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD 1866
            + +K   L +  PP++++      I      S  ++CI  G P P + W +     G    L       +LQ+  +   D G+Y C A +   + + K  I+    PP I GS    +I   +  P++LTC    IPAP   ++ W ++ + +   D++ T    + GG ++ +    V  ED G Y C   +  G D
Sbjct: 3421 VDNKHYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDAHLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVS-KHFILKVLEPPHINGSEEHEEISVIVNNPLELTCIASGIPAP---KMTWMKDGRPLPQTDQVQT----LGGGEVLRISTAQV--EDTGRYTCLASSPAGDD 3608          

HSP 4 Score: 55.8398 bits (133), Expect = 4.622e-7
Identity = 48/159 (30.19%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 1300 SKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGK----QDILLTRQPSFILQMSTHN--DYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRI 1749
            SK   L +  PP I   + +  I+  +   + L+CIA+G P PK+ W K   G+     D + T     +L++ST    D G Y C A SP  D   K  +V    PP I G+  P+  + L  + + L C   ++P P    I W RN + +    R+
Sbjct: 3516 SKHFILKVLEPPHINGSEEHEEISVIVNNPLELTCIASGIPAPKMTWMK--DGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCLASSPAGDDD-KEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPV---ITWLRNGERLQATPRV 3668          

HSP 5 Score: 55.4546 bits (132), Expect = 6.316e-7
Identity = 59/208 (28.37%), Postives = 87/208 (41.83%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKI-----VSGKQDILLTRQPSFILQMS--THNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELL---KPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            A + + L +  PP I+   S + +   L   I L C ATG P P I W K       SG+   +L   PS  LQ+S     D G Y C A +P    A+ ++ +    PP I  SP +   ++   KPI L+C    +P   P  I W ++ + +   +  R+++           +L I  V   D G Y C      GS   S  L
Sbjct: 3976 AHRHVTLHVHEPPVIQPQPSELHVI--LNNPILLPCEATGTPSPFITWQKEGINVNTSGRNHAVL---PSGGLQISRAVREDAGTYMCVAQNPA-GTALGKIKLNVQVPPVI--SPHLKEYVIAVDKPITLSCEADGLP---PPDITWHKDGRAIVESIRQRVLSS---------GSLQIAFVQPGDAGHYTCMAANVAGSSSTSTKL 4163          

HSP 6 Score: 53.9138 bits (128), Expect = 1.784e-6
Identity = 60/221 (27.15%), Postives = 88/221 (39.82%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK--------------IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLYQTENL 1902
            K   L++  PPSIE  +  + + T +   + L+C ATG P P I W K              I+SG   + + R        S H+D G Y C A S    +A K   +    PP + G+  P   S LL + ++L C    IP P    I W ++ K +     +RI             TL I      D G Y C      G +   F++ +Y T  +
Sbjct: 3141 KNFHLNVYVPPSIEGPEREVIVET-ISNPVTLTCDATGIPPPTIAWLKNHKRIENSDSLEVRILSGGSKLQIAR--------SQHSDSGNYTCIA-SNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTP---LIQWLKDGKPIASGETERIRVSANG------STLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTI 3342          

HSP 7 Score: 53.1434 bits (126), Expect = 3.623e-6
Identity = 52/210 (24.76%), Postives = 90/210 (42.86%), Query Frame = 1
Query: 1315 LSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQM--STHNDYGEYQCHALSPGF--DRAVKRVIVGTPGPPKIYG----SPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLYQTENL 1902
            LSI  PPS+   +    ++  L +++ L C A G P P I W K    I SG+ + +        L +  +  +D G+Y C A +P    DR     +  T   P I G    + K+ + +   I + C     P   P QI W +N     +P  + + +  +  G ++ ++   VS  D  VY C      G D  ++++ ++   N+
Sbjct: 3239 LSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERIRVSANGSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVT---PTIRGNKDEAEKLMTLVDTSINIECRATGTP---PPQINWLKN----GLPLPLSSHIRLLAAGQVIRIVRAQVS--DVAVYTCVASNRAGVDNKHYNLQVFAPPNM 3436          
BLAST of AGAP000218-PA vs. Ensembl Human
Match: OBSCN (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF [Source:HGNC Symbol;Acc:HGNC:15719])

HSP 1 Score: 74.3294 bits (181), Expect = 1.167e-12
Identity = 58/197 (29.44%), Postives = 90/197 (45.69%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWF---KIVSGKQDILLTRQP----SFILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGP--PKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGS 1863
            + + L +  PP  E+  ++ T    L +++ L+C  TG PKP I W+   K V      +L   P    + IL   T  D G+Y C A S  G    + +++V  P     K+  SP +  E     + TCTI   P P   QI W ++  ++   ++  T  E  P   ++ L+I A S ED G+Y C +    GS
Sbjct: 6004 QRLALPVWRPPDFEEELADCT--AELGETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNKVRASPFVEGE---DAQFTCTIEGAPYP---QIRWYKDGALLTTGNKFQTLSE--PRSGLLVLVIRAASKEDLGLYECELVNRLGS 6190          
BLAST of AGAP000218-PA vs. Ensembl Human
Match: OBSCN (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF [Source:HGNC Symbol;Acc:HGNC:15719])

HSP 1 Score: 74.3294 bits (181), Expect = 1.177e-12
Identity = 58/197 (29.44%), Postives = 90/197 (45.69%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWF---KIVSGKQDILLTRQP----SFILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGP--PKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGS 1863
            + + L +  PP  E+  ++ T    L +++ L+C  TG PKP I W+   K V      +L   P    + IL   T  D G+Y C A S  G    + +++V  P     K+  SP +  E     + TCTI   P P   QI W ++  ++   ++  T  E  P   ++ L+I A S ED G+Y C +    GS
Sbjct: 6004 QRLALPVWRPPDFEEELADCT--AELGETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNKVRASPFVEGE---DAQFTCTIEGAPYP---QIRWYKDGALLTTGNKFQTLSE--PRSGLLVLVIRAASKEDLGLYECELVNRLGS 6190          
BLAST of AGAP000218-PA vs. Ensembl Human
Match: OBSCN (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF [Source:HGNC Symbol;Acc:HGNC:15719])

HSP 1 Score: 74.3294 bits (181), Expect = 1.177e-12
Identity = 58/197 (29.44%), Postives = 90/197 (45.69%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWF---KIVSGKQDILLTRQP----SFILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGP--PKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGS 1863
            + + L +  PP  E+  ++ T    L +++ L+C  TG PKP I W+   K V      +L   P    + IL   T  D G+Y C A S  G    + +++V  P     K+  SP +  E     + TCTI   P P   QI W ++  ++   ++  T  E  P   ++ L+I A S ED G+Y C +    GS
Sbjct: 6004 QRLALPVWRPPDFEEELADCT--AELGETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNKVRASPFVEGE---DAQFTCTIEGAPYP---QIRWYKDGALLTTGNKFQTLSE--PRSGLLVLVIRAASKEDLGLYECELVNRLGS 6190          
BLAST of AGAP000218-PA vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 65.4698 bits (158), Expect = 2.222e-10
Identity = 56/211 (26.54%), Postives = 101/211 (47.87%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWF---KIVSGKQDILLTRQPSFI-LQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTC-TIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSM 1908
            ++++++ L I  PPS++    ++    ++R+ ++LSC A G+PKP+++W+   + +       + +   F+ ++ +TH+D G Y+C A+S  G  R    +++ TP   +I  + K+       +   C TIR  P P   +I W +N K +  PD  +   E         L I+    ED G Y+C      G D       Q  NLS+
Sbjct:  598 MSTRKMRLDIMEPPSVKVTPQDVYF--NMREGVNLSCEAMGDPKPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQN-KMMVGRGDRVSFECKTIRGKPHP---KIRWFKNGKDLIKPDDYIKINEG-------QLHIMGAKDEDAGAYSCVGENMAGKD------VQVANLSV 789          

HSP 2 Score: 50.0618 bits (118), Expect = 9.417e-6
Identity = 56/214 (26.17%), Postives = 86/214 (40.19%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQ-----DILLTRQPSFILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSPK-IFSELLKPIKLTCTIRSIPAPSPKQIIWTR-NYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            A    +L ++ PP +E +Q+ + +    R S     I  G P PKI WFK  +GK      D +   +    +  +   D G Y C   +  G D  V  + VG    P I  SP  +   + + + L C    IP P   +I W + N  +  + +   T++          L+I     ED G + C     YG    S TL  T  +S +L
Sbjct:  690 ARDTTDLMLATPPKVEIIQNKMMVGRGDRVSFECKTI-RGKPHPKIRWFK--NGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRV--PTIIESPHTVRVNIERQVTLQCLAVGIPPP---EIEWQKGNVLLATLNNPRYTQL------ADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVL 889          
BLAST of AGAP000218-PA vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 65.4698 bits (158), Expect = 2.280e-10
Identity = 56/211 (26.54%), Postives = 101/211 (47.87%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWF---KIVSGKQDILLTRQPSFI-LQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTC-TIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSM 1908
            ++++++ L I  PPS++    ++    ++R+ ++LSC A G+PKP+++W+   + +       + +   F+ ++ +TH+D G Y+C A+S  G  R    +++ TP   +I  + K+       +   C TIR  P P   +I W +N K +  PD  +   E         L I+    ED G Y+C      G D       Q  NLS+
Sbjct:  598 MSTRKMRLDIMEPPSVKVTPQDVYF--NMREGVNLSCEAMGDPKPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQN-KMMVGRGDRVSFECKTIRGKPHP---KIRWFKNGKDLIKPDDYIKINEG-------QLHIMGAKDEDAGAYSCVGENMAGKD------VQVANLSV 789          

HSP 2 Score: 50.0618 bits (118), Expect = 9.419e-6
Identity = 56/214 (26.17%), Postives = 86/214 (40.19%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQ-----DILLTRQPSFILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSPK-IFSELLKPIKLTCTIRSIPAPSPKQIIWTR-NYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            A    +L ++ PP +E +Q+ + +    R S     I  G P PKI WFK  +GK      D +   +    +  +   D G Y C   +  G D  V  + VG    P I  SP  +   + + + L C    IP P   +I W + N  +  + +   T++          L+I     ED G + C     YG    S TL  T  +S +L
Sbjct:  690 ARDTTDLMLATPPKVEIIQNKMMVGRGDRVSFECKTI-RGKPHPKIRWFK--NGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRV--PTIIESPHTVRVNIERQVTLQCLAVGIPPP---EIEWQKGNVLLATLNNPRYTQL------ADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVL 889          
BLAST of AGAP000218-PA vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 65.4698 bits (158), Expect = 2.318e-10
Identity = 56/211 (26.54%), Postives = 101/211 (47.87%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWF---KIVSGKQDILLTRQPSFI-LQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTC-TIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSM 1908
            ++++++ L I  PPS++    ++    ++R+ ++LSC A G+PKP+++W+   + +       + +   F+ ++ +TH+D G Y+C A+S  G  R    +++ TP   +I  + K+       +   C TIR  P P   +I W +N K +  PD  +   E         L I+    ED G Y+C      G D       Q  NLS+
Sbjct:  598 MSTRKMRLDIMEPPSVKVTPQDVYF--NMREGVNLSCEAMGDPKPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQN-KMMVGRGDRVSFECKTIRGKPHP---KIRWFKNGKDLIKPDDYIKINEG-------QLHIMGAKDEDAGAYSCVGENMAGKD------VQVANLSV 789          

HSP 2 Score: 50.447 bits (119), Expect = 8.951e-6
Identity = 56/214 (26.17%), Postives = 86/214 (40.19%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQ-----DILLTRQPSFILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSPK-IFSELLKPIKLTCTIRSIPAPSPKQIIWTR-NYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            A    +L ++ PP +E +Q+ + +    R S     I  G P PKI WFK  +GK      D +   +    +  +   D G Y C   +  G D  V  + VG    P I  SP  +   + + + L C    IP P   +I W + N  +  + +   T++          L+I     ED G + C     YG    S TL  T  +S +L
Sbjct:  690 ARDTTDLMLATPPKVEIIQNKMMVGRGDRVSFECKTI-RGKPHPKIRWFK--NGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRV--PTIIESPHTVRVNIERQVTLQCLAVGIPPP---EIEWQKGNVLLATLNNPRYTQL------ADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVL 889          
BLAST of AGAP000218-PA vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 60.4622 bits (145), Expect = 5.156e-9
Identity = 43/156 (27.56%), Postives = 64/156 (41.03%), Query Frame = 1
Query: 1402 CIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPD-RIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD 1866
            C    NP P I+W +   G  D ++    +  L+       G Y C A   GF + +    +   GPP +    ++ + L +  ++ C I     P    + WT N K ++  + RI       P G    L I  +  EDFGVYNCS     G D
Sbjct:  378 CATLANPAPAIFWTR---GDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISG--RPKTNNVRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFD 528          

HSP 2 Score: 56.6102 bits (135), Expect = 6.985e-8
Identity = 38/118 (32.20%), Postives = 56/118 (47.46%), Query Frame = 1
Query:  160 EEPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKM-YHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKM 510
            E P++     G   IL CRV    ++Q   VQW+KD FG   +  + +  + R  M  S   G Y+L IS   + DD ++ACQ S     DH K  +  K      L ++V+P   K+
Sbjct:   27 EAPKDTLAAVGETAILTCRV----EHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQIS---ESDHAKAVVSSKAK----LTVLVRPTPPKI 133          
BLAST of AGAP000218-PA vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 60.4622 bits (145), Expect = 5.416e-9
Identity = 46/168 (27.38%), Postives = 69/168 (41.07%), Query Frame = 1
Query: 1402 CIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPD-RIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENL 1902
            C    NP P I+W +   G  D ++    +  L+       G Y C A   GF + +    +   GPP +    ++ + L +  ++ C I     P    + WT N K ++  + RI       P G    L I  +  EDFGVYNCS     G D    TL +  N+
Sbjct:  378 CATLANPAPAIFWTR---GDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISG--RPKTNNVRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRG-TLLKKRNI 539          

HSP 2 Score: 56.6102 bits (135), Expect = 7.674e-8
Identity = 38/118 (32.20%), Postives = 56/118 (47.46%), Query Frame = 1
Query:  160 EEPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKM-YHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKM 510
            E P++     G   IL CRV    ++Q   VQW+KD FG   +  + +  + R  M  S   G Y+L IS   + DD ++ACQ S     DH K  +  K      L ++V+P   K+
Sbjct:   27 EAPKDTLAAVGETAILTCRV----EHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQIS---ESDHAKAVVSSKAK----LTVLVRPTPPKI 133          
BLAST of AGAP000218-PA vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0343758)

HSP 1 Score: 90.8929 bits (224), Expect = 2.851e-18
Identity = 130/608 (21.38%), Postives = 221/608 (36.35%), Query Frame = 1
Query:  163 EPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKI-------------------QNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFI--KPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHND-YGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            EP++ T + G++V L CRV   +     T+QW KD FG    S +     R  M  S+ +G Y L I    + DD  Y CQ S        +  I    +G   L ++V P              E P   Q D               V++ + +    + C +    P A I W      +        +   Y  I   D +               + + S L+ + K E + +N   C   N  D    S    ++ V+  +   +++  + ++                       +     VR  C A  +  S + Y+W      FI  +P+    + E V   + ++ +   ++C V                 + +G + D   L            ISY PS    Q   ++   +   + L+C    NP+P+I W +  S +  ++ T   S  L  S  N+  G Y C A  PG+        V   G P I      +  +    ++ C   S+P    + + WT N + +  +        ++ +PGGV  TLII       +G YNC+V  +YG+D   I L   +++S+L+
Sbjct:   33 EPQDQTAVVGARVTLPCRVINKQG----TLQWTKDDFGL-GTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPG---PEGQPAIRSTFAG---LTVLVPP--------------EAPKITQGD---------------VIYATEDRKVEIECVSVGGKPAAEITW------IDGLGNVLTDNIEYTVIPLPDQR--------------RFTAKSVLRLTPKKEHHNTN-FSCQAQNTADRTYRSA---KIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRAD-ANPSDVRYRW------FINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEV----------------QNSVGKSEDSETL-----------DISYAPSFR--QRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDR--VVGT---STNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVP--RARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLM 533          
BLAST of AGAP000218-PA vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0070562)

HSP 1 Score: 90.8929 bits (224), Expect = 2.851e-18
Identity = 130/608 (21.38%), Postives = 221/608 (36.35%), Query Frame = 1
Query:  163 EPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKI-------------------QNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFI--KPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHND-YGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            EP++ T + G++V L CRV   +     T+QW KD FG    S +     R  M  S+ +G Y L I    + DD  Y CQ S        +  I    +G   L ++V P              E P   Q D               V++ + +    + C +    P A I W      +        +   Y  I   D +               + + S L+ + K E + +N   C   N  D    S    ++ V+  +   +++  + ++                       +     VR  C A  +  S + Y+W      FI  +P+    + E V   + ++ +   ++C V                 + +G + D   L            ISY PS    Q   ++   +   + L+C    NP+P+I W +  S +  ++ T   S  L  S  N+  G Y C A  PG+        V   G P I      +  +    ++ C   S+P    + + WT N + +  +        ++ +PGGV  TLII       +G YNC+V  +YG+D   I L   +++S+L+
Sbjct:   33 EPQDQTAVVGARVTLPCRVINKQG----TLQWTKDDFGL-GTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPG---PEGQPAIRSTFAG---LTVLVPP--------------EAPKITQGD---------------VIYATEDRKVEIECVSVGGKPAAEITW------IDGLGNVLTDNIEYTVIPLPDQR--------------RFTAKSVLRLTPKKEHHNTN-FSCQAQNTADRTYRSA---KIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRAD-ANPSDVRYRW------FINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEV----------------QNSVGKSEDSETL-----------DISYAPSFR--QRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDR--VVGT---STNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVP--RARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLM 533          
BLAST of AGAP000218-PA vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0332492)

HSP 1 Score: 75.0998 bits (183), Expect = 2.104e-13
Identity = 61/220 (27.73%), Postives = 98/220 (44.55%), Query Frame = 1
Query: 1273 CAVL-PVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDV----PDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLY-QTENLSMLL 1914
            C V+  V  + +  +L IS+ P     Q  +++   L  ++ + C   GNP+P+I W   +S   D ++       L++S+    G Y C A+  GF        +     P I      F  +   +K+ C   SIP    + I+W+   KI+++    PD  + +   +P GV   LII       FG YNC+V   YG D   ITL  +  N+ +LL
Sbjct:  361 CEVVNAVGKSEQSKKLDISFGPVFR--QRPVSVEADLGATVSMRCDVAGNPEPEIEW---ISENSDQVVGVAAELKLKVSSET-AGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIP--KAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLL 572          
BLAST of AGAP000218-PA vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309498)

HSP 1 Score: 75.0998 bits (183), Expect = 2.104e-13
Identity = 61/220 (27.73%), Postives = 98/220 (44.55%), Query Frame = 1
Query: 1273 CAVL-PVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDV----PDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLY-QTENLSMLL 1914
            C V+  V  + +  +L IS+ P     Q  +++   L  ++ + C   GNP+P+I W   +S   D ++       L++S+    G Y C A+  GF        +     P I      F  +   +K+ C   SIP    + I+W+   KI+++    PD  + +   +P GV   LII       FG YNC+V   YG D   ITL  +  N+ +LL
Sbjct:  361 CEVVNAVGKSEQSKKLDISFGPVFR--QRPVSVEADLGATVSMRCDVAGNPEPEIEW---ISENSDQVVGVAAELKLKVSSET-AGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIP--KAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLL 572          
BLAST of AGAP000218-PA vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070560)

HSP 1 Score: 75.0998 bits (183), Expect = 2.104e-13
Identity = 61/220 (27.73%), Postives = 98/220 (44.55%), Query Frame = 1
Query: 1273 CAVL-PVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDV----PDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLY-QTENLSMLL 1914
            C V+  V  + +  +L IS+ P     Q  +++   L  ++ + C   GNP+P+I W   +S   D ++       L++S+    G Y C A+  GF        +     P I      F  +   +K+ C   SIP    + I+W+   KI+++    PD  + +   +P GV   LII       FG YNC+V   YG D   ITL  +  N+ +LL
Sbjct:  361 CEVVNAVGKSEQSKKLDISFGPVFR--QRPVSVEADLGATVSMRCDVAGNPEPEIEW---ISENSDQVVGVAAELKLKVSSET-AGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIP--KAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLL 572          
BLAST of AGAP000218-PA vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 69.707 bits (169), Expect = 1.811e-11
Identity = 58/205 (28.29%), Postives = 94/205 (45.85%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSF---------ILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSP-KIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            +  +LS++ PP+I+D   ++++  H+ + + L C+  G P P+I W K    +  IL    P +         IL      D G Y C A +  G +R  KRV +    PP I   P  I   +     L+C    IP PS   + WT+N + ++  D+       +  G   +L+++A S ED  +Y C V  E G +  +I L
Sbjct: 3687 RHFKLSVNVPPTIKDGPQSVSV--HINQPVVLECVVNGVPAPRITWRK----QGSILAGNNPRYKFGEDGSLRILSAQV-TDTGRYLCMATNQAGTER--KRVDLQVYVPPSIAEGPTNITVTVNVQTTLSCEATGIPKPS---VSWTKNTQALNT-DQNQNMYRLLSSG---SLVVIAPSVEDTALYECVVSNEAGQESRAIQL 3875          

HSP 2 Score: 57.3806 bits (137), Expect = 1.006e-7
Identity = 55/196 (28.06%), Postives = 82/196 (41.84%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS-PKIFSE-----LLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG 1860
            K  +L +  PPSI +  +   +    R++  L+C  TGNP P+I W K    + S  +  +++      +  S   D G Y C A +   DR+ +   +     P I GS P+  +E     L  P  L C  +S P   P  I W ++      P      +  +PGG   TL I+    ED G Y C    E G
Sbjct: 2456 KNFDLYVLVPPSIVNEGTVEDVKVKERQNAILACEVTGNPVPEITWLKDGQPLASDTRLQVMSNGRFLQISASQVADTGRYSCLASNSAGDRS-RHFNLNVLVSPTIAGSGPEGSAEEVTVTLNSPTSLVCEAQSYP---PAIITWLKD----GTPFESSRNVRVLPGG--RTLQILNAKEEDAGRYTCVATNEAG 2641          

HSP 3 Score: 54.299 bits (129), Expect = 8.372e-7
Identity = 56/205 (27.32%), Postives = 87/205 (42.44%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS---PKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLY 1887
            A KE  L +   PSI     +    T     I L C A G P+P + W K    + +G++  +L       +  +   D G Y C A++    +A ++  V    PP I G    P+  S ++K P+ LTC    +P P+   I W ++ +    P    + +  I GG  + L+  A S  D G Y C V    G +  +  LY
Sbjct: 2268 AIKEYNLQVYVRPSISSSAQDEETVTR-GGDITLRCEADGVPRPAVSWMKDGRPLSTGRKAQILNEGRLLRILEAQVADTGRYTCIAINVA-GQADRKYDVNVHVPPTIIGQTHMPENISVVVKNPVVLTCEASGMPPPA---ITWLKDGQ----PISTSSSVRVISGGRGLRLMHAASS--DAGRYTCIVSNSAGEERKNFDLY 2461          

HSP 4 Score: 53.5286 bits (127), Expect = 1.437e-6
Identity = 51/212 (24.06%), Postives = 89/212 (41.98%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVK---RVIVGTPGPPKIYGSPKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDY--FSITLYQTENL 1902
            A + I LS+  PPSI+     +         I L C ATG+P P + W+K    + S     +L+R     +  +  +D G Y+C A++      +    +V V    PP I     + + ++  P++L C    +P PS   + W +    V         ++ + GG +++ I   VS  D G Y C      G  +  + + +Y   N+
Sbjct: 1899 AQQHIRLSVHEPPSIQYAGEMLNETILAGFQIQLKCKATGSPLPAVTWYKDGRPLTSAAGVNILSRGHVLEIDRAQVSDAGFYKCVAINVAGSTELTYSLQVYV----PPTISSKGGMVTVVVNDPVRLECEASGVPVPS---LTWLKEGSPV---SSFSDGIQVLSGGRVLSFISAQVS--DAGHYTCVAVNAGGEQHREYELRVYVPPNI 2098          

HSP 5 Score: 53.1434 bits (126), Expect = 1.898e-6
Identity = 53/214 (24.77%), Postives = 96/214 (44.86%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSI--EDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK-----IVSGKQDILLTRQPSFILQMSTH-NDYGEYQCHALSPGFDRAVKRVI-VGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPS-PKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLYQTENL 1902
            A K   L I  PP+I   +L S +++   L  S+ L C A G P P+I W K       + +++I ++   S +   + H +D G+Y C A +   +    R+  +    PP I G+     EL   +  +  I  + + S P Q+ W +N     +P  + +++  +  G ++ +    VS  D G Y C      G D  ++++ +Y   +L
Sbjct: 3217 AQKNYHLVIHVPPNIIGSELPSEMSVL--LNDSVQLVCRAEGTPTPEIQWLKDGMTISRTAQKNIKISPDGSTLTVTAVHTSDSGKYTCVATNQAGEE--DRIFNLNVYVPPLIQGNGPAAKELTTVLDSSINIECVASGSPPPQLNWLKN----GLPLPVSSQIRLLSAGQVLRIARAQVS--DGGSYTCVASNRAGVDNRHYTLQVYVPPSL 3420          

HSP 6 Score: 51.9878 bits (123), Expect = 4.643e-6
Identity = 58/223 (26.01%), Postives = 95/223 (42.60%), Query Frame = 1
Query: 1252 DIGNTPDCAVLPVTIASKEIELSISYPPSIED--LQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKI---YGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG--SDYFSITLY 1887
            D G     AV       K+ +L ++ PP I D  L SN+++   + +  +L C  TG P P I W+K    +V      +L +  +  L  +   D G Y C A++    R  +   +    PP I    GS  + + L + I L C ++  P P+   I W ++ K V + D     +E +  G    L I +    D   Y CS     G  S  F+++++
Sbjct: 1324 DNGEYTCMAVNDAGTTEKKYQLKVNVPPDIRDNGLLSNVSVV--INQPTNLVCDVTGTPVPVITWYKDGVEVVPSSDVQILQKGKTLKLLKAAVQDAGRYICKAINIAGSRE-RDFYLDVLVPPTIIGTVGSRDLSAVLNQEIVLECKVKGDPFPT---IQWYKDRKPVFLGD---PNIEVLNRG--QQLKIKSARLGDQARYQCSATNAAGKQSKDFNLSIF 1535          

HSP 7 Score: 51.6026 bits (122), Expect = 6.398e-6
Identity = 58/209 (27.75%), Postives = 82/209 (39.23%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPS---------FILQMSTHNDYGEYQCHAL-SPGFD-RAVKRVIVGTPGPPKIYGSPKIFSELLKPIKL--------TCTIRSIPAPSPKQIIWTRNYKIVDVP-DRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGS 1863
            +S +I L++  PPSI   +S +++  + +    L+C+A G P+P I W      K DI LT   +          ++  +   D G Y C    S G D R +   I   P           F+ELL  + L         C +  IP P   +I WT N  IV    D      E         L+I  VS +D G Y C      GS
Sbjct: 4141 SSLDISLTVQIPPSIRVGESEVSVVENTQAL--LTCVADGVPQPTITW-----EKDDIPLTDTTAEYTILPTGDLLIDTAQPEDSGSYTCVGTNSMGQDSRTISLSIHTHPA----------FTELLGDVALNKRERLLMVCGVTGIPPP---KITWTFNNNIVPAQYDHYNGHSE---------LVIERVSKDDSGTYTCMAENSVGS 4320          

HSP 8 Score: 51.2174 bits (121), Expect = 8.381e-6
Identity = 53/206 (25.73%), Postives = 85/206 (41.26%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDI---LLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLY 1887
            K   L+I  PP ++       + T +   +  +C ATG P P + W K   ++   + +   +L+      +  S  +D G Y C A S    +A K   +    PP I GS  P   S LL   ++L C     P P   +I W ++   +    +   K+   P G   TL + AV   D G Y C    + G +   F++ +Y
Sbjct: 3125 KNFHLNIHVPPRLDGPAEERVVET-ISNPVTFACDATGIPPPSLTWLKNGRVIENSESLEMHILSGGSKLQISRSQLSDSGTYTCVA-SNVEGKAQKNYHLVIHVPPNIIGSELPSEMSVLLNDSVQLVCRAEGTPTP---EIQWLKDGMTISRTAQKNIKIS--PDG--STLTVTAVHTSDSGKYTCVATNQAGEEDRIFNLNVY 3321          
BLAST of AGAP000218-PA vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 69.707 bits (169), Expect = 1.811e-11
Identity = 58/205 (28.29%), Postives = 94/205 (45.85%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSF---------ILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSP-KIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            +  +LS++ PP+I+D   ++++  H+ + + L C+  G P P+I W K    +  IL    P +         IL      D G Y C A +  G +R  KRV +    PP I   P  I   +     L+C    IP PS   + WT+N + ++  D+       +  G   +L+++A S ED  +Y C V  E G +  +I L
Sbjct: 3688 RHFKLSVNVPPTIKDGPQSVSV--HINQPVVLECVVNGVPAPRITWRK----QGSILAGNNPRYKFGEDGSLRILSAQV-TDTGRYLCMATNQAGTER--KRVDLQVYVPPSIAEGPTNITVTVNVQTTLSCEATGIPKPS---VSWTKNTQALNT-DQNQNMYRLLSSG---SLVVIAPSVEDTALYECVVSNEAGQESRAIQL 3876          

HSP 2 Score: 57.3806 bits (137), Expect = 1.006e-7
Identity = 55/196 (28.06%), Postives = 82/196 (41.84%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS-PKIFSE-----LLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG 1860
            K  +L +  PPSI +  +   +    R++  L+C  TGNP P+I W K    + S  +  +++      +  S   D G Y C A +   DR+ +   +     P I GS P+  +E     L  P  L C  +S P   P  I W ++      P      +  +PGG   TL I+    ED G Y C    E G
Sbjct: 2457 KNFDLYVLVPPSIVNEGTVEDVKVKERQNAILACEVTGNPVPEITWLKDGQPLASDTRLQVMSNGRFLQISASQVADTGRYSCLASNSAGDRS-RHFNLNVLVSPTIAGSGPEGSAEEVTVTLNSPTSLVCEAQSYP---PAIITWLKD----GTPFESSRNVRVLPGG--RTLQILNAKEEDAGRYTCVATNEAG 2642          

HSP 3 Score: 54.299 bits (129), Expect = 8.372e-7
Identity = 56/205 (27.32%), Postives = 87/205 (42.44%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS---PKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLY 1887
            A KE  L +   PSI     +    T     I L C A G P+P + W K    + +G++  +L       +  +   D G Y C A++    +A ++  V    PP I G    P+  S ++K P+ LTC    +P P+   I W ++ +    P    + +  I GG  + L+  A S  D G Y C V    G +  +  LY
Sbjct: 2269 AIKEYNLQVYVRPSISSSAQDEETVTR-GGDITLRCEADGVPRPAVSWMKDGRPLSTGRKAQILNEGRLLRILEAQVADTGRYTCIAINVA-GQADRKYDVNVHVPPTIIGQTHMPENISVVVKNPVVLTCEASGMPPPA---ITWLKDGQ----PISTSSSVRVISGGRGLRLMHAASS--DAGRYTCIVSNSAGEERKNFDLY 2462          

HSP 4 Score: 53.5286 bits (127), Expect = 1.437e-6
Identity = 51/212 (24.06%), Postives = 89/212 (41.98%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVK---RVIVGTPGPPKIYGSPKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDY--FSITLYQTENL 1902
            A + I LS+  PPSI+     +         I L C ATG+P P + W+K    + S     +L+R     +  +  +D G Y+C A++      +    +V V    PP I     + + ++  P++L C    +P PS   + W +    V         ++ + GG +++ I   VS  D G Y C      G  +  + + +Y   N+
Sbjct: 1900 AQQHIRLSVHEPPSIQYAGEMLNETILAGFQIQLKCKATGSPLPAVTWYKDGRPLTSAAGVNILSRGHVLEIDRAQVSDAGFYKCVAINVAGSTELTYSLQVYV----PPTISSKGGMVTVVVNDPVRLECEASGVPVPS---LTWLKEGSPV---SSFSDGIQVLSGGRVLSFISAQVS--DAGHYTCVAVNAGGEQHREYELRVYVPPNI 2099          

HSP 5 Score: 53.1434 bits (126), Expect = 1.898e-6
Identity = 53/214 (24.77%), Postives = 96/214 (44.86%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSI--EDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK-----IVSGKQDILLTRQPSFILQMSTH-NDYGEYQCHALSPGFDRAVKRVI-VGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPS-PKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLYQTENL 1902
            A K   L I  PP+I   +L S +++   L  S+ L C A G P P+I W K       + +++I ++   S +   + H +D G+Y C A +   +    R+  +    PP I G+     EL   +  +  I  + + S P Q+ W +N     +P  + +++  +  G ++ +    VS  D G Y C      G D  ++++ +Y   +L
Sbjct: 3218 AQKNYHLVIHVPPNIIGSELPSEMSVL--LNDSVQLVCRAEGTPTPEIQWLKDGMTISRTAQKNIKISPDGSTLTVTAVHTSDSGKYTCVATNQAGEE--DRIFNLNVYVPPLIQGNGPAAKELTTVLDSSINIECVASGSPPPQLNWLKN----GLPLPVSSQIRLLSAGQVLRIARAQVS--DGGSYTCVASNRAGVDNRHYTLQVYVPPSL 3421          

HSP 6 Score: 51.9878 bits (123), Expect = 4.643e-6
Identity = 58/223 (26.01%), Postives = 95/223 (42.60%), Query Frame = 1
Query: 1252 DIGNTPDCAVLPVTIASKEIELSISYPPSIED--LQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKI---YGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG--SDYFSITLY 1887
            D G     AV       K+ +L ++ PP I D  L SN+++   + +  +L C  TG P P I W+K    +V      +L +  +  L  +   D G Y C A++    R  +   +    PP I    GS  + + L + I L C ++  P P+   I W ++ K V + D     +E +  G    L I +    D   Y CS     G  S  F+++++
Sbjct: 1325 DNGEYTCMAVNDAGTTEKKYQLKVNVPPDIRDNGLLSNVSVV--INQPTNLVCDVTGTPVPVITWYKDGVEVVPSSDVQILQKGKTLKLLKAAVQDAGRYICKAINIAGSRE-RDFYLDVLVPPTIIGTVGSRDLSAVLNQEIVLECKVKGDPFPT---IQWYKDRKPVFLGD---PNIEVLNRG--QQLKIKSARLGDQARYQCSATNAAGKQSKDFNLSIF 1536          

HSP 7 Score: 51.6026 bits (122), Expect = 6.398e-6
Identity = 58/209 (27.75%), Postives = 82/209 (39.23%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPS---------FILQMSTHNDYGEYQCHAL-SPGFD-RAVKRVIVGTPGPPKIYGSPKIFSELLKPIKL--------TCTIRSIPAPSPKQIIWTRNYKIVDVP-DRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGS 1863
            +S +I L++  PPSI   +S +++  + +    L+C+A G P+P I W      K DI LT   +          ++  +   D G Y C    S G D R +   I   P           F+ELL  + L         C +  IP P   +I WT N  IV    D      E         L+I  VS +D G Y C      GS
Sbjct: 4142 SSLDISLTVQIPPSIRVGESEVSVVENTQAL--LTCVADGVPQPTITW-----EKDDIPLTDTTAEYTILPTGDLLIDTAQPEDSGSYTCVGTNSMGQDSRTISLSIHTHPA----------FTELLGDVALNKRERLLMVCGVTGIPPP---KITWTFNNNIVPAQYDHYNGHSE---------LVIERVSKDDSGTYTCMAENSVGS 4321          

HSP 8 Score: 51.2174 bits (121), Expect = 8.381e-6
Identity = 53/206 (25.73%), Postives = 85/206 (41.26%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDI---LLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLY 1887
            K   L+I  PP ++       + T +   +  +C ATG P P + W K   ++   + +   +L+      +  S  +D G Y C A S    +A K   +    PP I GS  P   S LL   ++L C     P P   +I W ++   +    +   K+   P G   TL + AV   D G Y C    + G +   F++ +Y
Sbjct: 3126 KNFHLNIHVPPRLDGPAEERVVET-ISNPVTFACDATGIPPPSLTWLKNGRVIENSESLEMHILSGGSKLQISRSQLSDSGTYTCVA-SNVEGKAQKNYHLVIHVPPNIIGSELPSEMSVLLNDSVQLVCRAEGTPTP---EIQWLKDGMTISRTAQKNIKIS--PDG--STLTVTAVHTSDSGKYTCVATNQAGEEDRIFNLNVY 3322          
BLAST of AGAP000218-PA vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 67.0106 bits (162), Expect = 7.620e-11
Identity = 48/176 (27.27%), Postives = 79/176 (44.89%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             SC   GNP   I W K   G   ++L+ + +  L+     D G+Y C A+ P      K V++   GPP I  +    +   +  ++ C IRS P P   +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L +  +L + +
Sbjct:  284 FSCAWIGNPSLTIVWMKRGHG---VVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPPD--RIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAV 454          
BLAST of AGAP000218-PA vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 67.0106 bits (162), Expect = 9.163e-11
Identity = 48/176 (27.27%), Postives = 79/176 (44.89%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             SC   GNP   I W K   G   ++L+ + +  L+     D G+Y C A+ P      K V++   GPP I  +    +   +  ++ C IRS   P P +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L +  +L + +
Sbjct:  327 FSCAWIGNPSLTIVWMKRGHG---VVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAV 497          
BLAST of AGAP000218-PA vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 67.0106 bits (162), Expect = 9.163e-11
Identity = 48/176 (27.27%), Postives = 79/176 (44.89%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             SC   GNP   I W K   G   ++L+ + +  L+     D G+Y C A+ P      K V++   GPP I  +    +   +  ++ C IRS   P P +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L +  +L + +
Sbjct:  327 FSCAWIGNPSLTIVWMKRGHG---VVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAV 497          
BLAST of AGAP000218-PA vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 71.2478 bits (173), Expect = 4.696e-12
Identity = 51/174 (29.31%), Postives = 76/174 (43.68%), Query Frame = 1
Query: 1402 CIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVP--DRIMTKMEWIPGGVIMTLIIVAVSYEDFGV-YNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            C  TGNP P  +W K  +G+   +L+   + +L   T  D G Y C A+ P      K V +   GPP I       + L    ++ C I S PA  P +I+W  + + ++     R   + E    G I  L+I      DF   +NCS   +YG D   ++L Q   L + L
Sbjct:  331 CGWTGNPTPTQFWSKKGTGE---VLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPA--PDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPLTL 499          
BLAST of AGAP000218-PA vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 70.8626 bits (172), Expect = 5.680e-12
Identity = 51/174 (29.31%), Postives = 76/174 (43.68%), Query Frame = 1
Query: 1402 CIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVP--DRIMTKMEWIPGGVIMTLIIVAVSYEDFGV-YNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            C  TGNP P  +W K  +G+   +L+   + +L   T  D G Y C A+ P      K V +   GPP I       + L    ++ C I S PA  P +I+W  + + ++     R   + E    G I  L+I      DF   +NCS   +YG D   ++L Q   L + L
Sbjct:  359 CGWTGNPTPTQFWSKKGTGE---VLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPA--PDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPLTL 527          
BLAST of AGAP000218-PA vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 69.707 bits (169), Expect = 1.253e-11
Identity = 49/166 (29.52%), Postives = 73/166 (43.98%), Query Frame = 1
Query: 1402 CIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVP--DRIMTKMEWIPGGVIMTLIIVAVSYEDFGV-YNCSVFTEYGSDYFSITLYQ 1890
            C  TGNP P  +W K  +G+   +L+   + +L   T  D G Y C A+ P      K V +   GPP I       + L    ++ C I S PA  P +I+W  + + ++     R   + E    G I  L+I      DF   +NCS   +YG D   ++L Q
Sbjct:  335 CGWTGNPTPTQFWSKKGTGE---VLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPA--PDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQ 495          
BLAST of AGAP000218-PA vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 69.707 bits (169), Expect = 1.505e-11
Identity = 49/166 (29.52%), Postives = 73/166 (43.98%), Query Frame = 1
Query: 1402 CIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVP--DRIMTKMEWIPGGVIMTLIIVAVSYEDFGV-YNCSVFTEYGSDYFSITLYQ 1890
            C  TGNP P  +W K  +G+   +L+   + +L   T  D G Y C A+ P      K V +   GPP I       + L    ++ C I S PA  P +I+W  + + ++     R   + E    G I  L+I      DF   +NCS   +YG D   ++L Q
Sbjct:  322 CGWTGNPTPTQFWSKKGTGE---VLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPA--PDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQ 482          
BLAST of AGAP000218-PA vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 69.707 bits (169), Expect = 1.681e-11
Identity = 51/174 (29.31%), Postives = 76/174 (43.68%), Query Frame = 1
Query: 1402 CIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVP--DRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            C  TGNP P  +W K  +G+   +L+   + +L   T  D G Y C A+ P      K V +   GPP I       + L    ++ C I S PA  P +I+W  + + ++     R   + E    G I  L+I      DF   +NCS   +YG D   ++L Q   L + L
Sbjct:  315 CGWTGNPTPTQFWSKKGTGE---VLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPA--PDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPLTL 483          
BLAST of AGAP000218-PA vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 73.1738 bits (178), Expect = 1.033e-12
Identity = 50/174 (28.74%), Postives = 75/174 (43.10%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             SC   GNP   I W K  SG   ++L+ + +  L+     D G+Y C A+ P      + V +   GPP I  +    +   +  ++ C IRS P P      W  N        R   +      GVI TL I  +   DF  +YNC+ +  +GSD   I L + E++ M +
Sbjct:  321 FSCAWIGNPSLTIVWMKRGSG---VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAV 491          
BLAST of AGAP000218-PA vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 73.1738 bits (178), Expect = 1.033e-12
Identity = 50/174 (28.74%), Postives = 75/174 (43.10%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             SC   GNP   I W K  SG   ++L+ + +  L+     D G+Y C A+ P      + V +   GPP I  +    +   +  ++ C IRS P P      W  N        R   +      GVI TL I  +   DF  +YNC+ +  +GSD   I L + E++ M +
Sbjct:  321 FSCAWIGNPSLTIVWMKRGSG---VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAV 491          
BLAST of AGAP000218-PA vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 72.7886 bits (177), Expect = 1.329e-12
Identity = 50/174 (28.74%), Postives = 75/174 (43.10%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             SC   GNP   I W K  SG   ++L+ + +  L+     D G+Y C A+ P      + V +   GPP I  +    +   +  ++ C IRS P P      W  N        R   +      GVI TL I  +   DF  +YNC+ +  +GSD   I L + E++ M +
Sbjct:  354 FSCAWIGNPSLTIVWMKRGSG---VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAV 524          
BLAST of AGAP000218-PA vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 72.4034 bits (176), Expect = 1.740e-12
Identity = 50/173 (28.90%), Postives = 75/173 (43.35%), Query Frame = 1
Query: 1399 SCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            SC   GNP   I W K  SG   ++L+ + +  L+     D G+Y C A+ P      + V +   GPP I  +    +   +  ++ C IRS P P      W  N        R   +      GVI TL I  +   DF  +YNC+ +  +GSD   I L + E++ M +
Sbjct:  322 SCAWIGNPSLTIVWMKRGSG---VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAV 491          
BLAST of AGAP000218-PA vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 71.633 bits (174), Expect = 4.884e-12
Identity = 64/222 (28.83%), Postives = 103/222 (46.40%), Query Frame = 1
Query: 1246 NSDIGNTPDCAVLPVTIASK---EIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQPSFILQMSTH-NDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSP-KIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            N+D+G+T +   +   IA K   E  L+++ PPSI       ++ T L KSI L C A G P P+I W K   +++         +  F+   S H  D G Y C A +  G DR  +R+ +    PP I   P  +   +     L C    IP PS   + W +N  +++V D+       +  G   +L+I++ S +D   Y C+V ++ G D  ++ L
Sbjct: 3680 NADLGDTANYTCVASNIAGKTTREFNLTVNVPPSIGGGPQ--SLVTLLNKSIALECRAEGVPAPRITWRKDGVVLAESHARYSILENGFLHIESAHVTDTGRYLCMATNVAGTDR--RRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPS---VTWRKNGHLLNV-DQNQNSYRLLSSG---SLVIISPSVDDTASYECTVTSDAGEDKRAVDL 3890          

HSP 2 Score: 60.8474 bits (146), Expect = 9.952e-9
Identity = 76/307 (24.76%), Postives = 127/307 (41.37%), Query Frame = 1
Query:  994 TVKIQNLSNDDLVRFACYATFSENSRIFY-----------------KWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRK--SIHLSCIATGNPKPKIYWFK---IVSGKQDI-LLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYG--SPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNC 1839
            +++I N    D  R+ C A  +  S   Y                   S+V NHFI    E S     DL   K    ++    VL  P         +++ SD G+    A+     + K++ L++  PPSI+D  S      ++R+  S+ L C +   P P I W K   ++    ++ +LT   +  ++ +  +D G+Y C A++    R  K   +    PP I G  +  I   +  P+ LTC    IP P+   I W +N+K ++  D +  ++  + GG    L I      + G Y C
Sbjct: 2926 SLQILNAQITDTGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPNHEHLSVVVNHFISLNCEVSGFPPPDLSWLKNEEPIKPNTNVLTVPGGRTLQIIRAKI-SDGGDYTCIAINQAGESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTNVEILTGGQTLHIRRAEVSDTGQYVCRAINVA-GRDDKNFHLNVYVPPTIEGPETEVIVETISNPVTLTCDATGIPPPT---ITWLKNHKPIENSDPL--EVHILSGG--SKLQIARPQRSNSGNYTC 3223          

HSP 3 Score: 59.6918 bits (143), Expect = 2.006e-8
Identity = 45/151 (29.80%), Postives = 74/151 (49.01%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLT-RQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYG---SPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIV 1731
            K+  +++  PPSI    S   ++  L  ++ L C  TG P P I+WFK    +  G  +I L+ R  S  L+ +  +D G YQC  +S    +  K + +    PP I G   + +I + L   +KL C  R +P P+   I W ++ ++V
Sbjct: 1441 KDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFLGDPNIELSDRGQSLHLRNARRSDKGRYQC-TVSNAAGKQAKDIKLTVYVPPSIKGGNITTEISALLNSIVKLECETRGLPVPA---ITWYKDGQVV 1587          

HSP 4 Score: 58.151 bits (139), Expect = 7.361e-8
Identity = 54/202 (26.73%), Postives = 81/202 (40.10%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHAL-SPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPI-KLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            A +  +L +  PPS++D          +   I L C ATG P P I W+K    +        L R     +  +  +D G Y+C A+ S G       + V    PP I GS  +   ++  + +L C  R IPAPS   + W ++   V         ++ + GG I+ L    +S  D G Y C      G     I L
Sbjct: 1906 AHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKATGKPLPVITWYKDSHPLSGSASAAFLKRGQVLEIGSAQISDAGIYKCVAINSAGATELFYSLQVHV--PPSISGSSSMVEVVVNNLARLECEARGIPAPS---LTWLKDGSPV---SSFSNGIQILSGGRILALTSAQMS--DAGRYTCVAVNAAGEKQRDIDL 2097          

HSP 5 Score: 55.8398 bits (133), Expect = 2.989e-7
Identity = 56/217 (25.81%), Postives = 94/217 (43.32%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQM--STHNDYGEYQCHALSPGF--DRAVK-RVIVGTPGPPKIYG----SPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLYQTENL 1902
            A K   L I  PPS+   +    ++  L +++ L C A G P P + W +    IV+G+ + +        L +  +  +D G+Y C A +P    DR     V V    PPKI G    + K+ + +   I + C     P   P QI W +N     +P  I + +  +  G ++ ++   VS  D  VY C      G D  ++S+ ++   N+
Sbjct: 3232 AQKNFILFIQVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGKPIVNGETERVRVTTDGSTLNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYV----PPKIRGNKEEAEKLMALVDTSINIECKATGTP---PPQINWLKN----GLPLPISSHIRLLSAGQVVRIVRAQVS--DIAVYTCVASNRAGVDSKHYSLQVFVPPNM 3435          

HSP 6 Score: 54.6842 bits (130), Expect = 8.439e-7
Identity = 49/199 (24.62%), Postives = 89/199 (44.72%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQPSFILQM--STHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD 1866
            + SK   L +  PP++++      I      S  ++C   G P P + W +    ++    + ++ Q   +LQ+  +   D G+Y C A +   + + K  ++    PP I GS  P   S ++  P++L+C    IPAP   +I W ++ +    P     +++ + GG I  L + +   ED G Y C   +  G D
Sbjct: 3420 VDSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAHLTVSTQ-GMVLQLIKAETEDTGKYTCVATNEAGEVS-KHFVLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAP---KISWMKDGR----PFLQTEQVQTLEGGAI--LRVSSAQVEDTGRYTCLASSPAGDD 3607          

HSP 7 Score: 53.5286 bits (127), Expect = 1.603e-6
Identity = 47/159 (29.56%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 1300 SKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGK----QDILLTRQPSFILQMSTHN--DYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYG--SPKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRI 1749
            SK   L +  PP I   +    ++  +   + LSCIA+G P PKI W K   G+     + + T +   IL++S+    D G Y C A SP  D   K  +V    PP I G    + F+ L  + + L C   ++P P    I+W +N + +    R+
Sbjct: 3515 SKHFVLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAPKISWMK--DGRPFLQTEQVQTLEGGAILRVSSAQVEDTGRYTCLASSPAGDDD-KEYLVRVHVPPNIAGMDEAQDFTVLRNRQVTLECKSDAVPPPV---IMWLKNREQLQATPRV 3667          

HSP 8 Score: 52.7582 bits (125), Expect = 2.993e-6
Identity = 61/206 (29.61%), Postives = 82/206 (39.81%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK-----IVSGKQDILLTRQPSFILQMS--THNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            A + + L +  PP I+   S + +   L   I L C ATG P P I W K     I SGK   +L   PS  LQ+S     D G Y C A +P    A+ +V +    PP I    K +   + KP+ L C     P   P  I W ++   +   +  RI+             L I     +D G Y C      GS   S TL
Sbjct: 3975 AHRHVTLRVQEPPVIQPQPSELDVI--LNNPILLPCEATGIPTPFITWQKEGINVITSGKSLAIL---PSGSLQISRAVRGDAGTYMCVAQNPA-GTALGKVKLNVQVPPVISSHQKEYVVTMDKPVSLLCETEGSP---PPDITWHKDGHALTESIRQRILNS---------GALQIAFAQPDDAGQYTCMAANMAGSSSVSSTL 4162          

HSP 9 Score: 52.7582 bits (125), Expect = 3.175e-6
Identity = 55/213 (25.82%), Postives = 90/213 (42.25%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIE-DLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQPSFILQMST-HNDYGEYQCHALSPGFDRAVK---RVIVGTPGPPKIYGSPK-----IFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDY---FSITLY 1887
            A K   + I  PP+IE DL +       + +S+ L C A GNP P + W K    V    +I +      +  +S    D G+Y C A S   +R +K    V+V    PP + G  +     + +  L  ++L C +   P P+   I+W +  +++D  D     +          L+I      D G+Y C V T    D+   F +T++
Sbjct: 1626 AEKSFHVDIYVPPTIEGDLTAPSNKQVIIGQSLILECKAAGNPPPILTWLKDGVPVKASDNIHIEAGGKKLEILSALEVDRGQYICVATSVAGEREIKYEVDVLV----PPAVEGGEETSYFIVLANNL--LELDCQVSGSPPPT---IMWLKGGQLIDERDGFKILLNG------RKLVIAQAQVSDTGLYQC-VATNIAGDHRKEFEVTVH 1822          
BLAST of AGAP000218-PA vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 3.611e-12
Identity = 65/222 (29.28%), Postives = 104/222 (46.85%), Query Frame = 1
Query: 1246 NSDIGNTPDCAVLPVTIASK---EIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQPSFILQMSTH-NDYGEYQCHAL-SPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLK-PIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            N+D+G+T +   +   IA K   E  L+++ PP+I+    ++ I   L KS  L CIA G P P+I W K   +++G        +  F+   S H  D G Y C A  + G DR  +R+ +    PP I   P   + ++     L C    IP PS   I W +N  +++V D+       +  G   +L+I++ S +D   Y C+V    G D  ++ L
Sbjct: 3681 NADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQSLVIL--LNKSTVLECIAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGRYLCMATNAAGTDR--RRIDLQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPS---INWRKNGHLLNV-DQNQNSYRLLSSG---SLVIISPSVDDTATYECTVTNGAGDDKRTVDL 3891          

HSP 2 Score: 59.3066 bits (142), Expect = 2.124e-7
Identity = 56/200 (28.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDI-LLTRQPSFILQMSTHNDYGEYQCHAL-SPGFDRAVKRVIVGTPGPPKIYGS-PKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            + I+L +  PPS+ED    +     +   + L C A GNP P I W+K   ++SG   +  L R     ++ +  +D G Y+C A+ S G       + V     P I GS   +   +  P++L C  R IPAPS   + W ++   V         ++ + GG I+ L    +S  D G Y C      G     I L
Sbjct: 1909 QHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQIIDIESAQISDAGIYKCVAINSAGATELFYSLQVHV--APSISGSNNMVAVVVNNPVRLECEARGIPAPS---LTWLKDGSPV---SSFSNGLQVLSGGRILALTSAQIS--DTGRYTCVAVNAAGEKQRDIDL 2098          

HSP 3 Score: 58.151 bits (139), Expect = 4.736e-7
Identity = 50/198 (25.25%), Postives = 86/198 (43.43%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVS--GKQDILLTRQPSFILQM--STHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS---PKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD 1866
            + +K   L +  PP++++      I      S  ++CI  G P P + W +     G    L       +LQ+  +   D G+Y C A +   + + K  I+    PP I GS    +I   +  P++LTC    IPAP   ++ W ++ + +   D++ T    + GG ++ +    V  ED G Y C   +  G D
Sbjct: 3421 VDNKHYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDAHLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVS-KHFILKVLEPPHINGSEEHEEISVIVNNPLELTCIASGIPAP---KMTWMKDGRPLPQTDQVQT----LGGGEVLRISTAQV--EDTGRYTCLASSPAGDD 3608          

HSP 4 Score: 55.8398 bits (133), Expect = 2.220e-6
Identity = 48/159 (30.19%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 1300 SKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGK----QDILLTRQPSFILQMSTHN--DYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRI 1749
            SK   L +  PP I   + +  I+  +   + L+CIA+G P PK+ W K   G+     D + T     +L++ST    D G Y C A SP  D   K  +V    PP I G+  P+  + L  + + L C   ++P P    I W RN + +    R+
Sbjct: 3516 SKHFILKVLEPPHINGSEEHEEISVIVNNPLELTCIASGIPAPKMTWMK--DGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCLASSPAGDDD-KEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPV---ITWLRNGERLQATPRV 3668          

HSP 5 Score: 55.4546 bits (132), Expect = 3.033e-6
Identity = 59/208 (28.37%), Postives = 87/208 (41.83%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKI-----VSGKQDILLTRQPSFILQMS--THNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELL---KPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            A + + L +  PP I+   S + +   L   I L C ATG P P I W K       SG+   +L   PS  LQ+S     D G Y C A +P    A+ ++ +    PP I  SP +   ++   KPI L+C    +P   P  I W ++ + +   +  R+++           +L I  V   D G Y C      GS   S  L
Sbjct: 3976 AHRHVTLHVHEPPVIQPQPSELHVI--LNNPILLPCEATGTPSPFITWQKEGINVNTSGRNHAVL---PSGGLQISRAVREDAGTYMCVAQNPA-GTALGKIKLNVQVPPVI--SPHLKEYVIAVDKPITLSCEADGLP---PPDITWHKDGRAIVESIRQRVLSS---------GSLQIAFVQPGDAGHYTCMAANVAGSSSTSTKL 4163          

HSP 6 Score: 53.9138 bits (128), Expect = 8.565e-6
Identity = 60/221 (27.15%), Postives = 88/221 (39.82%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK--------------IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLYQTENL 1902
            K   L++  PPSIE  +  + + T +   + L+C ATG P P I W K              I+SG   + + R        S H+D G Y C A S    +A K   +    PP + G+  P   S LL + ++L C    IP P    I W ++ K +     +RI             TL I      D G Y C      G +   F++ +Y T  +
Sbjct: 3141 KNFHLNVYVPPSIEGPEREVIVET-ISNPVTLTCDATGIPPPTIAWLKNHKRIENSDSLEVRILSGGSKLQIAR--------SQHSDSGNYTCIA-SNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTP---LIQWLKDGKPIASGETERIRVSANG------STLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTI 3342          
BLAST of AGAP000218-PA vs. UniProt/SwissProt
Match: sp|Q5VST9|OBSCN_HUMAN (Obscurin OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=3)

HSP 1 Score: 74.3294 bits (181), Expect = 5.651e-12
Identity = 58/197 (29.44%), Postives = 90/197 (45.69%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWF---KIVSGKQDILLTRQP----SFILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGP--PKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGS 1863
            + + L +  PP  E+  ++ T    L +++ L+C  TG PKP I W+   K V      +L   P    + IL   T  D G+Y C A S  G    + +++V  P     K+  SP +  E     + TCTI   P P   QI W ++  ++   ++  T  E  P   ++ L+I A S ED G+Y C +    GS
Sbjct: 6004 QRLALPVWRPPDFEEELADCT--AELGETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNKVRASPFVEGE---DAQFTCTIEGAPYP---QIRWYKDGALLTTGNKFQTLSE--PRSGLLVLVIRAASKEDLGLYECELVNRLGS 6190          
BLAST of AGAP000218-PA vs. UniProt/SwissProt
Match: sp|D3YXG0|HMCN1_MOUSE (Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.421e-11
Identity = 64/222 (28.83%), Postives = 103/222 (46.40%), Query Frame = 1
Query: 1246 NSDIGNTPDCAVLPVTIASK---EIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQPSFILQMSTH-NDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSP-KIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            N+D+G+T +   +   IA K   E  L+++ PPSI       ++ T L KSI L C A G P P+I W K   +++         +  F+   S H  D G Y C A +  G DR  +R+ +    PP I   P  +   +     L C    IP PS   + W +N  +++V D+       +  G   +L+I++ S +D   Y C+V ++ G D  ++ L
Sbjct: 3680 NADLGDTANYTCVASNIAGKTTREFNLTVNVPPSIGGGPQ--SLVTLLNKSIALECRAEGVPAPRITWRKDGVVLAESHARYSILENGFLHIESAHVTDTGRYLCMATNVAGTDR--RRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPS---VTWRKNGHLLNV-DQNQNSYRLLSSG---SLVIISPSVDDTASYECTVTSDAGEDKRAVDL 3890          

HSP 2 Score: 60.8474 bits (146), Expect = 6.624e-8
Identity = 76/307 (24.76%), Postives = 127/307 (41.37%), Query Frame = 1
Query:  994 TVKIQNLSNDDLVRFACYATFSENSRIFY-----------------KWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRK--SIHLSCIATGNPKPKIYWFK---IVSGKQDI-LLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYG--SPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNC 1839
            +++I N    D  R+ C A  +  S   Y                   S+V NHFI    E S     DL   K    ++    VL  P         +++ SD G+    A+     + K++ L++  PPSI+D  S      ++R+  S+ L C +   P P I W K   ++    ++ +LT   +  ++ +  +D G+Y C A++    R  K   +    PP I G  +  I   +  P+ LTC    IP P+   I W +N+K ++  D +  ++  + GG    L I      + G Y C
Sbjct: 2926 SLQILNAQITDTGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPNHEHLSVVVNHFISLNCEVSGFPPPDLSWLKNEEPIKPNTNVLTVPGGRTLQIIRAKI-SDGGDYTCIAINQAGESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTNVEILTGGQTLHIRRAEVSDTGQYVCRAINVA-GRDDKNFHLNVYVPPTIEGPETEVIVETISNPVTLTCDATGIPPPT---ITWLKNHKPIENSDPL--EVHILSGG--SKLQIARPQRSNSGNYTC 3223          

HSP 3 Score: 59.6918 bits (143), Expect = 1.453e-7
Identity = 45/151 (29.80%), Postives = 74/151 (49.01%), Query Frame = 1
Query: 1303 KEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLT-RQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYG---SPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIV 1731
            K+  +++  PPSI    S   ++  L  ++ L C  TG P P I+WFK    +  G  +I L+ R  S  L+ +  +D G YQC  +S    +  K + +    PP I G   + +I + L   +KL C  R +P P+   I W ++ ++V
Sbjct: 1441 KDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFLGDPNIELSDRGQSLHLRNARRSDKGRYQC-TVSNAAGKQAKDIKLTVYVPPSIKGGNITTEISALLNSIVKLECETRGLPVPA---ITWYKDGQVV 1587          

HSP 4 Score: 58.151 bits (139), Expect = 5.110e-7
Identity = 54/202 (26.73%), Postives = 81/202 (40.10%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHAL-SPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPI-KLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            A +  +L +  PPS++D          +   I L C ATG P P I W+K    +        L R     +  +  +D G Y+C A+ S G       + V    PP I GS  +   ++  + +L C  R IPAPS   + W ++   V         ++ + GG I+ L    +S  D G Y C      G     I L
Sbjct: 1906 AHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKATGKPLPVITWYKDSHPLSGSASAAFLKRGQVLEIGSAQISDAGIYKCVAINSAGATELFYSLQVHV--PPSISGSSSMVEVVVNNLARLECEARGIPAPS---LTWLKDGSPV---SSFSNGIQILSGGRILALTSAQMS--DAGRYTCVAVNAAGEKQRDIDL 2097          

HSP 5 Score: 55.8398 bits (133), Expect = 2.092e-6
Identity = 56/217 (25.81%), Postives = 94/217 (43.32%), Query Frame = 1
Query: 1297 ASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK----IVSGKQDILLTRQPSFILQM--STHNDYGEYQCHALSPGF--DRAVK-RVIVGTPGPPKIYG----SPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD--YFSITLYQTENL 1902
            A K   L I  PPS+   +    ++  L +++ L C A G P P + W +    IV+G+ + +        L +  +  +D G+Y C A +P    DR     V V    PPKI G    + K+ + +   I + C     P   P QI W +N     +P  I + +  +  G ++ ++   VS  D  VY C      G D  ++S+ ++   N+
Sbjct: 3232 AQKNFILFIQVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGKPIVNGETERVRVTTDGSTLNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYV----PPKIRGNKEEAEKLMALVDTSINIECKATGTP---PPQINWLKN----GLPLPISSHIRLLSAGQVVRIVRAQVS--DIAVYTCVASNRAGVDSKHYSLQVFVPPNM 3435          

HSP 6 Score: 54.6842 bits (130), Expect = 5.958e-6
Identity = 49/199 (24.62%), Postives = 89/199 (44.72%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQPSFILQM--STHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGS--PKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD 1866
            + SK   L +  PP++++      I      S  ++C   G P P + W +    ++    + ++ Q   +LQ+  +   D G+Y C A +   + + K  ++    PP I GS  P   S ++  P++L+C    IPAP   +I W ++ +    P     +++ + GG I  L + +   ED G Y C   +  G D
Sbjct: 3420 VDSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAHLTVSTQ-GMVLQLIKAETEDTGKYTCVATNEAGEVS-KHFVLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAP---KISWMKDGR----PFLQTEQVQTLEGGAI--LRVSSAQVEDTGRYTCLASSPAGDD 3607          
BLAST of AGAP000218-PA vs. UniProt/SwissProt
Match: sp|Q8IZU9|KIRR3_HUMAN (Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606 GN=KIRREL3 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.537e-11
Identity = 49/166 (29.52%), Postives = 71/166 (42.77%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQ 1890
             SC  TGNP   I W K  SG   ++L+ + +  L+     D G+Y C A+ P      + V +   GPP I  +    +   +  ++ C IRS P P      W  N        R   +      GVI TL I  +   DF  +YNC+ +  +GSD   I L +
Sbjct:  354 FSCAWTGNPSLTIVWMKRGSG---VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKE 516          
BLAST of AGAP000218-PA vs. UniProt/SwissProt
Match: sp|Q08180|ICCR_DROME (Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.399e-10
Identity = 72/300 (24.00%), Postives = 122/300 (40.67%), Query Frame = 1
Query: 1030 VRFACYATFSENSRIFYKWSLVTNHFI--KPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHND-YGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIV--DVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            VR  C A  +  S + Y+W      FI  +P+    + E V   + ++ +   ++C V                 + +G + D   L            ISY PS    Q   ++   +   + L+C    NP+P+I W +  S +  ++ T   S  L  S  N+  G Y C A  PG+        V   G P I      +  +    ++ C   S+P    + + WT N + +  +        ++ +PGGV  TLII       +G YNC+V  +YG+D   I L   +++S+L+
Sbjct:  277 VRLECRAD-ANPSDVRYRW------FINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEV----------------QNSVGKSEDSETL-----------DISYAPSFR--QRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDR--VVGT---STNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVP--RARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLM 533          
BLAST of AGAP000218-PA vs. TrEMBL
Match: A0A0H3YJP5 (NEPH-1 OS=Schmidtea mediterranea OX=79327 GN=NEPH-1 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.070e-43
Identity = 165/614 (26.87%), Postives = 270/614 (43.97%), Query Frame = 1
Query:  154 QFEEPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGE------IQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKW----SLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNS-----DIGNTPDCAVLPVTIASKEIELSISYPPSIED--LQSNITIATHLRKSIHLSCIATGNPKPKIYWFKI------VSGKQDILLTRQPSFILQMSTH-------------------NDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPK-IFSELLKPIKLTCTIRSIPAPSPKQIIWTRNY--KIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG 1860
            Q   P + +VL  S   L+CRV  +       VQW KDGFG+ NE+L   ++ R  M      G YDLVI + +  DDGEYACQ +    I         + + +I L +IV P+++K+K    S  ++       +NS   E+     I+N +W   N    ++C  + S P   + WK     L              E +S DI G+       ++    SF  + Y S S L+  L+ + N    L+C I+N Q F+  +     + +  LFV +++++ IP     + +  ++++  C A+ +  + + Y W           I    ++S +  + +K+++++N + +RC VL   +V+      S   +     D     +C+       S +I L + Y P I D  L+   T A  L   + L C A  NP  KI W+K       +    D++  R      QMS++                   ++ G + C AL+ GF    K V VG    P+I  + K I ++    ++++C I SIP P   +IIW +N   K ++   +     E    GV+  L I  V+YED+G YNCSV   YG
Sbjct:   32 QILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHI--------LETTKSINLTVIVPPDKIKLK----SSQFDF-----QNNSTNNEI-----IQN-IWGHLNEFLILSCEIQYSRPATELVWKLGEFAL-------------REGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHN-GEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSAS-TNPANVIYNWIKYNPTTKTTTIIKYFDRSGV--LKIKVRRDLNNMFIRCQVL---SVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILE---TKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYG 599          
BLAST of AGAP000218-PA vs. TrEMBL
Match: A0A0H3YJJ7 (NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=NEPH-3 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.278e-30
Identity = 145/601 (24.13%), Postives = 247/601 (41.10%), Query Frame = 1
Query:  166 PENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLE-------KMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKL-SQPTTFRNEQSHYEEIQSKDIKGEIQ-NSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQ------DFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWT-RNYKIVDVPDRIMTKM--EWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            PE       S + LKCRV + EKY+   V W+KDGFG  N   +       K +  R  +  +  +G YDL I+   + D+G + CQ           VN     S  + ++++V  ++ ++          + +NK    ++  E       KN + V++     + C  +   P A + W  N  K+ +Q     NE           + G+I   S        +Y  V+ L+  + +  N  N L+C   N        ++  A  +VY V +       + I   P  +      +D+V F C A+    S   + W+         + ++S +   D K + ++ +V                        D G    C     +I      + + Y P+ +D  S    A  + +++ + C A GNP+P I W +I S +   ++ R    +      +D+G+Y C A    F    K + +G  GPP+I      +    +  +L+CTI+SIP P+  +I W  +N ++++     M +   E I   VI  L I++V   DFG YNCSV T+YGSD  +I L +     ML+
Sbjct:   44 PERQVAALNSTITLKCRVKVVEKYE---VHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQ---------IVVNGKAYSSQKVLVQVLVPSDKPQL----------VQINKIGPQAIRNE-------KNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETF---------LNGKITITSESSENLPKLYDVVNSLELKIVSLKN-GNWLKCLAINNGYTNQKLNYTSAQIVVYTVPI-------VVINVYPKKQNNIFIENDIVEFTCSAS-GRPSDFHWAWT---------IGDESLVNIRDPKYKLKITRV------------------------DHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNE---VIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI---VISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLM 558          
BLAST of AGAP000218-PA vs. TrEMBL
Match: A0A0L8G6N0 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22039071mg PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.630e-27
Identity = 151/597 (25.29%), Postives = 231/597 (38.69%), Query Frame = 1
Query:  148 PVQFEE-PENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEW----KFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKP---NVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDV--PDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSM 1908
            P +F + P N +V+ GS   LKC+V    + ++  +QW K+ +    +     Y  R  M  +  +  + L I +  + DDG Y CQ       +  + N ++       L ++  P+          Q+ E P                     +  V     T++ C  +   P A+I W    K  NRKL     F             D KG I                       KTE ++   LEC   N     + +  V RV++   +  +I ++   T KI+   N   V+ AC   F+   +I +KW     H                         R   +VL  P   +V   +T T    + IG+T            KE  L I Y P      S++  A   R++  L C A GNP+P I W K   G  +IL +     +++++   D G Y C A   GF    + V++   GPP+I    K ++   K   + C   +I  P P  + W +N + +D    DR  T  E +P G+  TL I+ V  EDFG YNCSV  +YG D   ITL + + L M
Sbjct:    3 PQEFVQIPVNQSVIEGSTATLKCQV----RNRVGNLQWTKNKYALGIDRNLPNYE-RYSMVGNPARDEFHLRIVSVKLEDDGLYQCQVGQTEAAEGIRSNTVK-------LTVLFPPDP--------PQILEAP---------------------IAAVILGKPTNITCLVKNGKPGAKITWYLAGKLMNRKLYSTEMFTKSNKRV------DTKGNIM-------------------LIPKTE-HSGKLLECHAINEA---LQNPYVTRVTLNVQYPPDITMKINITGKIRQGMN---VQLACEG-FANPQQIKWKWYRNGKHL-----------------------ARQTASVLNLPSISHVYHDNTITCEATNSIGST-----------RKEKRLDIKYGPRFISASSHV--AVDPRENAKLKCEADGNPQPSIIWRK--KGSHNILGSGSTLELVEVNDA-DLGTYYCTATVVGFSEISREVLLLKNGPPRIMSDGKFYTSQEKTAHIECI--AISVPKPVSMYWMKNGRTLDNTNSDRFSTNNEELPYGMKSTLEILKVHKEDFGSYNCSVANKYGEDIAIITLAEKDVLPM 484          
BLAST of AGAP000218-PA vs. TrEMBL
Match: A0A0X3PDA1 (Irregular chiasm C-roughest protein OS=Schistocephalus solidus OX=70667 GN=ICCR PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.395e-26
Identity = 136/601 (22.63%), Postives = 235/601 (39.10%), Query Frame = 1
Query:  160 EEPENLTVLNGSQVILKCRVYL-----SEKYQIETVQWIKDGFGF--TNESLEKMY------HHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQS-FQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQ-SNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIW-TRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            E P++ +V   S  IL+CR  +     +E+     + W ++GFG   T E + +          R  +  +  +G YDL I+ + + DDG+Y CQ +       ++ N    +S  + + +  +P  L+            P+N  A   +  ++++         V    +  + C  E   P AR+ W  +      P   +N Q  Y E  +      +     +S    Y   ++S L  +  T+ +    ++C   N   + M  +      ++  +   +++ +    ++ N + +D+V F+C A     S   + WSL  N     + E     +  L++ +++    LRCT                    I N    A         E  L+ + PP    LQ S +  A  + +S  L C   GNP P+I W +   G+   LL R            D+G Y C A   G+    K + +     P I     + +    P +LTCT+ S+P P  K+  W  R  ++     R     E+  GGV+  L    V   DFG YNC+    YGS   ++ L Q + LS+ L
Sbjct:   38 EHPKSQSVTLNSTFILRCRFRIEIFQSAEQEGRPRIDWSRNGFGIGGTPEDIHQAGIGANYPESRYSLPYNLQEGQYDLQITNAQLKDDGKYVCQLT-------YRGNAYHSQSAIVEVLVPSKPPFLRQLD---------PVNSSAYRPVDSDVRAT--------VFEGGILKLQCIAEEGKPGARLLWLVDG----IPINAKNRQLEYFETFTAGFTMNVTAEKLESTLPPYFVTTISTLS-AFVTKLHHGRQIQCRAEN-PGYEMYKSKPANTIIEVHYAPVVKMVSRSANELGNYAENDVVSFSCKAE-GRPSEFRWVWSLNGNELTN-VREN----WHRLRLTRDLQNSTLRCTA-------------------ISNQAGYA---------ETILNFTSPPQF--LQTSTLLYAGSVGESARLECATDGNPPPRIEWRR---GRTGDLLARGRFLNRPKIQPEDFGSYTCIATVRGYPSISKEIWLSEKTAPSIKPMEAVLAPAGAPARLTCTVLSVPLPPAKEAHWYRRGIRVTQSAHRTFESEEFT-GGVVYVLKFSQVLPTDFGFYNCTASNGYGSASQTVELRQKDELSVSL 568          
BLAST of AGAP000218-PA vs. TrEMBL
Match: A0A1E1X6I0 (Putative neural cell adhesion molecule l1 (Fragment) OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.242e-23
Identity = 95/331 (28.70%), Postives = 147/331 (44.41%), Query Frame = 1
Query:  946 SVQQLFVKNIRIET------IPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKM--EWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            +++Q  +  IR+E         TV+   +S  D VRF C AT +  S I YKW    +  I   H     E V  ++ +  N   + C      N + T+ ST  +N                        I Y P+ +      T+A      + L C    NPKP I W    S   D +L RQ + I+     +D G Y C A  PGF    + V V   GPPK+      +    + +++ C I S+P P+  ++ W+RN ++VD+ +    ++  E +  G+   LII   + EDFG YNCSV+ ++G D   IT+ + +NL ML+
Sbjct:    2 ALKQPMLATIRMEVKYPPEITLTVESDKISEFDDVRFHCQAT-ANPSDIVYKW-YRNDEIIAGDHT---TELVLPRVTRNFNGDTITCEAR---NDVGTTKSTHTLN------------------------IHYRPAFKSTAE--TVAAEEGAEVALRCEVDSNPKPDIVWRHEGS---DRVLARQATLIIPAMRPSDAGRYSCRATVPGFPEITQDVHVYVKGPPKVSSPSTQYGVEGEQVRVECVITSVPPPT--RVAWSRNLQLVDIDNNQGYEIIKEPLSNGLRNLLIIHNAAEEDFGQYNCSVWNQFGYDTRLITVRKQKNLPMLI 293          
BLAST of AGAP000218-PA vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 68.9366 bits (167), Expect = 1.676e-11
Identity = 49/172 (28.49%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENL 1902
             +C  TGNP   I W K  SG   ++L+ +    L+     D G+Y C A+ P      K V +   GPP I  +    +   +  ++ C IRS P P   +I W+    +++     R   +      GV+ TL +  +   DF  +YNC+ +  +GSD   I L + E+L
Sbjct:  306 FNCAWTGNPSLTIVWMKRGSG---VVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPPD--RIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESL 472          
BLAST of AGAP000218-PA vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 68.9366 bits (167), Expect = 1.710e-11
Identity = 49/176 (27.84%), Postives = 80/176 (45.45%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             +C  TGNP   I W K  SG   ++L+ +    L+     D G+Y C A+ P      K V +   GPP I  +    +   +  ++ C IRS P P   +I W+    +++     R   +      GV+ TL +  +   DF  +YNC+ +  +GSD   I L + E+L + +
Sbjct:  306 FNCAWTGNPSLTIVWMKRGSG---VVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPPD--RIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAV 476          
BLAST of AGAP000218-PA vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 66.2402 bits (160), Expect = 1.170e-10
Identity = 48/176 (27.27%), Postives = 79/176 (44.89%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENLSMLL 1914
             +C  TGNP   I W K   G   ++L+ + +  L+     D G+Y C A+ P      K V +   GPP I  +    +   +  ++ C IRS   P P +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L +  +L + +
Sbjct:  333 FNCAWTGNPSLTIVWMKRGHG---VVLSNENTLTLKAVKQEDAGKYVCRAVVPRVGVGEKEVTLTVNGPPTISSTQTQQALYGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAV 503          
BLAST of AGAP000218-PA vs. Ensembl Cavefish
Match: OBSCN (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF [Source:HGNC Symbol;Acc:HGNC:15719])

HSP 1 Score: 64.3142 bits (155), Expect = 7.807e-10
Identity = 54/187 (28.88%), Postives = 85/187 (45.45%), Query Frame = 1
Query: 1330 PPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFK---IVSGKQDILLTRQP----SFILQMSTHNDYGEYQCHALSP-GFDRAVKRVIVGTPGPPKIYGSPKIFSELL-------KPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSV 1845
            PP  + + ++ T    L +++ L+C  TG+PKP + WFK    V      ++   P    + IL   T  D G+Y C A SP G    + ++ V  P        P+  ++L        +  + TCTI+S  APSPK I W +  K++   ++  T  E   G  ++ L+I      D G Y C V
Sbjct: 5554 PPDFDAVLTDCT--AELGQTVKLACKVTGSPKPVVTWFKDGRTVEVDPHHIIIEDPDGSCTLILDNMTAEDSGQYMCFATSPAGNASTLGKITVQVP--------PRFVNKLRNAAFIPGEDAQFTCTIQS--APSPK-IRWFKEGKLLTDQEKYQTYSESRSG--VVVLVIKNPGERDLGHYECEV 5725          
BLAST of AGAP000218-PA vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 62.003 bits (149), Expect = 2.204e-9
Identity = 50/203 (24.63%), Postives = 90/203 (44.33%), Query Frame = 1
Query: 1315 LSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPG--GVIMTLIIVAVSYEDFGV-YNCSVFTEYGSDYFSITLYQTENLSMLL 1914
            + + + P +      +T+ T +  +   +C  TGNP   + W K  S   +++L+   +  L+  T  D G Y C A+ P    A + V +   GPP I       +      KL C + S  +P P +I+WT     +         ++ +    GV+ +LI+     +DF + YNC+ +  +G+    + L + E L ML+
Sbjct:  286 VDVQFGPRLLSEPKPLTVDTGMDAA--FTCAWTGNPPLTLAWTKQGS---NVVLSNSNTLQLKAVTQEDAGLYTCKAIVPMIGVAERDVTLTVNGPPIITAEATQKAVKHSKGKLECLVGS--SPPPDKIVWTFGEMTLSSGSSGRYSVQTVNSDRGVLSSLILSETLAQDFQLRYNCTAWNRFGTGTALVILKEQEALPMLI 481          
BLAST of AGAP000218-PA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010550.1 (pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 gene:ENSPMAG00000009556.1 transcript:ENSPMAT00000010550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 3.123e-10
Identity = 48/168 (28.57%), Postives = 72/168 (42.86%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIK--LTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQ 1890
             +C  +GNP   + W +  S   +++L+     +L+  T +D G Y C A+ P      K V++   GPP I  S  +    L+  K  + C I S P        W  N   V   +R   +      GV+ TL I  V   DF   YNC+ +  +GSD    TL +
Sbjct:   21 FTCAWSGNPPLTLAWTRKGS---NVVLSNSNMLLLKGVTQDDTGRYVCKAIVPRIGVGEKEVMLNVNGPPII--SSDLLQHALRGEKGRVECFIGSTPPAHHLAWAWKENVLEVGTYERYTVETVSRVDGVLSTLTITNVMEGDFQTAYNCTAWNGFGSDTEIFTLRE 183          
BLAST of AGAP000218-PA vs. Ensembl Sea Lamprey
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 57.3806 bits (137), Expect = 1.162e-8
Identity = 56/202 (27.72%), Postives = 85/202 (42.08%), Query Frame = 1
Query: 1276 AVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVS---GKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVG---TPGPPKIYGSPK-IFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG 1860
            A+L VT A   +    S  P I     N+T+  H  ++  L CIATGNP+P + W ++     G + I +    + ++        G Y C A  PG    V+R   G      PP+    P+ +   L     LTC+ +  P+P   +IIW  N   +   +R+  +          TL I  V  ED G+Y C+     G
Sbjct:  184 ALLTVTPA---VPAKSSKDPVILSGPQNLTLTVH--QTAILECIATGNPRPIVSWSRLDGRPIGVEGIQVVGTGNLMISDVAVQHAGVYVCAANRPGTR--VRRTAQGRLIVQAPPEFMQPPQSVTRSLGASAVLTCSAQGTPSP---RIIWLHNGLPLHQSERVRLQNG------NSTLTIQRVCSEDEGIYQCTAENSAG 369          
BLAST of AGAP000218-PA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005303.1 (pep scaffold:Pmarinus_7.0:GL476820:290278:328887:1 gene:ENSPMAG00000004817.1 transcript:ENSPMAT00000005303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 3.163e-7
Identity = 43/184 (23.37%), Postives = 83/184 (45.11%), Query Frame = 1
Query: 1330 PPSIEDLQSNITIATHLRKSIHLSC-IATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVI---VGTPGPPKIYGSPKIFSE-----LLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIM---TKMEWIPGGVIMTLIIVAVSYEDFGVYNCSV 1845
            PP +E   S   +     + + L C +  G+P P + W +   G     L  + +  +Q    +D G Y C  +S G   AV+R I   V +    + + +P  + E     + + +K++C + ++P        W RN +++   DR++   +  ++ PG    +L I+ + + DFG Y C+ 
Sbjct:  111 PPVLEHPASE-QLVLEPGERVRLRCAVIKGDPIPSVTWSRSPGGLPPTCLIGKDNLTIQSVRESDSGTYTC-LVSNGVGGAVRRAINVTVRSLRRGRFWITPDPYHEDDNIQIGREVKISCQVEAVPI-EELSFTWYRNGRMLRSSDRLLISKSDSDFAPG--TSSLDIIDLRFTDFGTYTCTA 289          
BLAST of AGAP000218-PA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004605.1 (pep scaffold:Pmarinus_7.0:GL476854:241038:246210:-1 gene:ENSPMAG00000004199.1 transcript:ENSPMAT00000004605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 3.237e-7
Identity = 49/200 (24.50%), Postives = 75/200 (37.50%), Query Frame = 1
Query: 1300 SKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYW----FKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDR----AVKRVIVGTPGPPKIYGSPKIFSELLKP---IKLTCTIRSIPAPSPKQIIWT--RNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG 1860
            S    +SI+  P I+D      +      SI L C A+G+P P I W      +      +L     S  ++ +  +D G Y C A      R    +V   ++G P PP    +P      + P   + L C  R  P   P Q  WT     ++     R   +      G+   L++   +  D GVY CS  +  G
Sbjct:  183 SATATVSINQAPQIQDKPERAVVRITSGDSIALECRASGDPAPLITWRLPDGSVPHSSGRLLTHANGSLEIRSAARSDAGRYACVARGADGSRDARLSVDLTVMGAPAPPSFL-APTTERVEVAPGASVALACPARGEP---PPQTTWTLPGGAQLA----RGSNRGARFSAGLDGALLVRGATLADTGVYRCSARSPSG 374          

HSP 2 Score: 51.9878 bits (123), Expect = 3.918e-7
Identity = 49/197 (24.87%), Postives = 79/197 (40.10%), Query Frame = 1
Query: 1348 LQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPS-------------FILQMSTHNDYGEYQCHALS-PGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKP----IKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL 1884
            ++   T++    + + L C A+G P+P + W     G Q  LL  Q S              ++  +   D G Y+C A +  G D A   VIV   GPP++   P    ++  P    ++L C     P P    ++W         P     +M  +P G   +L +  V   D G Y C+V   +G D  + T+
Sbjct:    6 VRGATTVSVAAGRPLSLPCTASGWPEPAVSWALPGDGGQ--LLPNQRSGAGSGARVFANGTLLVPAAMWRDAGTYKCTAANVAGVDSAA--VIVTVLGPPRVAAPPP--GDVAVPYGGALRLRCVAEGEPRP---VVVW--RLPSASPPPSADRRMRVLPDG---SLALDGVVASDAGRYVCTVRNRHGEDSATATV 188          
BLAST of AGAP000218-PA vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 50.0618 bits (118), Expect = 2.929e-6
Identity = 32/120 (26.67%), Postives = 55/120 (45.83%), Query Frame = 1
Query: 1387 SIHLSCIATGNPKPKIYWFK-----IVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIV---GTPGPPKIYGSPKIFSELL-KPIKLTCTIRSIPAPSPKQIIWTRN 1719
            +++L C A GNPKP I W        ++  +   L +  + +++ + H D G YQC A +   +     V++     P PP     P     L+ + + L C+    PAP   ++ WTR+
Sbjct:  199 TVYLRCRAEGNPKPAIIWLHNSNEIAMAEDERRNLLQDGTLMIRDTRHTDQGTYQCMARNVAGEVKAPEVVLRYFDVPAPPTFVIQPHDTEVLVGESVTLECSAGGHPAP---RVSWTRD 315          
BLAST of AGAP000218-PA vs. Ensembl Nematostella
Match: EDO32296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVH4])

HSP 1 Score: 55.8398 bits (133), Expect = 4.586e-8
Identity = 49/177 (27.68%), Postives = 78/177 (44.07%), Query Frame = 1
Query: 1366 IATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDIL--LTRQPSFILQMSTHNDYGEYQCHALSP-GFDRAVKRVI-VGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIM---TLIIVAVSYEDFGVYNCSVFTEYGSDYFS 1875
            + T   + + L C ATG P+P I WF+   G +++   +T   S IL+  + +D G Y C A +  G D A    I  G   P K+     I      P+ + C +  IP PS   ++W ++ ++      +M +     G VI    TL++      D G Y C+     G D+ S
Sbjct:   51 LTTMKGRKLTLICHATGRPRPTITWFR---GGEEMRTKVTNNGSLILEKVSSSDIGRYTCTARNAFGKDNANSTTIPPGDGSPVKVSVGDNITVITDTPLLIDCEVSGIPFPS---VVWVKDGRV------LMGE-----GYVIFDNGTLVLRRARPADSGRYTCTANNSRGKDHIS 210          

HSP 2 Score: 50.8322 bits (120), Expect = 1.532e-6
Identity = 49/206 (23.79%), Postives = 80/206 (38.83%), Query Frame = 1
Query: 1294 IASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKI---VSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKP----------------IKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMT-----LIIVAVSYEDFGVYNC 1839
            +A ++I L     P+I  +  N T+ T  R +I   C+ATG PKP I W K    + G    +     S ++Q    + +G + C A +P  + +V   I       ++  + K+    +KP                I L C+ R +P P                       +EW+ GG ++T     L++  V   D G Y C
Sbjct:  219 VAPRDIPLG-DGSPTIARIADNATVLTGSRLTID--CVATGVPKPSIIWRKDGRELIGAGSYMAPGNGSLLIQQVAASHHGVFTCTATNPVGEDSVSSNI-------RVRTTDKVEKSDMKPVDVRIGGQVTSLSGVDITLNCSARGLPPP----------------------DIEWMNGGKMITVQGPRLVLRNVMSSDSGNYTC 392          
BLAST of AGAP000218-PA vs. Ensembl Nematostella
Match: EDO27477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T954])

HSP 1 Score: 52.7582 bits (125), Expect = 7.251e-8
Identity = 50/191 (26.18%), Postives = 77/191 (40.31%), Query Frame = 1
Query: 1333 PSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSE--LLKPIKLTCTIRSIPAPSPKQIIWTR---NYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQ 1890
            P I  +  ++++  +   S+ L C A+G+P P I W    S +   L        L   T  + G Y+C A +     A    ++     P+I    K   E  L K I LTC +   P PS   + W+R    + I+  P R+ + +E IP               DFG Y C      G D  ++TL +
Sbjct:    1 PRITAISPDVSVTINRTDSVTLQCHASGDPAPNITW----SHEGAPLEHNGSILTLYNVTRREAGSYECKADNGIRKPAKASAVLSVNFAPEIERQKKKHFETSLGKAINLTCDVEGGPLPS---VTWSRKRSQFSIIFSPVRMRSVLEVIPK-----------QSRDFGDYICMARNIMGWDSHTLTLKR 173          
BLAST of AGAP000218-PA vs. Ensembl Nematostella
Match: EDO34079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQH0])

HSP 1 Score: 53.1434 bits (126), Expect = 7.464e-8
Identity = 45/183 (24.59%), Postives = 77/183 (42.08%), Query Frame = 1
Query: 1384 KSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFD----RAVKRVIVGTPGPPKIYGSP-KIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITL---YQTENLSM 1908
            ++I L+C   GNP P ++W K  SG      T    F    +T  D G+Y C A++        R     ++    P  +  SP +  +E    +KLTC     PAP+   + W+R+ ++V       +                +V+  + G Y C+   E GSD  ++ +   Y+ E +S+
Sbjct:    8 ETITLTCAVAGNPTPSVFWSKAGSGHS----TSGNVFTKASATKADTGQYVCTAVNTVTGNTQTRTASTYVMVKYKPSILSKSPDQTVNETTGSLKLTCNSDGYPAPT---VTWSRDGQVVSRTSVYNSN---------------SVTRSEAGTYMCTATNEMGSDTTTVQVTVNYKPEMVSL 168          
BLAST of AGAP000218-PA vs. Ensembl Nematostella
Match: EDO31942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF5])

HSP 1 Score: 55.4546 bits (132), Expect = 9.354e-8
Identity = 50/198 (25.25%), Postives = 84/198 (42.42%), Query Frame = 1
Query: 1300 SKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHAL----SPGFDRAVKRVIVGTPGPPKIYGSP-KIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIV----AVSYEDFGVYNCSVFTEYGSD 1866
            +++  +++ YPP I  +Q N T+     ++I L+C   GNP P + W K  SG+     T    F    +T  + G+Y C A+         + V   ++    P  I  SP +  +E    +KL+C     PAP    + W+R+                   GV+++   V    +V+  + G Y C+   E GSD
Sbjct:   81 TQDFTINVQYPPEITPIQ-NTTV--RAGETITLTCAVAGNPTPSVSWSKAGSGQS----TGGNVFNEAGATKAETGQYVCTAVNIVSGNTQTKTVSTYVIVKYKPSIIANSPYQTVNETTGSLKLSCISDGYPAP---MVTWSRD-------------------GVVVSPTSVYYSDSVTRSEAGTYTCTATNEMGSD 249          
BLAST of AGAP000218-PA vs. Ensembl Nematostella
Match: EDO43488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYM5])

HSP 1 Score: 55.0694 bits (131), Expect = 1.176e-7
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 1
Query: 1306 EIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDI---LLTRQPSFILQMSTHNDYGEYQCHAL-SPGFDRAVKRVI-VGTPGPPKI 1611
            E+     + P I+   S+  + +    +I+L C+ +G P P+I WF    G+  +   +L  +    +      DYGEY+C+   S GFD    +V  +G PGPP++
Sbjct:  225 EVNNETPHRPVIDSAGSSHDVISWDNNTIYLQCLVSGKPAPRITWFDPKGGEVKVGVMILPDRGVLAVMTQAPEDYGEYRCNVKNSHGFDNYYVQVTKLGLPGPPRL 331          
BLAST of AGAP000218-PA vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 68.1662 bits (165), Expect = 3.013e-11
Identity = 50/172 (29.07%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENL 1902
             +C  TGNP   I W K  SG   ++L+ +    L+     D G+Y C A+ P      K V +   GPP I  +    +   +  ++ C IRS P P   +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L + E+L
Sbjct:  394 FNCAWTGNPSLTIVWMKRGSG---VVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPPD--RIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESL 560          
BLAST of AGAP000218-PA vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 68.1662 bits (165), Expect = 3.386e-11
Identity = 50/172 (29.07%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENL 1902
             +C  TGNP   I W K  SG   ++L+ +    L+     D G+Y C A+ P      K V +   GPP I  +    +   +  ++ C IRS   P P +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L + E+L
Sbjct:  352 FNCAWTGNPSLTIVWMKRGSG---VVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESL 518          
BLAST of AGAP000218-PA vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 67.781 bits (164), Expect = 3.749e-11
Identity = 50/172 (29.07%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENL 1902
             +C  TGNP   I W K  SG   ++L+ +    L+     D G+Y C A+ P      K V +   GPP I  +    +   +  ++ C IRS   P P +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L + E+L
Sbjct:  328 FNCAWTGNPSLTIVWMKRGSG---VVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESL 494          
BLAST of AGAP000218-PA vs. Ensembl Medaka
Match: kirrel1a (kin of IRRE-like protein 1 [Source:NCBI gene;Acc:101168819])

HSP 1 Score: 65.0846 bits (157), Expect = 2.807e-10
Identity = 53/199 (26.63%), Postives = 84/199 (42.21%), Query Frame = 1
Query: 1333 PSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIM--------TKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQTENL 1902
            P   D+ S++T          L+C   GNP   + WFK  S   +++L+      LQ  +  D G+Y C A+ P        V +   GPP I   P  ++   +  ++ C I S P   P +I+W     + +     +        +K+    GGV+ TL I  V   DF   YNC+ +  +G     ITL + E +
Sbjct:  311 PKTVDVNSDVT----------LNCKWAGNPPLTLTWFKKGS---NMVLSNSNQLYLQSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSDPVQYAVRGERGEVKCYIASTPP--PDKIVWAWKENVWEKERGTLQERYTVEQSKLSAEGGGVLSTLTINNVMESDFLSTYNCTAWNSFGPGTMIITLEEKEEV 494          
BLAST of AGAP000218-PA vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 64.6994 bits (156), Expect = 3.638e-10
Identity = 48/168 (28.57%), Postives = 75/168 (44.64%), Query Frame = 1
Query: 1396 LSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVD--VPDRIMTKMEWIPGGVIMTLIIVAVSYEDF-GVYNCSVFTEYGSDYFSITLYQ 1890
             +C  TGNP   I W K  SG   ++L+ +    L+     D G+Y C A+ P      K V +   GPP I  +    +   +  ++ C IRS P P   +I W+    +++     R   +      GVI TL +  +   DF  +YNC+ +  +GSD   I L +
Sbjct:  320 FNCAWTGNPSLTIVWMKRGSG---VVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPPD--RIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKE 482          
BLAST of AGAP000218-PA vs. Planmine SMEST
Match: SMESG000053066.1 (SMESG000053066.1)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 562/563 (99.82%), Postives = 563/563 (100.00%), Query Frame = 1
Query:  508 MKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCXXXXXXXXXXXXXXXXXXXXXKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL 2196
            MKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQ+ILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVAIAIVLAIFAVIVCIVIYAIKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL
Sbjct:    1 MKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQEILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVAIAIVLAIFAVIVCIVIYAIKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL 563          
BLAST of AGAP000218-PA vs. Planmine SMEST
Match: SMESG000053066.1 (SMESG000053066.1)

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 554/555 (99.82%), Postives = 555/555 (100.00%), Query Frame = 1
Query:  532 MYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCXXXXXXXXXXXXXXXXXXXXXKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL 2196
            MYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQ+ILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVAIAIVLAIFAVIVCIVIYAIKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL
Sbjct:    1 MYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQEILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVAIAIVLAIFAVIVCIVIYAIKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL 555          
BLAST of AGAP000218-PA vs. Planmine SMEST
Match: SMESG000053066.1 (SMESG000053066.1)

HSP 1 Score: 1089.33 bits (2816), Expect = 0.000e+0
Identity = 549/550 (99.82%), Postives = 550/550 (100.00%), Query Frame = 1
Query:  547 MNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCXXXXXXXXXXXXXXXXXXXXXKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL 2196
            MNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQ+ILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVAIAIVLAIFAVIVCIVIYAIKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL
Sbjct:    1 MNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQEILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTRNYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVAIAIVLAIFAVIVCIVIYAIKLKNTRQKIKFLQIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKKENTLQALYNL 550          
BLAST of AGAP000218-PA vs. Planmine SMEST
Match: SMESG000053076.1 (SMESG000053076.1)

HSP 1 Score: 257.684 bits (657), Expect = 1.148e-80
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1
Query:  118 PGQFLSISDDPVQFEEPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKII 486
            PGQFLSISDDPVQFEEPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKS NIWLKII
Sbjct:   18 PGQFLSISDDPVQFEEPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSRNIWLKII 140          
BLAST of AGAP000218-PA vs. Planmine SMEST
Match: SMESG000074081.1 (SMESG000074081.1)

HSP 1 Score: 181.415 bits (459), Expect = 1.114e-46
Identity = 165/611 (27.00%), Postives = 269/611 (44.03%), Query Frame = 1
Query:  154 QFEEPENLTVLNGSQVILKCRVYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVISTSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKTKKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEASHPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGE------IQNSHFQSFQDYMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFVKNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKW----SLVTNHFIKPLHEKSEIEYVDLKIQKEMNQVRLRCTVL-IKPNVICTST-STSRMNSDIGNTPDCAVLPVTIASKEIELSISYPPSIED--LQSNITIATHLRKSIHLSCIATGNPKPKIYWFKI------VSGKQDILLTRQPSFILQMSTH-------------------NDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPK-IFSELLKPIKLTCTIRSIPAPSPKQIIWTRNY--KIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYG 1860
            Q   P + +VL  S   L+CRV  +       VQW KDGFG+ NE+L   ++ R  M      G YDLVI + +  DDGEYACQ +    I         + + +I L +IV P+++K+K    S  ++       +NS   E+     I+N +W   N    ++C  + S P   + WK     L              E +S DI G+       ++    SF  + Y S S L+  L+ + N    L+C I+N Q F+  +     + +  LFV +++++ IP     + +  ++++  C A+ +  + + Y W           I    ++S +  + +K+++++N + +RC VL +     C S      +  D     +C+       S +I L + Y P I D  L+   T A  L   + L C A  NP  KI W+K       +    D++  R      QMS++                   ++ G + C AL+ GF    K V VG    P+I  + K I ++    ++++C I SIP P   +IIW +N   K ++   +     E    GV+  L I  V+YED+G YNCSV   YG
Sbjct:   32 QILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHI--------LETTKSINLTVIVPPDKIKLK----SSQFDF-----QNNSTNNEI-----IQN-IWGHLNEFLILSCEIQYSRPATELVWKLGEFAL-------------REGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHN-GEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSAS-TNPANVIYNWIKYNPTTKTTTIIKYFDRSGV--LKIKVRRDLNNMFIRCQVLSVLAGQECYSNFQPESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILE---TKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYG 599          
The following BLAST results are available for this feature:
BLAST of AGAP000218-PA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL33.583e-1329.31kirre like nephrin family adhesion molecule 3 [Sou... [more]
HMCN17.520e-1329.28hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
OBSCN1.167e-1229.44obscurin, cytoskeletal calmodulin and titin-intera... [more]
OBSCN1.177e-1229.44obscurin, cytoskeletal calmodulin and titin-intera... [more]
OBSCN1.177e-1229.44obscurin, cytoskeletal calmodulin and titin-intera... [more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
him-42.222e-1026.54High Incidence of Males (Increased X chromosome lo... [more]
him-42.280e-1026.54High Incidence of Males (Increased X chromosome lo... [more]
him-42.318e-1026.54High Incidence of Males (Increased X chromosome lo... [more]
syg-15.156e-927.56Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
syg-15.416e-927.38Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rst2.851e-1821.38gene:FBgn0003285 transcript:FBtr0343758[more]
rst2.851e-1821.38gene:FBgn0003285 transcript:FBtr0070562[more]
kirre2.104e-1327.73gene:FBgn0028369 transcript:FBtr0332492[more]
kirre2.104e-1327.73gene:FBgn0028369 transcript:FBtr0309498[more]
kirre2.104e-1327.73gene:FBgn0028369 transcript:FBtr0070560[more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn11.811e-1128.29hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
hmcn11.811e-1128.29hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
kirrel3a7.620e-1127.27kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a9.163e-1127.27kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a9.163e-1127.27kirre like nephrin family adhesion molecule 3a [So... [more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4e4.696e-1229.31eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e5.680e-1229.31eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.253e-1129.52eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.505e-1129.52eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.681e-1129.31eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kirrel31.033e-1228.74kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.033e-1228.74kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.329e-1228.74kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.740e-1228.90kirre like nephrin family adhesion molecule 3 [Sou... [more]
Hmcn14.884e-1228.83hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
back to top
BLAST of AGAP000218-PA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96RW7|HMCN1_HUMAN3.611e-1229.28Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
sp|Q5VST9|OBSCN_HUMAN5.651e-1229.44Obscurin OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=... [more]
sp|D3YXG0|HMCN1_MOUSE3.421e-1128.83Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=... [more]
sp|Q8IZU9|KIRR3_HUMAN3.537e-1129.52Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606... [more]
sp|Q08180|ICCR_DROME1.399e-1024.00Irregular chiasm C-roughest protein OS=Drosophila ... [more]
back to top
BLAST of AGAP000218-PA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJP52.070e-4326.87NEPH-1 OS=Schmidtea mediterranea OX=79327 GN=NEPH-... [more]
A0A0H3YJJ72.278e-3024.13NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A0L8G6N04.630e-2725.29Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A0X3PDA12.395e-2622.63Irregular chiasm C-roughest protein OS=Schistoceph... [more]
A0A1E1X6I01.242e-2328.70Putative neural cell adhesion molecule l1 (Fragmen... [more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL31.676e-1128.49kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.710e-1127.84kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3a1.170e-1027.27kirre like nephrin family adhesion molecule 3a [So... [more]
OBSCN7.807e-1028.88obscurin, cytoskeletal calmodulin and titin-intera... [more]
kirrel3l2.204e-924.63kirre like nephrin family adhesion molecule 3, lik... [more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010550.13.123e-1028.57pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 ... [more]
igdcc31.162e-827.72immunoglobulin superfamily, DCC subclass, member 3... [more]
ENSPMAT00000005303.13.163e-723.37pep scaffold:Pmarinus_7.0:GL476820:290278:328887:1... [more]
ENSPMAT00000004605.13.237e-724.50pep scaffold:Pmarinus_7.0:GL476854:241038:246210:-... [more]
pxdn2.929e-626.67peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP000218-PA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO322964.586e-827.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274777.251e-826.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340797.464e-824.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319429.354e-825.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434881.176e-728.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AGAP000218-PA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL33.013e-1129.07kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL33.386e-1129.07kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL33.749e-1129.07kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel1a2.807e-1026.63kin of IRRE-like protein 1 [Source:NCBI gene;Acc:1... [more]
KIRREL33.638e-1028.57kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of AGAP000218-PA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053066.10.000e+099.82SMESG000053066.1[more]
SMESG000053066.10.000e+099.82SMESG000053066.1[more]
SMESG000053066.10.000e+099.82SMESG000053066.1[more]
SMESG000053076.11.148e-8099.19SMESG000053076.1[more]
SMESG000074081.11.114e-4627.00SMESG000074081.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003775 ID=SMED30003775|Name=AGAP000218-PA|organism=Schmidtea mediterranea sexual|type=transcript|length=2753bp
TCACAATCTTGTCACAATCATTTAGAAACCTCGATCGCGTTCTATCTTGA
CTCGCAACTTTAATCAATGTGTTTGCCGTTATCACTTTGTTGGCTTCCTT
TGATTTGGATAATTATTCCTGGACAGTTCTTGTCGATATCAGATGACCCA
GTCCAGTTCGAAGAACCAGAAAACTTGACTGTTTTGAACGGATCTCAAGT
CATATTAAAGTGCCGTGTTTATCTGAGCGAAAAATATCAAATAGAAACCG
TTCAATGGATCAAAGATGGATTCGGATTTACAAATGAGTCATTAGAGAAA
ATGTATCACCATAGAATAATGATGACATCCTCCAATATGAAAGGTCATTA
TGATCTGGTAATAAGCACCAGTAACGTGACGGATGACGGAGAATACGCCT
GCCAAGCTTCAATCAAATATAGAATTGATCATTTCAAGGTCAACATCATG
CGAAAGAAAAGTGGGAATATTTGGCTTAAGATTATTGTCCAACCAAATGA
GCTTAAAATGAAGACAAAAAAACAAAGCCAAATGTATGAAATACCCATGA
ATAAGCAAGCGGACAACTCGCTGACAGAGGAGCTGAAATCATATGCACAT
ATAAAAAATGTCGTTTGGGTTTCAAATAATTTGGTAACAAGTGTAGCATG
CTATACGGAAGCGTCACATCCTTTTGCAAGAATAGAGTGGAAATTCAACA
ATAGGAAACTATCTCAACCGACCACATTCAGAAATGAACAAAGCCATTAT
GAAGAAATACAGTCAAAAGATATTAAAGGAGAAATTCAAAATTCACATTT
TCAATCTTTTCAAGACTACATGTATTTGTCGGTTAGTTTTCTGAAGTTTT
CATTGAAGACAGAAACAAACACATCAAATAGTCTGGAGTGCTTTATTAGC
AACTTTCAAGATTTCCTAATGGCGTCGACTCTCGTCTACCGGGTCTCAGT
TCAACAATTATTCGTGAAAAATATTCGAATCGAAACAATTCCGACGGTGA
AAATTCAAAATCTTTCCAATGACGATTTGGTCAGATTCGCCTGTTATGCG
ACATTCAGCGAGAACTCTCGAATATTTTATAAGTGGTCCCTCGTCACGAA
TCATTTCATTAAACCGCTTCACGAAAAGTCAGAAATTGAATATGTTGATT
TGAAAATTCAAAAAGAAATGAACCAAGTGCGTCTGCGTTGCACGGTTCTC
ATAAAACCGAATGTCATATGTACGTCGACGTCGACGTCTCGAATGAACTC
CGACATCGGCAATACGCCTGATTGCGCCGTTTTGCCAGTCACGATAGCGT
CCAAGGAGATAGAATTATCAATTTCATACCCCCCATCAATTGAGGATCTG
CAATCCAATATTACAATCGCAACCCATTTGCGTAAATCTATTCATTTGTC
TTGCATCGCTACCGGAAATCCGAAACCAAAGATTTACTGGTTCAAAATAG
TCTCCGGGAAACAAGACATCTTGTTGACTCGGCAACCTTCCTTTATTCTG
CAAATGTCAACTCACAATGATTATGGAGAATACCAATGTCACGCTCTGTC
ACCAGGGTTCGACCGGGCAGTGAAACGAGTAATTGTTGGAACTCCGGGAC
CTCCCAAAATTTACGGAAGCCCAAAAATATTCTCGGAATTATTAAAGCCA
ATCAAATTGACTTGCACTATCAGATCAATTCCTGCACCGAGTCCTAAACA
AATAATATGGACACGAAATTATAAAATTGTAGATGTTCCTGATCGAATAA
TGACAAAAATGGAATGGATTCCAGGAGGAGTGATAATGACGTTAATAATT
GTTGCTGTTTCGTATGAGGATTTCGGGGTTTACAATTGTTCAGTGTTTAC
TGAATATGGCAGTGACTACTTTTCTATTACTTTATATCAAACAGAAAATC
TTTCAATGCTTCTATGCGTAGCGATCGCCATCGTGTTGGCGATATTCGCG
GTCATCGTTTGTATCGTCATTTACGCTATCAAGTTGAAAAATACTCGTCA
GAAAATTAAGTTTTTACAAATACAAACATTTTCAGGGTACAAGTCAGAAA
TCCAGTTCAAAGAGACATTTAGAAACGATCAATTCTATCTTTCTCCCTAC
GATACTCTCAAGTCGAAATCAGGCAGAAATGCGCTAGAACCCTTCATTGA
AAACGTCAATAAAAAAGAAAATACTCTCCAGGCATTATACAACCTTTGAA
ACTCAGAAAATACGAAATTTCGAGACGGATTTTTCTCTATATATCTGTGA
ATAAACTTTTCAATAGATTAACGAATTCGAGTGCTCGTGTTTGTGTGCAT
ATTGTGTGTATTGGCATTTGTGAATACGTGTGCATTGATTAATTATAGAC
AATTATGCTTAATTGTGAATGGGTGTGTGCCTAATGTGTTTTTGATTGAT
TATAGACATTTGCGTACAATTATGAATGTATTGATTATTCAGATCTGTAT
ATTGATTATTCACAAAAAAATTTTTTTGCTGTAAATGAATGAATACTTGT
AGATAATACAGAATTGATGTCAATAAATTTCCATCAAAACTTCCATTGAC
CGGGTGATTTAATTCCCCTATTGAATTTCTTTCATTTTGTTTGACAACTT
GCATGAGGAAATTTAATAATAACTCTTTTCCCGCTGATTTATGTGCATTT
GTAAAGGATTTTTCTTTTTCAACAATAAATTTGGTTCATGACCAACTAAA
CTTGTATTCGTTTTTATTTCGGGAATAGAATTTGTATTAATTCTGAAAAA
AAA
back to top

protein sequence of SMED30003775-orf-1

>SMED30003775-orf-1 ID=SMED30003775-orf-1|Name=SMED30003775-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=711bp
MCLPLSLCWLPLIWIIIPGQFLSISDDPVQFEEPENLTVLNGSQVILKCR
VYLSEKYQIETVQWIKDGFGFTNESLEKMYHHRIMMTSSNMKGHYDLVIS
TSNVTDDGEYACQASIKYRIDHFKVNIMRKKSGNIWLKIIVQPNELKMKT
KKQSQMYEIPMNKQADNSLTEELKSYAHIKNVVWVSNNLVTSVACYTEAS
HPFARIEWKFNNRKLSQPTTFRNEQSHYEEIQSKDIKGEIQNSHFQSFQD
YMYLSVSFLKFSLKTETNTSNSLECFISNFQDFLMASTLVYRVSVQQLFV
KNIRIETIPTVKIQNLSNDDLVRFACYATFSENSRIFYKWSLVTNHFIKP
LHEKSEIEYVDLKIQKEMNQVRLRCTVLIKPNVICTSTSTSRMNSDIGNT
PDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATG
NPKPKIYWFKIVSGKQDILLTRQPSFILQMSTHNDYGEYQCHALSPGFDR
AVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWTR
NYKIVDVPDRIMTKMEWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSD
YFSITLYQTENLSMLLCVAIAIVLAIFAVIVCIVIYAIKLKNTRQKIKFL
QIQTFSGYKSEIQFKETFRNDQFYLSPYDTLKSKSGRNALEPFIENVNKK
ENTLQALYNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 40..119
e-value: 0.23
score: 13.2
coord: 437..498
e-value: 0.008
score: 25.4
coord: 524..598
e-value: 0.5
score: 10.0
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 34..130
e-value: 5.8E-4
score: 29.2
coord: 431..508
e-value: 14.0
score: 10.3
coord: 518..609
e-value: 0.01
score: 25.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 27..148
e-value: 9.5E-16
score: 59.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 511..608
e-value: 7.2E-11
score: 44.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 412..507
e-value: 5.0E-10
score: 41.4
NoneNo IPR availablePFAMPF13927Ig_3coord: 422..493
e-value: 9.9E-9
score: 35.7
NoneNo IPR availablePANTHERPTHR11640:SF31NEPHROSIS 1, CONGENITAL, FINNISH TYPE (NEPHRIN)-RELATEDcoord: 33..647
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 33..647
NoneNo IPR availableCDDcd00096Igcoord: 529..605
e-value: 1.60417E-7
score: 46.8516
NoneNo IPR availableCDDcd00096Igcoord: 45..126
e-value: 2.10043E-5
score: 41.0737
NoneNo IPR availableCDDcd00096Igcoord: 442..493
e-value: 1.30583E-7
score: 47.2368
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.687
NoneNo IPR availableTMHMMTMhelixcoord: 616..638
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 33..118
e-value: 5.6E-8
score: 32.7
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 28..115
score: 10.589
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 513..605
score: 9.192
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 423..493
score: 9.301
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 419..607
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 28..118