GPI ethanolamine phosphate transferase 2

Overview
NameGPI ethanolamine phosphate transferase 2
Smed IDSMED30003771
Length (bp)3401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GPI ethanolamine phosphate transferase 2 (SMED30003771) t-SNE clustered cells

Violin plots show distribution of expression levels for GPI ethanolamine phosphate transferase 2 (SMED30003771) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GPI ethanolamine phosphate transferase 2 (SMED30003771) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GPI ethanolamine phosphate transferase 2 (SMED30003771) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003771

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30003771SMESG000000653.1 dd_Smed_v4_7970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 213.386 bits (542), Expect = 2.136e-59
Identity = 119/304 (39.14%), Postives = 186/304 (61.18%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIFEKRSL--WPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
            KVV+++ID+LR D +F  + +   P    ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +D++I   K+    ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I +KLSEMD+  M +  +L  K++      L +L  DHGMS+ G HG SS  EVN PL+  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:   67 KVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIV-FYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGD-WDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERK-PGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQEN 365          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 213.772 bits (543), Expect = 2.665e-56
Identity = 119/305 (39.02%), Postives = 186/305 (60.98%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSL--WPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
             KVV+++ID+LR D +F  + +   P    ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +D++I   K+    ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I +KLSEMD+  M +  +L  K++      L +L  DHGMS+ G HG SS  EVN PL+  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:   66 SKVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIV-FYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGD-WDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERK-PGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQEN 365          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 213.772 bits (543), Expect = 3.182e-56
Identity = 119/305 (39.02%), Postives = 186/305 (60.98%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSL--WPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
             KVV+++ID+LR D +F  + +   P    ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +D++I   K+    ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I +KLSEMD+  M +  +L  K++      L +L  DHGMS+ G HG SS  EVN PL+  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:   66 SKVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIV-FYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGD-WDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERK-PGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQEN 365          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 197.208 bits (500), Expect = 9.280e-56
Identity = 109/275 (39.64%), Postives = 169/275 (61.45%), Query Frame = 3
Query:  306 IINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
            ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +D++I   K+    ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I +KLSEMD+  M +  +L  K++      L +L  DHGMS+ G HG SS  EVN PL+  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:    7 LVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIV-FYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGD-WDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERK-PGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQEN 276          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 200.29 bits (508), Expect = 1.139e-54
Identity = 109/275 (39.64%), Postives = 169/275 (61.45%), Query Frame = 3
Query:  306 IINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
            ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +D++I   K+    ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I +KLSEMD+  M +  +L  K++      L +L  DHGMS+ G HG SS  EVN PL+  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:    7 LVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIV-FYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGD-WDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERK-PGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQEN 276          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596300:8599308:-1 gene:WBGene00009204.1 transcript:F28C6.4a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 142.124 bits (357), Expect = 2.708e-34
Identity = 90/281 (32.03%), Postives = 149/281 (53.02%), Query Frame = 3
Query:  207 QKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYK-LWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKT--NKTLFILTADHGMSDLGGHGGSSKNEVNVPLL---FFNKKFSKMFTWDLDSLSQN------DIAPSLSVLLGVPIPADNIGV 1013
            +  +  ++V +VID+ R   +   +S        I K       A  + P+++L +I + +TG +  F  V+ N  + ++K  N I  ++     V +F+GD TW++L P  F   +  T FFV DY  VD NV+R++   LSN    WD +I+HYLG+DHIGH+ G  +S I EKL EMD+  +  I    K   +   ++  I+  DHGM+  G HGG+S +E  VP++   F  ++ +K +    DSL Q       D++ ++  +  +PIP ++ G+
Sbjct:   48 ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGKKV-HFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDD-VIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596286:8599317:-1 gene:WBGene00009204.1 transcript:F28C6.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 142.124 bits (357), Expect = 2.708e-34
Identity = 90/281 (32.03%), Postives = 149/281 (53.02%), Query Frame = 3
Query:  207 QKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYK-LWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKT--NKTLFILTADHGMSDLGGHGGSSKNEVNVPLL---FFNKKFSKMFTWDLDSLSQN------DIAPSLSVLLGVPIPADNIGV 1013
            +  +  ++V +VID+ R   +   +S        I K       A  + P+++L +I + +TG +  F  V+ N  + ++K  N I  ++     V +F+GD TW++L P  F   +  T FFV DY  VD NV+R++   LSN    WD +I+HYLG+DHIGH+ G  +S I EKL EMD+  +  I    K   +   ++  I+  DHGM+  G HGG+S +E  VP++   F  ++ +K +    DSL Q       D++ ++  +  +PIP ++ G+
Sbjct:   48 ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGKKV-HFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDD-VIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596300:8600265:-1 gene:WBGene00009204.1 transcript:F28C6.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 142.124 bits (357), Expect = 2.708e-34
Identity = 90/281 (32.03%), Postives = 149/281 (53.02%), Query Frame = 3
Query:  207 QKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYK-LWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKT--NKTLFILTADHGMSDLGGHGGSSKNEVNVPLL---FFNKKFSKMFTWDLDSLSQN------DIAPSLSVLLGVPIPADNIGV 1013
            +  +  ++V +VID+ R   +   +S        I K       A  + P+++L +I + +TG +  F  V+ N  + ++K  N I  ++     V +F+GD TW++L P  F   +  T FFV DY  VD NV+R++   LSN    WD +I+HYLG+DHIGH+ G  +S I EKL EMD+  +  I    K   +   ++  I+  DHGM+  G HGG+S +E  VP++   F  ++ +K +    DSL Q       D++ ++  +  +PIP ++ G+
Sbjct:   48 ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGKKV-HFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDD-VIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596322:8599308:-1 gene:WBGene00009204.1 transcript:F28C6.4b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 140.969 bits (354), Expect = 3.959e-34
Identity = 90/281 (32.03%), Postives = 149/281 (53.02%), Query Frame = 3
Query:  207 QKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNY-KLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKT--NKTLFILTADHGMSDLGGHGGSSKNEVNVPLL---FFNKKFSKMFTWDLDSLSQN------DIAPSLSVLLGVPIPADNIGV 1013
            +  +  ++V +VID+ R   +   +S        I K       A  + P+++L +I + +TG +  F  V+ N  + ++K  N I  ++     V +F+GD TW++L P  F   +  T FFV DY  VD NV+R++   LSN    WD +I+HYLG+DHIGH+ G  +S I EKL EMD+  +  I    K   +   ++  I+  DHGM+  G HGG+S +E  VP++   F  ++ +K +    DSL Q       D++ ++  +  +PIP ++ G+
Sbjct:   48 ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGKKV-HFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDD-VIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596322:8599317:-1 gene:WBGene00009204.1 transcript:F28C6.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 140.969 bits (354), Expect = 3.959e-34
Identity = 90/281 (32.03%), Postives = 149/281 (53.02%), Query Frame = 3
Query:  207 QKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNY-KLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKT--NKTLFILTADHGMSDLGGHGGSSKNEVNVPLL---FFNKKFSKMFTWDLDSLSQN------DIAPSLSVLLGVPIPADNIGV 1013
            +  +  ++V +VID+ R   +   +S        I K       A  + P+++L +I + +TG +  F  V+ N  + ++K  N I  ++     V +F+GD TW++L P  F   +  T FFV DY  VD NV+R++   LSN    WD +I+HYLG+DHIGH+ G  +S I EKL EMD+  +  I    K   +   ++  I+  DHGM+  G HGG+S +E  VP++   F  ++ +K +    DSL Q       D++ ++  +  +PIP ++ G+
Sbjct:   48 ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGKKV-HFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDD-VIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: PIG-G (gene:FBgn0033187 transcript:FBtr0088904)

HSP 1 Score: 145.206 bits (365), Expect = 7.236e-35
Identity = 97/276 (35.14%), Postives = 154/276 (55.80%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSLWPNL--MGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVR-DPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIG-VIPLRILSL 1037
            D  VL+++D+LR D        +P+   M +         + ++  P++++ ++KSI TG +  FID+  N    +  QD+ +  LK  +N V++F GD TW+KLFP +F  + +    F+V D+++ D NV++ +   L     W ++I+HYLG+DHIGH EG  +  +  KL EMD     +++ +         L +LT DHGM+D GGHGG++  E  VPL  +    SK  +      +Q D+AP+LSVLL V IP  +IG +IP  + SL
Sbjct:   64 DSFVLLLVDALRDD--------FPDATSMPVAYSRACEKLKLHVDIPTVTMPRLKSITTGTLSNFIDIALNVGHTEQMQDSFLHRLKQ-QNRVVSFAGDHTWVKLFPSEFTRQVENHDSFYVNDFYEGDRNVTKTLETELERSD-WSLLILHYLGLDHIGHVEGNASPRVPLKLKEMDE----VVKKILDHKSFPNVLLMLTGDHGMADGGGHGGNTPAETLVPLYLYYNNCSKTPSAS-KRYNQIDLAPTLSVLLSVEIPTLSIGCLIPEMLQSL 324          

HSP 2 Score: 50.447 bits (119), Expect = 9.486e-6
Identity = 21/57 (36.84%), Postives = 40/57 (70.18%), Query Frame = 3
Query: 2307 FFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFY-WIFIWIEWLAGD 2474
            FF QGNSNSL+T+D+ PG++G T++ P I+   V ++T++ + + ++++ +  L  D
Sbjct:  786 FFYQGNSNSLSTIDLTPGYIGQTNYNPSIVAIFVTLNTYSADIHAFLYLVVHTLRSD 842          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: PIG-O (gene:FBgn0034346 transcript:FBtr0086691)

HSP 1 Score: 144.05 bits (362), Expect = 1.855e-34
Identity = 82/251 (32.67%), Postives = 139/251 (55.38%), Query Frame = 3
Query:  336 RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLID-ILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK---FSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNP-MDQTQALL 1073
            R    PP+ +L ++K + TG++  FID+  N  S +I +DN+ID I+K+  +  + F GD TW  L+P +F        F + D   VD  + +++P  L + K W +++ H+LG+DH GH  GP +  +  KL EM+    +++ A+      N T  ++  DHGM+  G HGG + +E N  L  ++K+   +      D + L Q D+ P+L+ +LGVPIP  N+G++   I+  +  P +++ Q LL
Sbjct:  126 RFRADPPTTTLQRLKGLTTGSLPTFIDIGSNFASPEINEDNIIDQIVKN--DLPVVFLGDSTWTDLYPHRFKRSYSYPSFDIFDLDSVDNEILKHLPKELES-KDWQVLVAHFLGVDHCGHKHGPMHEEMARKLGEMNEVIRSVVAAM-----DNDTTLLVMGDHGMTASGDHGGDTDDETNALLFAYSKQHRFYGNDSGSDSEMLQQIDLVPTLATILGVPIPYSNLGLVNFNIVPDLRVPHLNKFQTLL 368          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: PIG-N (gene:FBgn0033479 transcript:FBtr0088431)

HSP 1 Score: 75.8702 bits (185), Expect = 1.801e-13
Identity = 75/323 (23.22%), Postives = 123/323 (38.08%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSLW-PNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDY-FQVDYNVSRNIPNILSNYKLW-------------DMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMF---------------TWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKL 1100
            +++VLIV D  R D  FE+   + PNL  I  +  V        P       I ++I G       V+    S  I  D + +  +S + +    +G    + +F    N  +    F+  D  F   Y+       +    KL               +  +H LG+D  GH   P        L + +     + Q   +     +T ++LTADHGM+D G HG  S +E + P + +    S+                    L  L Q  + P +S LLG+  P +N G +PL  L    N   + +A+ ++ + L  L
Sbjct:   46 NRLVLIVTDGFRADSFFEENCRYVPNLRKIFLREGVVGVSRTRVPTETRPGHI-TLIAGLYEDPSAVLRGWKSNPIDFDTVFN--RSSQTYA---WGANDVLNVFSHVSNGGEINLRFYNHDLDFSPGYDAYEEDEWVFKRVKLLLQQKREALQRAQNVVFFLHLLGLDTAGHVHKPGAPKFRRTLEKTEKGVYAIYQEFERVFPDKRTAYLLTADHGMTDSGAHGSGSPHETDTPFMLWGAGASRAVPKPGGRTFMPNNEGPAMPLHELEQAQLTPLMSALLGLAPPMNNFGKLPLGYL----NVSKEYEAMAAHVNALQLL 358          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: CG13978 (gene:FBgn0039518 transcript:FBtr0085182)

HSP 1 Score: 59.3066 bits (142), Expect = 1.941e-8
Identity = 47/175 (26.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  603 NVSRNIPNI--LSNYKLWDMVIMHYLG-IDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSK---------MFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQL 1091
            N  RN+ N+    NYK    V   YL  +D   H   P +     KL           +   +    ++T +++T+DHGM++ G HG  S  EV  PL  +     +             ++  + Q  +AP +S L+G+P P +N+ ++P+  L++ D    Q  AL  N  QL
Sbjct:  180 NFLRNVDNVREWRNYK--PAVFFVYLADMDIAAHRFKPLSKKFFAKLQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGMNNEGAHGSGSPLEVETPLFMWGAGVKRDEIDAEANFPEKPNISQVDQTQLAPLMSSLIGLPPPKNNLALMPVGYLNVSDE--YQAVALHLNVLQL 350          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: CG6790 (gene:FBgn0037915 transcript:FBtr0082460)

HSP 1 Score: 54.6842 bits (130), Expect = 4.896e-7
Identity = 32/99 (32.32%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  762 LIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFN---KKFSKMFTWD----------LDSLSQNDIAPSLSVLLGVPIPADNIGVIP 1019
            LI+A F   KT    ++ T+ HG++  G HGG S  E   P L +    K  ++  T D          L  L Q  +AP +S L+G+P P +N+ ++P
Sbjct:  236 LIEATFNDSKTA---YLYTSAHGLTYFGSHGGGSDEEREAPFLLWGAGVKHVTENITSDFVLNNGVGMQLHKLDQIQLAPLMSALIGLPPPVNNLAILP 331          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Match: PIGG (si:ch73-49o8.1 [Source:ZFIN;Acc:ZDB-GENE-141215-6])

HSP 1 Score: 207.608 bits (527), Expect = 1.994e-54
Identity = 117/299 (39.13%), Postives = 183/299 (61.20%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIFEK--RSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDK--TNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDS-LSQNDIAPSLSVLLGVPIPADNIG-VIPLRILSLIDNPMDQTQALLSNYDQLSKLM 1103
            +VV+++ID+LR D +F    R   P    ++ K   +S  A  +PP++++ +IK++ TG++ GFIDV+ N +S  + +DNLI   KS    +I FYGD TW++LFP  F  +D TT FFV DY +VD NV+R++ + L     WD++I+HYLG+DHIGH  GP +S I  KL EMD+    +  +L  K+   T   L ++  DHGMS+ G HGGSS+ E+N  L+  +  F +    +  + + Q D+AP+L++ LG+PI  +++G +IP     L  +  +Q + L  N  QLS+L+
Sbjct:   68 RVVIVLIDALREDFVFSSNGRRFMPYTRHVVEKGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPVLLEDNLIWQAKSAGKRII-FYGDDTWVRLFPKHFMEQDGTTSFFVSDYTEVDNNVTRHLDSTLKRDD-WDILILHYLGLDHIGHISGPHSSLIGPKLMEMDDIIKKIHASLISKESEGTLPNLLVVCGDHGMSETGSHGGSSEQEINTALVLISPAFRRKVGLERPAVVEQVDLAPTLALGLGLPISQNSVGRLIPAVFEEL--SMREQLRMLQINGHQLSQLL 362          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Match: pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:ZFIN;Acc:ZDB-GENE-091204-80])

HSP 1 Score: 160.229 bits (404), Expect = 2.210e-39
Identity = 105/333 (31.53%), Postives = 176/333 (52.85%), Query Frame = 3
Query:  174 PKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMI-FEKRSLWP----NLMGIINK--------TWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTW-----DLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSL-----IDNPMDQTQALLSNYDQLSKLM 1103
            P   LK      +    + V+++ID+L+ D   ++  +  P    N + ++++          +Y+ RA+  PP+ ++ +IK   TG++  FIDV  N  S  I +DNL+  L      V+ F GD TW+ LFP +F+   P   F V+D   VD  + +NI   +     WD++I H+LG+DH GH  GP + A+ EKLS+MD     +I+++ K+ K N TL ++  DHGM+D G HGG S+ E +  L  ++   S +F       + + + Q D+ P+L++LLGVPIP  ++G + L +            + Q +AL  N  Q+++ +
Sbjct:   47 PVAQLKGDFCLSEPRFRRAVVLIIDALKADFTRYDPENAAPKPFENKLPVLDEMASAHSSHARLYTFRAD--PPTTTMQRIKGFTTGSLPTFIDVGNNFASNAILEDNLVHQLGQVGKRVV-FMGDDTWVSLFPKKFHRSLPFPSFNVKDLHTVDNGILQNIYPTMEGDD-WDVLIAHFLGVDHCGHRFGPDHPAMAEKLSQMDG----VIRSVIKRLK-NDTLLVVMGDHGMTDTGDHGGESQKETDAALFLYSS--SPLFPAPGSQVEPEVVPQTDLVPTLALLLGVPIPYSSVGQVLLPLFPQNGSRGAPTGLSQAEALWINVKQVNRFL 368          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Match: pign (phosphatidylinositol glycan anchor biosynthesis, class N [Source:ZFIN;Acc:ZDB-GENE-080204-114])

HSP 1 Score: 77.7962 bits (190), Expect = 6.318e-14
Identity = 45/144 (31.25%), Postives = 72/144 (50.00%), Query Frame = 3
Query:  663 MHYLGIDHIGHAEGPFNSAIEEKLSEMDNKT---MTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSK-------------MFTWDLDS-----LSQNDIAPSLSVLLGVPIPADNIGVIPLRIL 1031
            +H LGID  GHA  P +    E +  +D      +T++   +  D   KT ++ T+DHGM++ G HG    +E   PL+ +     K             +  W L+S     ++Q DIAP +S L+G+P P +++GV+PL  L
Sbjct:  210 LHLLGIDTNGHAHRPMSKECLENIGLVDAGVADIVTVMDDFYGHD--GKTAYVFTSDHGMTNWGSHGAGHPSETLTPLVVWGAGVQKAQWETSQKYEDNYLKEWGLESYRRVDVNQADIAPLMSSLIGIPFPLNSVGVLPLSYL 351          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Match: pign (phosphatidylinositol glycan anchor biosynthesis, class N [Source:ZFIN;Acc:ZDB-GENE-080204-114])

HSP 1 Score: 77.7962 bits (190), Expect = 6.318e-14
Identity = 45/144 (31.25%), Postives = 72/144 (50.00%), Query Frame = 3
Query:  663 MHYLGIDHIGHAEGPFNSAIEEKLSEMDNKT---MTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSK-------------MFTWDLDS-----LSQNDIAPSLSVLLGVPIPADNIGVIPLRIL 1031
            +H LGID  GHA  P +    E +  +D      +T++   +  D   KT ++ T+DHGM++ G HG    +E   PL+ +     K             +  W L+S     ++Q DIAP +S L+G+P P +++GV+PL  L
Sbjct:  210 LHLLGIDTNGHAHRPMSKECLENIGLVDAGVADIVTVMDDFYGHD--GKTAYVFTSDHGMTNWGSHGAGHPSETLTPLVVWGAGVQKAQWETSQKYEDNYLKEWGLESYRRVDVNQADIAPLMSSLIGIPFPLNSVGVLPLSYL 351          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 206.838 bits (525), Expect = 4.985e-54
Identity = 115/302 (38.08%), Postives = 183/302 (60.60%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIF--EKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALF--KKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKM--FTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHN 1112
            KVV+++ID+LR D ++  + +   P L  ++ K   +S  A    P++++ +IK+++TG++ GFIDV+ N +S ++  DN+I   K     ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++ +IL     WDM+I+HYLG+DHIGH  GP +  +  KL EMD     +  AL   ++D +  +L +L  DHGMS+ G HGGSS+ EV  PL+  +  F +    +   + + Q DIAP+L++ LG+PIP +++G++  + +    +  +Q + L  N  QL  L+  N
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPYLTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGKRIV-FYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKRND-WDMLILHYLGLDHIGHLTGPHSHLVGPKLLEMDTVLKKISVALMSQEEDISVPSLIVLCGDHGMSETGSHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGILVPQTVEH-KSMREQLRFLHLNGHQLCMLLRQN 365          

HSP 2 Score: 56.9954 bits (136), Expect = 2.245e-7
Identity = 71/275 (25.82%), Postives = 114/275 (41.45%), Query Frame = 3
Query: 1776 ATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYA------------DIKGLQRISDISVWVFYSIIVFQILFNLTMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTV----IEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGM----------------------VSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKI 2486
            + + ILI  R LRTLN+TG  W H PDFG WL    +   L   + +CLV++ ++   R S ++     L   L GI+ Y             +  GL +   I+   F  I V  ILF  T      +   +           + +++ LW V    I +  L YR   L     + L+F  L+   + M                        FF QGNSN+++T+D+  GFVGM ++V      +    T++G   W    + +L+ +  ++
Sbjct:  646 SPWAILIICRLLRTLNQTGIQWIHRPDFGHWLTSSEHKPELSFLVAVCLVMIFILIQGRCSFVSKV--ALAFGLLGIYCYRAAIGHVLYPWQNNSNGLSK--GITEARFVYIFVLGILFTGTKDLLKSQVIYTDP---------QTKSLGLWEVYSGFILLAALLYRPHNL-----VVLVFCLLMQTTLSMFIWNLLKHDAAQITIMHYWFGQAFFFFQGNSNTISTVDISAGFVGMENYVELPAIFLTMFITYSGPLLWAIHLLWYLSSETHRV 902          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 206.453 bits (524), Expect = 6.504e-54
Identity = 108/270 (40.00%), Postives = 170/270 (62.96%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIF--EKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALF--KKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKM--FTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVI 1016
            KVV+++ID+LR D ++  + +   P L  ++ K   +S  A    P++++ +IK+++TG++ GFIDV+ N +S ++  DN+I   K     ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++ +IL     WDM+I+HYLG+DHIGH  GP +  +  KL EMD     +  AL   ++D +  +L +L  DHGMS+ G HGGSS+ EV  PL+  +  F +    +   + + Q DIAP+L++ LG+PIP +++G++
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPYLTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGKRIV-FYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKRND-WDMLILHYLGLDHIGHLTGPHSHLVGPKLLEMDTVLKKISVALMSQEEDISVPSLIVLCGDHGMSETGSHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGIL 334          

HSP 2 Score: 56.9954 bits (136), Expect = 2.270e-7
Identity = 71/275 (25.82%), Postives = 114/275 (41.45%), Query Frame = 3
Query: 1776 ATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYA------------DIKGLQRISDISVWVFYSIIVFQILFNLTMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTV----IEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGM----------------------VSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKI 2486
            + + ILI  R LRTLN+TG  W H PDFG WL    +   L   + +CLV++ ++   R S ++     L   L GI+ Y             +  GL +   I+   F  I V  ILF  T      +   +           + +++ LW V    I +  L YR   L     + L+F  L+   + M                        FF QGNSN+++T+D+  GFVGM ++V      +    T++G   W    + +L+ +  ++
Sbjct:  655 SPWAILIICRLLRTLNQTGIQWIHRPDFGHWLTSSEHKPELSFLVAVCLVMIFILIQGRCSFVSKV--ALAFGLLGIYCYRAAIGHVLYPWQNNSNGLSK--GITEARFVYIFVLGILFTGTKDLLKSQVIYTDP---------QTKSLGLWEVYSGFILLAALLYRPHNL-----VVLVFCLLMQTTLSMFIWNLLKHDAAQITIMHYWFGQAFFFFQGNSNTISTVDISAGFVGMENYVELPAIFLTMFITYSGPLLWAIHLLWYLSSETHRV 911          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 205.297 bits (521), Expect = 1.450e-53
Identity = 114/300 (38.00%), Postives = 182/300 (60.67%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIF--EKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKM--FTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHN 1112
            KVV+++ID+LR D ++  + +   P L  ++ K   +S  A    P++++ +IK+++TG++ GFIDV+ N +S ++  DN+I   K     ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++ +IL     WDM+I+HYLG+DHIGH  GP +  +  KL EMD     L +   ++D +  +L +L  DHGMS+ G HGGSS+ EV  PL+  +  F +    +   + + Q DIAP+L++ LG+PIP +++G++  + +    +  +Q + L  N  QL  L+  N
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPYLTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGKRIV-FYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKRND-WDMLILHYLGLDHIGHLTGPHSHLVGPKLLEMDT---VLKKISVEEDISVPSLIVLCGDHGMSETGSHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGILVPQTVEH-KSMREQLRFLHLNGHQLCMLLRQN 360          

HSP 2 Score: 56.6102 bits (135), Expect = 2.876e-7
Identity = 71/275 (25.82%), Postives = 114/275 (41.45%), Query Frame = 3
Query: 1776 ATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYA------------DIKGLQRISDISVWVFYSIIVFQILFNLTMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTV----IEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGM----------------------VSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKI 2486
            + + ILI  R LRTLN+TG  W H PDFG WL    +   L   + +CLV++ ++   R S ++     L   L GI+ Y             +  GL +   I+   F  I V  ILF  T      +   +           + +++ LW V    I +  L YR   L     + L+F  L+   + M                        FF QGNSN+++T+D+  GFVGM ++V      +    T++G   W    + +L+ +  ++
Sbjct:  652 SPWAILIICRLLRTLNQTGIQWIHRPDFGHWLTSSEHKPELSFLVAVCLVMIFILIQGRCSFVSKV--ALAFGLLGIYCYRAAIGHVLYPWQNNSNGLSK--GITEARFVYIFVLGILFTGTKDLLKSQVIYTDP---------QTKSLGLWEVYSGFILLAALLYRPHNL-----VVLVFCLLMQTTLSMFIWNLLKHDAAQITIMHYWFGQAFFFFQGNSNTISTVDISAGFVGMENYVELPAIFLTMFITYSGPLLWAIHLLWYLSSETHRV 908          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 169.474 bits (428), Expect = 3.415e-42
Identity = 102/300 (34.00%), Postives = 167/300 (55.67%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIF--EKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKM--FTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHN 1112
            KVV+++ID+LR D ++  + +   P L  ++ K   +S  A    P++++ +IK+++TG++ GFIDV+ N +S ++  DN+I   K     ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++ +IL     WDM+I+HYLG+DHIGH  GP +  ++                +FK   +   +F             HGGSS+ EV  PL+  +  F +    +   + + Q DIAP+L++ LG+PIP +++G++  + +    +  +Q + L  N  QL  L+  N
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPYLTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGKRIV-FYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKRND-WDMLILHYLGLDHIGHLTGPHSHLVD----------------VFKNLISKSNIFC-----------SHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGILVPQTVEH-KSMREQLRFLHLNGHQLCMLLRQN 336          

HSP 2 Score: 52.7582 bits (125), Expect = 3.586e-6
Identity = 31/85 (36.47%), Postives = 44/85 (51.76%), Query Frame = 3
Query: 1776 ATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKG 2030
            + + ILI  R LRTLN+TG  W H PDFG WL    +   L   + +CLV++ ++   R S ++     L   L GI+ Y    G
Sbjct:  634 SPWAILIICRLLRTLNQTGIQWIHRPDFGHWLTSSEHKPELSFLVAVCLVMIFILIQGRCSFVSKV--ALAFGLLGIYCYRAAIG 716          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: pigo (phosphatidylinositol glycan anchor biosynthesis class O [Source:NCBI gene;Acc:100145458])

HSP 1 Score: 115.161 bits (287), Expect = 2.725e-25
Identity = 66/189 (34.92%), Postives = 105/189 (55.56%), Query Frame = 3
Query:  477 SYRNFV------INFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNI-PNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK--FSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVI 1016
            SY++ V      + F GD TW  LFP +F        F V+D   VD  + +++ P   S    WD++I H+LG+DH GH  GP +     KL++M+    +L++ L       +TL ++  DHGM+D G HGG S+ EV   L  ++K   FS   + + +++ Q ++ P+LS+LLG+PIP  N+G +
Sbjct:    2 SYKHIVPIAGRRVVFMGDDTWDGLFPKKFFKSYFFPSFNVKDLHTVDNGILQHLYPTRDSGD--WDVIIAHFLGVDHCGHKHGPDHPETANKLAQMNQVISSLVEHL-----DEETLLLVAGDHGMTDTGDHGGDSEKEVMAALFLYSKSPLFSHELSKEAETVPQVNLVPTLSLLLGLPIPYSNLGAV 183          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigg (phosphatidylinositol glycan anchor biosynthesis, class G [Source:MGI Symbol;Acc:MGI:3576484])

HSP 1 Score: 217.238 bits (552), Expect = 1.770e-57
Identity = 127/344 (36.92%), Postives = 197/344 (57.27%), Query Frame = 3
Query:  141 YFFGYVPKTSYPKHDLK------------NRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSL--WPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
            +F   V  ++ P+HD +            N          KVV+++ID+LR D +F  + +   P    ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +DN++   K+    +I FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I  KLSEMD+  M +  +L  KD+     +L +L  DHGMS+ G HG SS  EV+ PLL  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:   27 FFPAPVRSSARPEHDAETPAPEPVAGVRSNWTKLPPPLFSKVVIVLIDALRDDFVFGSKGVKYMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPVLLEDNVLRQAKAAGKRII-FYGDETWVKLFPKHFVEYDGTTSFFVSDYIEVDKNVTRHLDKVLKRGD-WDVLILHYLGLDHIGHISGPNSPLIGHKLSEMDSVLMKIHTSLLSKDRETLLPSLLVLCGDHGMSETGSHGASSTEEVSTPLLLISSAFERK-PGDIRHPKHVQQTDLAATLAIGLGLPIPKDSVGSLLFPVIE--GKPMREQLRFLHLNTLQLSKLLQEN 365          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigg (phosphatidylinositol glycan anchor biosynthesis, class G [Source:MGI Symbol;Acc:MGI:3576484])

HSP 1 Score: 216.853 bits (551), Expect = 2.099e-57
Identity = 127/344 (36.92%), Postives = 197/344 (57.27%), Query Frame = 3
Query:  141 YFFGYVPKTSYPKHDLK------------NRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSL--WPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
            +F   V  ++ P+HD +            N          KVV+++ID+LR D +F  + +   P    ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +DN++   K+    +I FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I  KLSEMD+  M +  +L  KD+     +L +L  DHGMS+ G HG SS  EV+ PLL  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:   27 FFPAPVRSSARPEHDAETPAPEPVAGVRSNWTKLPPPLFSKVVIVLIDALRDDFVFGSKGVKYMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPVLLEDNVLRQAKAAGKRII-FYGDETWVKLFPKHFVEYDGTTSFFVSDYIEVDKNVTRHLDKVLKRGD-WDVLILHYLGLDHIGHISGPNSPLIGHKLSEMDSVLMKIHTSLLSKDRETLLPSLLVLCGDHGMSETGSHGASSTEEVSTPLLLISSAFERK-PGDIRHPKHVQQTDLAATLAIGLGLPIPKDSVGSLLFPVIE--GKPMREQLRFLHLNTLQLSKLLQEN 365          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:MGI Symbol;Acc:MGI:1861452])

HSP 1 Score: 145.206 bits (365), Expect = 3.373e-35
Identity = 101/319 (31.66%), Postives = 160/319 (50.16%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSLWP--------------NLMGIINKTWVYST--RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK--FSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILS-------LIDNPMDQTQALLSNYDQLSKLM 1103
             +VVL++ID+LR D    +RS  P              +L  I+     +    R+ + PP+ ++ ++K++ TG++  FID   N  S  I +DN+I  L S    V+ F GD TW  LFP  F+     + F VRD   VD  +  ++   L     WD++I H+LG+DH GH  GP +  + +KLS+MD     LI+ L      N TL ++  DHGM+  G HGG S+ EV+  L  ++    F  +   + + + Q  + P+L++LLG+PIP  N G +   + S          + + Q  AL  N  Q+S+ +
Sbjct:   71 SRVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKLGSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNVIQQLNSAGRRVV-FMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHLYPTLDGGS-WDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERL-----ENDTLLVVAGDHGMTMNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLGLPIPFGNTGEVMAELFSGGSDSSHPHSSALAQVSALHINAQQVSRFL 382          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:MGI Symbol;Acc:MGI:1861452])

HSP 1 Score: 143.665 bits (361), Expect = 3.938e-34
Identity = 101/319 (31.66%), Postives = 160/319 (50.16%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSLWP--------------NLMGIINKTWVYST--RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK--FSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILS-------LIDNPMDQTQALLSNYDQLSKLM 1103
             +VVL++ID+LR D    +RS  P              +L  I+     +    R+ + PP+ ++ ++K++ TG++  FID   N  S  I +DN+I  L S    V+ F GD TW  LFP  F+     + F VRD   VD  +  ++   L     WD++I H+LG+DH GH  GP +  + +KLS+MD     LI+ L      N TL ++  DHGM+  G HGG S+ EV+  L  ++    F  +   + + + Q  + P+L++LLG+PIP  N G +   + S          + + Q  AL  N  Q+S+ +
Sbjct:   68 SRVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKLGSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNVIQQLNSAGRRVV-FMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHLYPTLDGGS-WDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERL-----ENDTLLVVAGDHGMTMNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLGLPIPFGNTGEVMAELFSGGSDSSHPHSSALAQVSALHINAQQVSRFL 379          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:MGI Symbol;Acc:MGI:1861452])

HSP 1 Score: 143.28 bits (360), Expect = 4.280e-34
Identity = 101/319 (31.66%), Postives = 160/319 (50.16%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSLWP--------------NLMGIINKTWVYST--RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK--FSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILS-------LIDNPMDQTQALLSNYDQLSKLM 1103
             +VVL++ID+LR D    +RS  P              +L  I+     +    R+ + PP+ ++ ++K++ TG++  FID   N  S  I +DN+I  L S    V+ F GD TW  LFP  F+     + F VRD   VD  +  ++   L     WD++I H+LG+DH GH  GP +  + +KLS+MD     LI+ L      N TL ++  DHGM+  G HGG S+ EV+  L  ++    F  +   + + + Q  + P+L++LLG+PIP  N G +   + S          + + Q  AL  N  Q+S+ +
Sbjct:   76 SRVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKLGSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNVIQQLNSAGRRVV-FMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHLYPTLDGGS-WDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERL-----ENDTLLVVAGDHGMTMNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLGLPIPFGNTGEVMAELFSGGSDSSHPHSSALAQVSALHINAQQVSRFL 387          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q5H8A4|PIGG_HUMAN (GPI ethanolamine phosphate transferase 2 OS=Homo sapiens OX=9606 GN=PIGG PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.528e-55
Identity = 119/305 (39.02%), Postives = 186/305 (60.98%), Query Frame = 3
Query:  222 DKVVLIVIDSLRPDMIFEKRSL--WPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTN--KTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPM-DQTQALLSNYDQLSKLMGHN 1112
             KVV+++ID+LR D +F  + +   P    ++ K   +S  A  +PP++++ +IK+++TG++ GF+DVI N +S  + +D++I   K+    ++ FYGD TW+KLFP  F   D TT FFV DY +VD NV+R++  +L     WD++I+HYLG+DHIGH  GP +  I +KLSEMD+  M +  +L  K++      L +L  DHGMS+ G HG SS  EVN PL+  +  F +    D+     + Q D+A +L++ LG+PIP D++G +   ++     PM +Q + L  N  QLSKL+  N
Sbjct:   66 SKVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIV-FYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGD-WDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERK-PGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQEN 365          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|P40367|GPI7_YEAST (GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS21 PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 7.452e-53
Identity = 122/365 (33.42%), Postives = 204/365 (55.89%), Query Frame = 3
Query:  123 LMSLTMYFFGYVPK----TSYPKHDL-KNRLFFQKQTIDKVVLIVIDSLRPDMIFEKR-SLWPNLMGIIN--KTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNT----DSGKIKQ-DNLIDILKSYRNFVINFYGDITWMKLFPDQ-FNVRDPTTPFFVRDYFQVDYNVSRNIPN-ILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFT----------------WD---LDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNS 1115
            L+++ ++ F + P+    T   K D  ++R   + +   K+V ++ID+LR D +F+ + S + N+   +N  + W Y++ AN  PP+++L ++KSI TG+   FID++ N     DS  + + D+ +     + N  I F GD TW+KLFP Q F+  DPT  FFV D+ QVD NV+RN+P  +   +  WD+ I+HYLG+DHIGH +GP +  +  K  EMD+   ++   + + +  + TL  +  DHGM++LG HGGSS  E +  LLF + K ++                   W+   L+++ Q DI P+++ L G+PIP +++G+I    L L+ N +    ++  N+  L KL  H+ 
Sbjct:   14 LLAILLFIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALRSDFLFDSQISHFNNVHQWLNTGEAWGYTSFAN--PPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHDSWLQQFIQHNN-TIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVDNNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKL---ASMKENFMHLWKLSDHHG 372          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q4WDM5|GPI7_ASPFU (GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=las21 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 3.863e-52
Identity = 113/314 (35.99%), Postives = 174/314 (55.41%), Query Frame = 3
Query:  213 QTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFN-----TDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWD------------LDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLM 1103
            +  D+V+ +VID+LR D ++ K S +     +I         A+   P++++ ++K++ TG+V  F+DVI N     T S    QD  +  +K+    ++  YGD TW+KLFP  F+  D TT FFV D+ +VD+NV+R++P  LS  + W   IMH+LG+DHIGH  GP +  +  K  EMD+    +  A+ +++    TLF+L  DHGM+D G HGGSS  E++  LLF + KF    T +              ++ Q DI P+L+ LLG+PIP +++GV     L + DN   +   LL N  Q+   M
Sbjct:   52 KVFDRVIFMVIDALRSDFVYSKTSGFSFTQSLIRSGAALPFTAHASSPTVTMPRLKAMTTGSVPSFLDVILNIAESDTSSTLAYQDTWLAQIKAQGGQLV-MYGDDTWIKLFPGVFDRCDGTTSFFVSDFTEVDHNVTRHVPRELSE-RDWSAFIMHFLGLDHIGHKAGPKSRHMMTKQREMDSIVALIYAAMEEQEHLQSTLFVLCGDHGMNDAGNHGGSSPGEISPALLFISPKFQTKTTPEDSPVEAFSDLQYYRTVEQVDITPTLAGLLGLPIPLNSLGVFIPEFLMMWDNDAHRIDILLRNAKQMLSAM 363          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q6CLN2|GPI7_KLULA (GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAS21 PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 5.587e-52
Identity = 126/358 (35.20%), Postives = 206/358 (57.54%), Query Frame = 3
Query:  123 LMSLTMYFFGYVPKTSYPKHDLK-----NRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSL-WPNLMGIIN--KTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFN-----TDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQF-NVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWD------------------LDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKL 1100
            L+++ ++  G+ P+    K+D K           K    K+VL+VID+LR D +F+K S  +  L G++N  + W Y+  +N  PP+++L ++K I TG+   F+D I N     T S   +QD+L+    ++ ++ +NF+GD TW+KLFP +F +  D T  FFV D+ +VD+NV+R++P  + + K WD++I+HYLG+DHIGH  G  +  +  K  EMD    ++I+ +++K   + TL ++  DHGM+DLG HGGSS  E +  L F +K+  K  + D                  L  + Q DI P+LS+L  +PIP +++GVI   +L L+ + +   + +  NY QL+KL
Sbjct:   14 LVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLFQKDSSDFEFLHGLLNSGEAWGYTAYSN--PPTVTLPRLKGITTGSAPNFLDAILNVAEDDTSSNLKEQDSLLKQFHTH-HYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTRHVPYQMEHQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMD----SVIKQIYEKIDGD-TLMVVLGDHGMNDLGNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVEDAHPDYKYLKEVEQIDIVPTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIK-VQDNYLQLTKL 362          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q09782|GPI7_SCHPO (GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=las21 PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.763e-48
Identity = 126/366 (34.43%), Postives = 197/366 (53.83%), Query Frame = 3
Query:   87 MTYLKYASFLVLLMSLTMYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGII-NKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFN---TDSGKI--KQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRN----IPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFK-----KDKTN-KTLFILTADHGMSDLGGHGGSSKNEVNVP--LLFFNKKFSK----MFTWD------LDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKL 1100
            M +  +  F + +    ++  G+ P  +       +  F     ID+VV +++D+LR D +F K    P    ++ N T      A  + P++++ ++K++ TG + GF+DV+ N   +D+G     QD+ +  L S+ N  I FYGD TW+KLFP  F+  + TT FFV DY +VD NV+RN    +P+ LS+   WD +I+HYLG+DHIGH  GP +  +  KL E+D    T+I  ++K      +KTN  +L +L  DHGM+++G HGGSS  E      LLF + + S     +   D      L+ + Q D+ P++ +LLG+PIP  N+G +   +  L  +      A LSN  QLS L
Sbjct:    1 MRFAFFGIFWLQIFGSILFLLGFFPHKNDSTGKAMSNQFSPPAVIDQVVFVMVDALRADFVFSKSHNMPFTQSLLYNSTHGIGFSAFARSPTVTMPRLKALTTGTIPGFLDVLLNIAESDTGSSIEAQDSWVYQLNSF-NKKIEFYGDDTWLKLFPSAFSKFEGTTSFFVSDYTEVDNNVTRNFDHALPSSLSHS--WDALILHYLGVDHIGHLYGPSSPLLNIKLLEID----TIISRIYKYLQEYDEKTNTHSLIVLCGDHGMNEVGNHGGSSSGETTAALSLLFPSNELSHINKPILNMDDNPYSILERVEQVDVVPTICLLLGIPIPKGNMGKVLSPVTELWKDTKTAKMAALSNLFQLSLL 359          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A2H8TIF5 (GPI ethanolamine phosphate transferase 2 (Fragment) OS=Melanaphis sacchari OX=742174 GN=PIGG_2 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 4.408e-64
Identity = 227/805 (28.20%), Postives = 381/805 (47.33%), Query Frame = 3
Query:  156 VPKTSYPKHD------LKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKR--SLWPNLMGII--NKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLL--FFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAH---FLVILSSLVSFGILLMESGI------FISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSEELVIK----LCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKNVLETDAISVVKSTYFATFII-LISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYL--MISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIK-GLQRISDISVWVFYSIIVFQILFNLTMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNM-------------------IGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFA 2426
            +P T +P  +         R  + K +++KVVL+VID +R D   +       P    +I  N++ ++ TR N   P++++ +IK++ TG V  FID++ N DS  ++QD++I    +    VI FYGD TW+KLFP+ F   D TT F++ DY +VD NV+R++ N L     WD++I+HYLG+DHIGH  GP ++ +  KLSEMDN     +  +  +     ++ I+  DHGM D GGHGGSS  EV VPL   F NK          + + Q D  PS+SV++G+PIP+ + G +  ++L +++        +L  Y   SK M  N +      +      +       + +L   T ++ NQ  ++I+L +     +       N+VI  IA    FL+I+S ++S  + L+          FI V+ +++++ I   +  ++  +++  C FTA     ++++ I+    L G    +   F  + N     L       L  + +LF S+   +I+EE+Q+  +L +    + ++K F   N   T           A +I+ +I  RF + LN  G  WS I   GDW     N  YL  ++ IG+C +    I   R    N  F++L V++  ++ +      + R+    V+V Y   + +++F L          I   IF       RN N     V  +  L   ++ L    H  L+   L++                     + ++ FF QGNSNS+ TLD+ PG++G T + P +    +  HT+ 
Sbjct:   44 IPSTIWPNRNDSEPWRFDTRRLYHK-SVNKVVLMVIDGIRYDFFTDSEFNVYMPFSTNLIKQNRSCLFRTRVN--APTVTMPRIKALTTGTVPNFIDLVLNLDSSAVQQDSIIYQASAANKRVI-FYGDETWLKLFPNSFVRHDGTTSFYISDYTEVDNNVTRHLENELKPTADWDIMILHYLGLDHIGHTGGPRSTLMPNKLSEMDNIIQRTVNYMDSEKSELPSVLIVCGDHGMRDNGGHGGSSTGEVMVPLFVYFKNKTCGGSIK---EEIMQTDFVPSISVIMGLPIPSSSTGKLINKMLQILN-----INEILFAYHYNSKQMYTNYISKKGLMNKAFMKDYDHAVLYYYNWLKRETASV-NQAHRVISLYESALSGMS------NYVIGSIAKFDIFLIIVSIVLSIQVWLLLIDFDAVNIKFIKVSRLVYLMLIRWAVCVWLQCDSVL-CEFTATFNLLASVVIIMFIINLGGIGRPLSTFFRLEINDFDNNLFYVLPGILIHVLSLFSSS---YIEEEHQLLYHLWTGFSAIQVYKTFVMHNYTTT-----------AKWIVSMILHRFCKNLNIIGNQWSGIYSLGDWFRESQNRIYLSTLMVIGLCSIFYACINIYRVVKNNKQFHMLSVIILILYFWTLCSVYMYRVETKEVFVPYGYNILKLIFCLHSWTIAWYLLIGCHIFIVIKQTNRNNNKFNSAVCSMIILLMLRLSLLLRPHNILVPAVLVYTCKLIQFKNWNTLTITILHYWLSLMFFFYQGNSNSVGTLDIVPGYIGQTIYDPVVAGIHIFTHTYG 814          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A182T086 (Uncharacterized protein OS=Anopheles maculatus OX=74869 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 9.087e-64
Identity = 230/849 (27.09%), Postives = 408/849 (48.06%), Query Frame = 3
Query:  108 SFLVLLMSLTMYFFGYVPKTSYPK---------HDLKNRLFFQ---KQTIDKVVLIVIDSLRPDMIFEKRSLW--PNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVR-DPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQAL--FKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMD---QTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLLNCTGNLSNQHKKLI---NLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESG-IFISVAGVLFVLSISSMLLTFVYI---------ENLDNCNFTAFKISTSALIF---ILTCHTLMGAKI-FIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKNVL-------ETDA--ISVVK---------STYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMIS--IGICLVIVVVIYWDR--ESILNSFFYILLVVLNGIHRYADIKGLQRISDISVWVFYSIIVFQILF--NLTMXXXXXXXXXXXXXXXXXXXXC------------RNQNILL-WTVIEIKRLFYRKI-WLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAG 2429
            +F+V L+S +++ +G+ P +  P            + N  F     K  I + +L+VID+LR D + ++ +      L+G   K  +Y  R  + PP++++ +IK++ +GA+  F+DVI N  S ++K D  +  +K  +   + FYGD TW  +FPD F+ R + T   +V D+++ D N+++ +   L  Y  W ++I+HYLG+DHIGH EGPF+  +  KL EMD+   T+ Q +  +K+    K L I+T DHGM D GGHGGS+  E  VPL+  + + +K      ++  Q D+AP++S+L+GV IP  +IG       S+ID  +    + + L + Y    +L     V ++  F                   L  T ++S   + L+   ++ K++T++L   +I+++ V + +   + +L + ++   LL ++    +S+   LF  SI+ MLL+F+ +               +F A  +S S + F   ++  H L G K   I   F + F        I   + F+    A   F++EE+Q W YL S++++L   KE +  N         +TDA  I V K         S  FA   +L+     R  N+TG+ W H+PD GDWL +  +  +L ++  IG+C ++  + Y      ++L+    +L+           I GL   +       + I + +I F   L M       + +       +  C            +  N+LL  T++   R    +I  + + ++  ++ + +    +G   +F QGNSNSL T+D+  G+VG+ +F    +  ++ +HTF+G
Sbjct:   12 TFVVFLLSFSLFCYGFFPLSFSPSTKASFDELPQSVGNASFNGTDYKPRISRAILMVIDALRMDFVLQEDNFQFLNQLLGD-GKACLY--RLQVHPPTVTMPRIKAMTSGAIPSFLDVILNLGSPEMKLDTFLYQMKQRQQKTV-FYGDNTWTNMFPDVFHRRGENTDSLYVNDFYKGDRNITKLLNLELQMYD-WKLMILHYLGLDHIGHVEGPFSDKVPGKLREMDSVIKTIHQTMDKWKQKYYTKPLLIITGDHGMRDSGGHGGSTHPETLVPLVIVSDQCAK----SEETFLQIDLAPTMSILMGVAIPYASIG-------SMIDPALKMLHRREMLYALYYNTQRLTSKVEVILSDKFKITEVHKSFEEAIELHQLFLKDTTDISVYKRVLLLYTSVSKKLTQLLISSYIRYDIVFILVGTVMSLLCAAIAVTQLLQDANETVLSLQPKLFP-SINCMLLSFLLLKLLSFEKESSQEPTHSFHAALVSLSVVYFTLWVILSHLLKGMKAPAISSSFLSTF--------IWFGVTFHCISLASSSFVEEEHQTWYYLTSSVMVLLTLKEVSVMNSTIGMIKHSKTDASLIEVCKEERSIFCAASVAFACIHVLV-----RRFNQTGDKWQHVPDVGDWLSKDEHKVWLSVTMFIGLCYLVYQICYMAGLLTTVLSMTASMLIYYYRAASGTVSIFGLSASNSSFCLTIFWINLVEIFFIGFLPMMYRAIVGRTTQRRTGELYSNCIIIVALLSALLHKPHNVLLVGTLLATSRFLTERIDRIADDKYCNIMLKVITHYWLGKTFYFYQGNSNSLATIDLNAGYVGLANFSIVRVGLLLTLHTFSG 830          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A182YR49 (Uncharacterized protein OS=Anopheles stephensi OX=30069 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.446e-62
Identity = 231/845 (27.34%), Postives = 402/845 (47.57%), Query Frame = 3
Query:  108 SFLVLLMSLTMYFFGYVPKTSYPK---------HDLKNRLFFQ---KQTIDKVVLIVIDSLRPDMIFEKRSLW--PNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVR-DPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQAL--FKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLLNCTGNLSNQHKKLI---NLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMES-GIFISVAGVLFVLSISSMLLTFVYI---------ENLDNCNFTAFKISTSALIF---ILTCHTLMG--AKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKN--------VLETDA--ISVVKSTYF----ATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMIS--IGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYA----DIKGLQRISDISVWVFYSIIVFQILF--NLTMXXXXXXXXXXXXXXXXXXXXC------------RNQNILL-WTVIEIKRLFYRKI-WLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAG 2429
            +F+V L S +++ +G+ P +  P            + N  F     K  I + +L+VID+LR D + ++ +      L+G   K  +Y  R  + PP++++ +IK++ +GA+  F+DVI N  S ++K D  +  +K  +   + FYGD TW  +FPD F+ R + T   +V D+++ D N+++ +   L  Y  W ++I+HYLG+DHIGH EGPF+  +  KL EMD    T+ Q +  +K+    K L I+T DHGM D GGHGGS+  E +VPL+  + + +K      D+  Q D+AP++S+L+GV IP  +IG      L ++    +   AL  N  +L+  +     D         S   +I  +  F   L  T + S   + L+   ++ K++T +L   +I+++ V + I   + ++ + ++   LL ++    +S+   LF  SI+ MLL+F+ +               +F A  +S S + F   ++  H L G  A  F      T          +   + F+    A   F++EE+Q W YL S++++L   K+    N          +TDA  I V K        A+   L     +R  N+TG+ W H+PD GDWL +  +  +L ++  +G+C ++  + Y     +L +   +   +L   +R A     I GL   +       + I + +I F   L M       + +       +  C            +  N+LL  T++   R    +I    + R+  ++ + +    +G   +F QGNSNSL T+D+  G+VG+TSF    +   + +HTF+G
Sbjct:   12 TFVVFLFSFSLFCYGFFPLSFSPSTKASFDELPQSIGNASFNGTDYKPRISRAILMVIDALRMDFVLQEDNFQFLNQLLGD-GKACLY--RLQVHPPTVTMPRIKAMTSGAIPSFLDVILNLGSPEMKLDTFLYQMKQRQQKTV-FYGDNTWTNMFPDAFHRRGENTDSLYVNDFYKGDRNITKLLNMELQMYD-WKLMILHYLGLDHIGHVEGPFSDKVPGKLREMDKVIKTIHQTMDKWKQKYYTKPLLIITGDHGMRDSGGHGGSTHPETHVPLVIVSDQCAK----SEDTFLQIDLAPTMSILMGVAIPYASIGSTIDPALKMLHR-REMLYALFYNTQRLATKVEAILRDKFKRTEVHKSFEEAIELHQVF---LKDTTDTSAYKRALLLYSSVSKELTRLLISSYIRYDIVFIVIGTVMSLVCAAIAVTQLLQDANASALSLQPKLFP-SINCMLLSFLLLKLLSFEKESSQEPTHSFHAALVSLSVVFFTLWVILSHLLKGINANAFGSSFLST---------FVWCGVAFHCVSLASSSFVEEEHQTWYYLTSSIMVLLTLKQVGVMNNTIAMISKHTKTDASLIEVCKEERVIFCAASIAFLCLHVAMRRFNQTGDKWQHVPDVGDWLSKDEHKVWLSLTLFVGLCYLVYQICYM--AGLLTTVLSMTACMLIYYYRAASGTVSIFGLSASNSSFCLTIFWINLAEIFFIGFLPMVYRALVSRATQRRTGELYSNCIIIVALLAALLHKPHNVLLVGTLMATSRFLTERIERTADDRYGSVMLKVISHYWLGKTFYFYQGNSNSLATIDLNAGYVGLTSFSIVRVGLFLTLHTFSG 831          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A182WM24 (Uncharacterized protein OS=Anopheles minimus OX=112268 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.245e-61
Identity = 223/850 (26.24%), Postives = 405/850 (47.65%), Query Frame = 3
Query:  108 SFLVLLMSLTMYFFGYVPKTSYPK---------HDLKNRLFFQ---KQTIDKVVLIVIDSLRPDMIFEKRSLW--PNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVR-DPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQAL--FKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLID---NPMDQTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLLNCTGNLSNQHKKLI---NLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKIS-TSALIFILTC-----------HTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKN------------------VLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMIS--IGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYA----DIKGLQ-RISDISVWVFYSIIVFQILF--NLTMXXXXXXXXXXXXXXXXXXXXC------------RNQNILL-WTVIEIKRLFYRKI-WLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAG 2429
            +F+V L S +++ +G+ P +  P            + N  F     K  I + +L+VID+LR D + ++ +      L+G   K  +Y  R  + PP++++ +IK++ +GA+  F+DVI N  S ++K D  +  +K  +   + FYGD TW  +FP+ F+ R + T   +V D+++ D N+++ +   L  Y  W ++I+HYLG+DHIGH EGP++  +  KL EMD    T+ Q +  +K+    K L I+T DHGM D GGHGGS++ E  VPL+  + + +K      ++  Q D+AP++++ +GV IP  +IG       S+ID   N + +   L + Y    +L     V +   F                   ++ T ++S   + L+   ++ K +T++L   +I+++ V + I   + +L + ++   LL ++   +         SI+ MLL+F+ ++ L     ++ + + +S ++ IL C           H L G K     +F    + L     I   + F+    A   F++EE+Q W Y  S++++L   K+ +  N                    E  +I  V S  F    +L+     R  N+TG+ W HIPD GDWL +  +  +L ++  IG+C ++  + Y     +L +   +   +L   +R A     I GL    S I + +F+ I + +I F   L M       + ++      +  C            +  N+LL  T++   R    +I  + + ++  ++ + +    +G   +F QGNSNSL T+D+  G+VG+ +F    +   + +HTF+G
Sbjct:   12 TFVVFLFSFSLFCYGFFPLSFSPSTKASFDELPQSIGNASFNGTDYKPRISRAILMVIDALRMDFVVQEENFQFLNQLLGD-GKACLY--RVQVHPPTVTMPRIKAMTSGAIPSFLDVILNLGSPEMKLDTFLYQMKQRQQKTV-FYGDNTWTNMFPEIFHRRGENTDSLYVNDFYKGDRNITKLLNMELQMYD-WKLMILHYLGLDHIGHVEGPYSDKVPGKLQEMDKIIKTIHQTMDKWKQKYYTKPLLIITGDHGMRDSGGHGGSTQPETIVPLVIVSDQCAK----SEETFLQIDLAPTMAIWMGVAIPYASIG-------SMIDPALNMLQRKDMLYALYYNTERLASKVEVILRDEFRKTEVHKSFEEAKELHRVFMHDTTDISAYKRALLLYTSVSKNLTQLLISSYIRYDIVFILIGMTMAVLCAAIAVTQLLQDTDATVLPLQPKLFPSINCMLLSFLLLKLLSFEKESSQESTHSSHVVIILLCVVYFSLWVILSHMLKGVKAPTVSLFHEGASFLMP--FIWFGVGFHCVSLASSSFVEEEHQTWYYFTSSIMVLLTLKQVSVMNSTIGAIKHTKTDPSLVEVCKEERSIFCVASVAFVCLHVLV-----RRFNQTGDKWQHIPDVGDWLSKDEHKLWLSVTMIIGLCYLVYQICY--MAGLLTTVLSLTASMLIYYYRAASGTVSIFGLSASKSSICLTIFW-INLAEIFFIGFLPMMYHAVVGRTTARRSGELYSNCIIIVALLSALLHKPHNVLLVGTLLATSRFLTERIDRIADDKYSGIVLKVITHYWLGKTFYFYQGNSNSLATIDLNAGYVGLNNFDIVRVGLFLTLHTFSG 835          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A182RE55 (Uncharacterized protein OS=Anopheles funestus OX=62324 PE=4 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 4.904e-61
Identity = 223/858 (25.99%), Postives = 398/858 (46.39%), Query Frame = 3
Query:  108 SFLVLLMSLTMYFFGYVPKTSYPK---------HDLKNRLFFQ---KQTIDKVVLIVIDSLRPDMIFEKRSLW--PNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVR-DPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQAL--FKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSN------------YDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLLNCTGNLSNQHKKLI---NLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILL----------MESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIF---ILTCHTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKN------------------VLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYL--MISIGICLVIVVVIYWDR--ESILNSFFYILLVVLNGIHRYADIKGLQRI-SDISVWVFYSIIVFQILF--NLTMXXXXXXXXXXXXXXXXXXXXC------------RNQNILL-WTVIEIKRLFYRKI-WLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAG 2429
            +F+V L S +++ +G+ P +  P            + N  F     K  I + +L+VID+LR D + ++ +     +L+G  N       R  + PP++++ +IK++ +GA+  F+DVI N  S ++K D  +  +K  +   + FYGD TW  +FPD F  R + T   +V D+++ D N+++ +   L  Y  W ++I+HYLG+DHIGH EGP++  +  KL EMD    T+ Q +  +K+    K L I+T DHGM D GGHGGS++ E  VPL+  + + +K      D+  Q D+AP++S+L+GV IP  +IG +    L+++    D   AL  N             D+  K   H S D A           ++H+       ++ T ++S   +  +   ++ K +T++L   +I+++ V + +   + +L + ++   LL          ++  +F S+  VL    +  +L            +F    +  S + F   ++  H L G K     +F      LS    I   + F+    A   F++EE+Q W YL S++++L   K+ +  N                    E  +I  V S  F    +L+     R  N+TG+ W HIPD GDWL +  +  +L  ++ +G+C ++  + Y      ++L+    +L+           I GL    S I + +F+ I + +I F   L M       + +       +  C            +  N+LL  T+    R    +I  + + ++  ++ + +    +G   +F QGNSNSL T+D+  G+VG+ +F    +   + +HTF+G
Sbjct:   12 TFMVFLFSFSLFCYGFFPLSFSPSTKASFDELPQSIGNGSFNGTDYKPRISRAILMVIDALRMDFVLQEENFQFLNHLLGDGNACLY---RLQVHPPTVTMPRIKAMTSGAIPSFLDVILNLGSPEMKLDTFLYQMKQRQQKTV-FYGDNTWTNMFPDIFYRRGENTDSLYVNDFYKGDRNITKLLNMELQMYD-WKLMILHYLGLDHIGHVEGPYSDKVPGKLQEMDKVIKTIHQTMDKWKQKYYTKPLLIITGDHGMRDSGGHGGSTQPETIVPLVIVSDQCAK----SEDTFLQIDLAPTMSILMGVAIPYASIGSMIDPALTMLHR-RDMLYALYYNTQRLASKVEVILRDKFKKTEVHKSFDEA----------KALHQQ-----FMHDTTDISAYKRATLLYTSVSKNLTQLLISSYIRYDIVFILVGTIMALLCAAIAVTQLLQQDTNTTVLSLQPKLFPSINCVLLSFLLLKLLSFEKETSQEATHSFHVVIVLLSVVYFTLWVILSHLLKGVKAPSMTLFHDGTFFLSP--FIWFGVAFHCVSLASSSFVEEEHQTWYYLTSSIMVLLTLKQVSVMNSTIGVIKHTKTDPSLVEVCKEERSIFCVASIAFVCMHVLV-----RRFNQTGDKWQHIPDVGDWLSKDEHKVWLSVIMFLGLCYLVYQICYMAGLLTTVLSMTASMLIYYYRAASGTVSIFGLSASNSSICLTIFW-INLVEIFFIGFLPMMYRAIVARTTPNRTGELYSNCIIIVALLSALLHKPHNVLLVGTLFATSRFLTERINRIADDKYSSIMLKVITHYWLGKTFYFYQGNSNSLATIDLNAGYVGLNNFDMVRVGLFLTLHTFSG 836          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:103031697])

HSP 1 Score: 202.601 bits (514), Expect = 7.415e-53
Identity = 113/299 (37.79%), Postives = 178/299 (59.53%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIF--EKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNK--TLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNP--MDQTQALLSNYDQLSKLM 1103
            +VV+++ID+LR D +F    +   P    I+ +   +S  A  +PP++++ +IK++ TG++ GFIDV+ N +S  + +DNLI   K+    +I FYGD TW++LFP  F   D TT FFV DY +VD NV+R++ + L     WDM+I+HYLG+DHIGH  GP +S I  KL EMD+    +  +L  ++       L +L  DHGMS+ G HGGSS+ EV+ PL+ F+  F +        + Q D+ P+L++ L +PI  +++G +   I ++ +     +Q + L  N  QLS L+
Sbjct:   68 RVVIVLIDALREDFVFGPNGKRFMPYTRHIVERGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALLEDNLIWQAKNAGKRII-FYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKRDD-WDMLILHYLGLDHIGHISGPHSSLIGPKLLEMDDVIKKIHASLITRESEGSLPNLLVLCGDHGMSETGSHGGSSEPEVSTPLVLFSPAFQRKDCSHPVVVEQVDLPPTLALALALPISQNSVGRL---IPAMFEEASLREQLRFLHINGHQLSSLL 361          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:103031697])

HSP 1 Score: 200.29 bits (508), Expect = 3.141e-52
Identity = 113/300 (37.67%), Postives = 179/300 (59.67%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIF--EKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNK--TLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLD-SLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNP--MDQTQALLSNYDQLSKLM 1103
            +VV+++ID+LR D +F    +   P    I+ +   +S  A  +PP++++ +IK++ TG++ GFIDV+ N +S  + +DNLI   K+    +I FYGD TW++LFP  F   D TT FFV DY +VD NV+R++ + L     WDM+I+HYLG+DHIGH  GP +S I  KL EMD+    +  +L  ++       L +L  DHGMS+ G HGGSS+ EV+ PL+ F+  F +    +    + Q D+ P+L++ L +PI  +++G +   I ++ +     +Q + L  N  QLS L+
Sbjct:   68 RVVIVLIDALREDFVFGPNGKRFMPYTRHIVERGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALLEDNLIWQAKNAGKRII-FYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKRDD-WDMLILHYLGLDHIGHISGPHSSLIGPKLLEMDDVIKKIHASLITRESEGSLPNLLVLCGDHGMSETGSHGGSSEPEVSTPLVLFSPAFQRKAGLEQPVVVEQVDLPPTLALALALPISQNSVGRL---IPAMFEEASLREQLRFLHINGHQLSSLL 362          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:103031697])

HSP 1 Score: 199.904 bits (507), Expect = 3.573e-52
Identity = 113/300 (37.67%), Postives = 179/300 (59.67%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIF--EKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNK--TLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLD-SLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNP--MDQTQALLSNYDQLSKLM 1103
            +VV+++ID+LR D +F    +   P    I+ +   +S  A  +PP++++ +IK++ TG++ GFIDV+ N +S  + +DNLI   K+    +I FYGD TW++LFP  F   D TT FFV DY +VD NV+R++ + L     WDM+I+HYLG+DHIGH  GP +S I  KL EMD+    +  +L  ++       L +L  DHGMS+ G HGGSS+ EV+ PL+ F+  F +    +    + Q D+ P+L++ L +PI  +++G +   I ++ +     +Q + L  N  QLS L+
Sbjct:   68 RVVIVLIDALREDFVFGPNGKRFMPYTRHIVERGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALLEDNLIWQAKNAGKRII-FYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKRDD-WDMLILHYLGLDHIGHISGPHSSLIGPKLLEMDDVIKKIHASLITRESEGSLPNLLVLCGDHGMSETGSHGGSSEPEVSTPLVLFSPAFQRKAGLEQPVVVEQVDLPPTLALALALPISQNSVGRL---IPAMFEEASLREQLRFLHINGHQLSSLL 362          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:ZFIN;Acc:ZDB-GENE-091204-80])

HSP 1 Score: 152.525 bits (384), Expect = 4.743e-37
Identity = 104/335 (31.04%), Postives = 176/335 (52.54%), Query Frame = 3
Query:  174 PKHDLKNRLFFQKQT-IDKVVLIVIDSLRPDMI-FEKRSLWP----NLMGIIN--------KTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNI-PNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTW-----DLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRIL-----SLIDNPMDQTQALLSNYDQLSKLM 1103
            P  D+    F  K+    + V+++ID+L+ D   ++  +  P    N + +++        ++ +Y+ RA+  PP+ ++ +IK   TG++  FIDV  N  S  + +DNL+  L      V+ F GD TW+ LFP +F+   P   F V+D   VD  + +NI P +  +   WD++I H+LG+DH GH  GP + A+ EKL++MD    ++I  L      N TL ++  DHGM+D G HGG S  E +  L  ++   S +F       + + + Q D+ P+L++LLGVPIP  ++G + L +            + Q +AL  N  Q+++ +
Sbjct:   47 PGADVARGDFCLKEPRFRRAVVLIIDALKSDFARYDPENTSPRAFENKLPVLDEMASSRPSQSRLYTFRAD--PPTTTMQRIKGFTTGSLPTFIDVGNNFASSAVLEDNLVHQLGQAGKRVV-FMGDDTWVSLFPRKFHRSLPFPSFNVKDLHTVDNGILQNIFPTMEGDD--WDVLIAHFLGVDHCGHRFGPDHPAMAEKLTQMDGVIRSVINRL-----QNDTLLVVMGDHGMTDTGDHGGESLKETDAALFLYSG--SPLFPAPSSQVEPEVVPQTDLVPTLALLLGVPIPYSSVGQVLLPLFPHNNSRAAPTGLSQAEALWINVKQVNRFL 369          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: pign (phosphatidylinositol glycan anchor biosynthesis class N [Source:NCBI gene;Acc:103038036])

HSP 1 Score: 77.411 bits (189), Expect = 6.803e-14
Identity = 82/313 (26.20%), Postives = 138/313 (44.09%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIFEK----RSLWPNLMGIINK--TW-VYSTRANIQPPSMSLAKIKSI---ITGAVVGF------IDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFP---DQFNVRDPTT-PFFVRDYFQVDYNVSRNIPNILSN-YKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDN---KTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSK---------------MFTWDLDS-----LSQNDIAPSLSVLLGVPIPADNIGVIPLRIL 1031
            ++VL V D LR D +F+      +  P +  II    TW V  TR   +     +A I      ++    G+       D +FN +S         DIL     F     GD      +P   + F   D +    +V D  +V  N ++    +LS  ++  ++  +H LGID  GHA  P ++   + +  +D    + +++ +  F  D   KT ++ TADHGM++ G HG S  +E   PL+ +                     +  W L++     ++Q DIA  +S L+GVP+P +++GV+PL+ L
Sbjct:   47 RLVLFVADGLRADSLFKPDINGTTRAPYIRNIIQNRGTWGVSHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSVFN-ESRHTWCWGSPDILPM---FAKGATGDHVHTYTYPATMEDFASTDASKLDTWVFDEVKVFLNSAKQNETLLSKLHEEQNVFFLHLLGIDTNGHAHRPMSTEYLDNIGLVDAGVAEMVSVFEEFFGND--GKTAYVFTADHGMTNWGSHGASHPSETLTPLVAWGAGVQTAQKATSTSQNYDDDFLKEWGLETYRRVDVNQADIAALMSSLIGVPVPLNSVGVLPLQYL 353          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 179.874 bits (455), Expect = 1.925e-47
Identity = 120/368 (32.61%), Postives = 202/368 (54.89%), Query Frame = 3
Query:   96 LKYASFLVL-----LMSLTMYFFGYVP-KTSYPKHDLKNRLFFQ-----------KQTIDKVVLIVIDSLRPDMIFEKRSL----WPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDN-LIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNK--TLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLS------QNDIAPSLSVLLGVPIPADNIG-VIPLRILSLIDNPM-DQTQALLSNYDQLSKLM 1103
            ++ AS  VL     L+ L ++  G+ P + S P H    RL  +           +    +VVL+++D+LR D +F         + +          Y+ RA+  PP++++ +IK++ +G++ GF+D++ N ++     D  L   L + R   + FYGD TW++LFP  F+  + TT FFV D+ +VD NV+R++P  L++ + W ++++HYLG+DHIGH  GP ++ +  KL EMD     +  AL ++D++     L +L  DHGMS+ G HGGSS+ E+  PLL F+  F        D  +      Q D+A +LS+ +G P+P +++G VI     +L   P+ +Q +AL +N  QL+ L+
Sbjct:    1 MRLASLSVLCAVAQLVGLALFLAGFFPVRRSLPGHADPARLPPEPGASSVAGEALEPAFGRVVLVLVDALRADFVFGAHGATNMPYTHAQAHGGHALRYTARAH--PPTVTMPRIKALTSGSIPGFLDLLMNLEAVAAGDDTFLWQALAAGRR--LRFYGDDTWLRLFPGTFHQAEGTTSFFVTDHTEVDTNVTRHVPAALAS-RDWQLLVLHYLGLDHIGHTHGPASALVPHKLREMDAVVRAVHTALLREDESPSLPALLVLCGDHGMSNAGSHGGSSEEELLSPLLLFSSAFPLAGERRTDPETVPAEVLQVDLAATLSLGMGRPVPLNSMGHVI---TAALEHRPIREQLRALQANAHQLAALL 360          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:ZFIN;Acc:ZDB-GENE-091204-80])

HSP 1 Score: 160.229 bits (404), Expect = 4.215e-40
Identity = 94/281 (33.45%), Postives = 152/281 (54.09%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMI-----------FEKRSLWPNLMGIINKTWVYST--RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFN--KKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIG-VIP 1019
            + VL+VID+LR D             +E R   P L   +  T  ++   R    PP+ ++ ++K++ TG +  FIDV  N  S ++++DNL+  L S   + + F GD TWM LFP  F+   P     VRD   VD  + +++ + ++    WD++I H+LG+DH+GH  GP + A+ +KLS+M+     L++ L         + ++  DHGM++ G HGG S+ E +  L  ++    F      +  ++ Q D+ PSL++LLGVPIP  N+G VIP
Sbjct:   80 RAVLVVIDALRLDFATYDAARSEPKPYENR--LPALHAALQATPRHARLFRFRADPPTTTMQRLKALATGGLPTFIDVSSNFASARVEEDNLVGQLVSVGQWKLVFLGDDTWMGLFPTHFHRAFPFPSLNVRDLHSVDDGILQHLHSEVAKSD-WDVIIAHFLGVDHVGHRLGPLHPAMSDKLSQMNEVLSNLLREL-----PEDAVLLVMGDHGMTETGDHGGESERETSAALFVYSPIPVFKGAQPREPRTVFQTDLVPSLALLLGVPIPYSNLGQVIP 352          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: pign (phosphatidylinositol glycan anchor biosynthesis, class N [Source:ZFIN;Acc:ZDB-GENE-080204-114])

HSP 1 Score: 77.411 bits (189), Expect = 1.209e-14
Identity = 90/392 (22.96%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  102 YASFLVLLMSLTMYFFGYVPKTSYPK---HDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFE----KRSLWPNLMGIINK--TWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIK---QDNLIDILKSYRNFVINFYGDITWMKLFPD---------------QFNVRDPTTPFFVRDYFQVDYNVSRNIPNIL----SNYKL-----WDMVI--MHYLGIDHIGHAEGPFNSAIEEKLSEMDN---KTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFT-------------WDLDSL-----SQNDIAPSLSVLLGVPIPADNIGVIPLRILS-----LIDNPMDQTQALLSNYD 1085
            Y  F+++ + + + FF  + +  +     H              ++VL+V D LR D I+      +S  P L  ++ +  +W  S   + + P+ S     ++I G         F  D G +    Q+N ++    +           TW    PD                F+       F  +D  ++D  V  ++ + L    SN KL      D ++  +H LG+D  GHA  P +    + ++ +D+   + +++I+  F  DK  KT ++ T+DHGM+D G HG    +E   PL+ +    ++                W L  L     +Q D+AP ++ LLG+P P +++GV+PL  L+       +N     QA+L  + 
Sbjct:    1 YRRFILVALVIHLVFFASIFEIYFSSPLVHGASPHAAPGPAPARRLVLLVADGLRADSIYRPVSVGQSRAPYLRRVMEELGSWGIS---HTRVPTESRPGHVALIAG---------FYEDVGAVAKGWQENPVEFDSVFNE------SRFTWSWGSPDILPMFAKGASGDHVHTFSYDAKKEDFASKDASKLDTWVFDHVKSFLKDASSNEKLAAQLSQDKIVFFLHLLGLDTNGHAHRPASREYLDNIASVDHGIGEIVSIIEDYFGNDK--KTAYVFTSDHGMTDWGSHGAGHLSETLTPLIAWGAGVNRPHPPGGQIHTDTYSQDWGLGHLNRMDVNQADVAPLMTSLLGIPFPLNSVGVLPLGYLNNSELFKAENIFANAQAILEQFQ 372          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: pign (phosphatidylinositol glycan anchor biosynthesis, class N [Source:ZFIN;Acc:ZDB-GENE-080204-114])

HSP 1 Score: 77.411 bits (189), Expect = 1.325e-14
Identity = 85/348 (24.43%), Postives = 148/348 (42.53%), Query Frame = 3
Query:  225 KVVLIVIDSLRPDMIFE----KRSLWPNLMGIINK--TWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIK---QDNLIDILKSYRNFVINFYGDITWMKLFPD---------------QFNVRDPTTPFFVRDYFQVDYNVSRNIPNIL----SNYKL-----WDMVI--MHYLGIDHIGHAEGPFNSAIEEKLSEMDN---KTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFT-------------WDLDSL-----SQNDIAPSLSVLLGVPIPADNIGVIPLRILS-----LIDNPMDQTQALLSNYD 1085
            ++VL+V D LR D I+      +S  P L  ++ +  +W  S   + + P+ S     ++I G         F  D G +    Q+N ++    +           TW    PD                F+       F  +D  ++D  V  ++ + L    SN KL      D ++  +H LG+D  GHA  P +    + ++ +D+   + +++I+  F  DK  KT ++ T+DHGM+D G HG    +E   PL+ +    ++                W L  L     +Q D+AP ++ LLG+P P +++GV+PL  L+       +N     QA+L  + 
Sbjct:   45 RLVLLVADGLRADSIYRPVSVGQSRAPYLRRVMEELGSWGIS---HTRVPTESRPGHVALIAG---------FYEDVGAVAKGWQENPVEFDSVFNE------SRFTWSWGSPDILPMFAKGASGDHVHTFSYDAKKEDFASKDASKLDTWVFDHVKSFLKDASSNEKLAAQLSQDKIVFFLHLLGLDTNGHAHRPASREYLDNIASVDHGIGEIVSIIEDYFGNDK--KTAYVFTSDHGMTDWGSHGAGHLSETLTPLIAWGAGVNRPHPPGGQIHTDTYSQDWGLGHLNRMDVNQADVAPLMTSLLGIPFPLNSVGVLPLGYLNNSELFKAENIFANAQAILEQFQ 372          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Match: LAS21 (Integral plasma membrane protein; involved in the synthesis of the glycosylphosphatidylinositol (GPI) core structure; mutations affect cell wall integrity [Source:SGD;Acc:S000003598])

HSP 1 Score: 203.756 bits (517), Expect = 1.073e-54
Identity = 122/365 (33.42%), Postives = 204/365 (55.89%), Query Frame = 3
Query:  123 LMSLTMYFFGYVPK----TSYPKHDL-KNRLFFQKQTIDKVVLIVIDSLRPDMIFEKR-SLWPNLMGIIN--KTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNT----DSGKIKQ-DNLIDILKSYRNFVINFYGDITWMKLFPDQ-FNVRDPTTPFFVRDYFQVDYNVSRNIPN-ILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFT----------------WD---LDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNS 1115
            L+++ ++ F + P+    T   K D  ++R   + +   K+V ++ID+LR D +F+ + S + N+   +N  + W Y++ AN  PP+++L ++KSI TG+   FID++ N     DS  + + D+ +     + N  I F GD TW+KLFP Q F+  DPT  FFV D+ QVD NV+RN+P  +   +  WD+ I+HYLG+DHIGH +GP +  +  K  EMD+   ++   + + +  + TL  +  DHGM++LG HGGSS  E +  LLF + K ++                   W+   L+++ Q DI P+++ L G+PIP +++G+I    L L+ N +    ++  N+  L KL  H+ 
Sbjct:   14 LLAILLFIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALRSDFLFDSQISHFNNVHQWLNTGEAWGYTSFAN--PPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHDSWLQQFIQHNN-TIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVDNNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKL---ASMKENFMHLWKLSDHHG 372          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Match: GPI13 (ER membrane localized phosphoryltransferase; adds phosphoethanolamine onto the third mannose residue of the glycosylphosphatidylinositol (GPI) anchor precursor; similar to human PIG-O protein [Source:SGD;Acc:S000003954])

HSP 1 Score: 119.398 bits (298), Expect = 1.093e-27
Identity = 78/233 (33.48%), Postives = 120/233 (51.50%), Query Frame = 3
Query:  351 PPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLF-PDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK-----FSKMFTWDLD-------SLSQNDIAPSLSVLLGVPIPADNIG 1010
            PP+ +L ++K + TG++  FID   N D   I++DN +  L    N  + F GD TWM LF P   N   P     V D   VD  V     + L   K WD++I H LGIDH+GH  GP +  + EK  ++D     +++++      + TL ++  DHGM   G HGG S +E+   L  ++KK       +   +++D       S+ Q D+  SL++L+G PIP +N+G
Sbjct:  138 PPTTTLQRLKGLTTGSLPTFIDAGSNFDGTVIEEDNFLKQLH-LANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDWILKSI-----DDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPDMWRLKETSNYNIDNLGHDYRSVRQIDLVSSLALLMGQPIPFNNLG 364          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Match: MCD4 (Protein involved in GPI anchor synthesis; multimembrane-spanning protein that localizes to the endoplasmic reticulum; highly conserved among eukaryotes; GPI stands for glycosylphosphatidylinositol [Source:SGD;Acc:S000001648])

HSP 1 Score: 76.2554 bits (186), Expect = 1.976e-14
Identity = 48/160 (30.00%), Postives = 76/160 (47.50%), Query Frame = 3
Query:  651 DMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMF------------TWDLDSLSQN-----DIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSN 1079
            ++  +H LG D  GH+  P+++   + +  +D++   LI  + K    +KT FI TADHGMS  G HG    N    PL+ +    +K               W+L S+ +N     DIA  +S L+GV  P +++G +P   ++ ID       A L N
Sbjct:  214 NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHNPFPVSDNYTENWELSSIKRNDVKQADIASLMSYLIGVNYPKNSVGELP---IAYIDGKESDKLAALYN 370          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO45110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTY0])

HSP 1 Score: 172.555 bits (436), Expect = 7.483e-48
Identity = 91/232 (39.22%), Postives = 141/232 (60.78%), Query Frame = 3
Query:  219 IDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKT--LFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKF 908
            +D++V+++ID+LR D +         L  ++      S  A   PP++++ +IK+++TG + GFIDV+ N+ S ++++DNL+  L +    ++ F+GD TW+KLFP  F   D T  FFV DY +VD NV+R++   LS+ K WD++I+HYLG+DHIGH  GP +  I  KL EMD+    + + L   D+   T    +L  DHGMSD G HGG+S  E   PL+F + + 
Sbjct:   60 LDRLVIVLIDALRADFVLPGDGRMKYLNELVRNNESLSFLAKAHPPTVTMPRIKALMTGGIPGFIDVLLNSLSTELQEDNLLAQLTAAGKKIV-FFGDDTWIKLFPGNFMRSDGTNSFFVSDYTEVDDNVTRHLGKELSS-KDWDVMILHYLGLDHIGHLAGPSSPLIGPKLQEMDDILRDIHRNLIHWDQEMGTHSAIVLCGDHGMSDSGSHGGASLPETLTPLVFLSSRL 289          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO47657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT5])

HSP 1 Score: 160.614 bits (405), Expect = 6.633e-40
Identity = 103/314 (32.80%), Postives = 175/314 (55.73%), Query Frame = 3
Query:  162 KTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIF------EKRSL-WPNLMGII--------NKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRN-IPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDL---DSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDN 1046
            + S P H    R  ++K      V++VID+LR D +       E ++L + N +  I        N+ W+Y  +A+  PP+ ++ ++K + TG++  F+D   N  +  IK+DN+I  L  +    I F GD TW  LFPD F+   P   F V+D   VD  V ++ IP +    K WD++I H+LG+DH GH  GP+++A+ +KL +MD     +I+++ ++      LF+L  DHGM+  G HGG S +E++  L  ++KK   +   DL   ++++Q D+ P+LS++LG+P+P  N+G +   + + +D 
Sbjct:   64 QMSPPPHGCWVRARYKK-----AVILVIDALRYDFVHFEDNVEENKTLSYQNKLTSIHKVLKSEPNRAWLYRFKAD--PPTTTMQRLKGLTTGSLPTFVDAGSNFATYDIKEDNIIRKLVEHGK-KITFMGDDTWTDLFPDAFHKSYPFPSFNVKDLHTVDNGVIKHLIPEL--RQKDWDVLIGHFLGVDHCGHRYGPYHAAMADKLRQMDK----VIRSVMEELDDESVLFVL-GDHGMTRTGDHGGDSDDELDAALFVYSKKPLDI-AHDLKEENTIAQVDLVPTLSLMLGIPVPFGNLGKVIADLFTQVDR 361          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO47599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLF9])

HSP 1 Score: 79.7221 bits (195), Expect = 4.898e-15
Identity = 91/350 (26.00%), Postives = 146/350 (41.71%), Query Frame = 3
Query:  207 QKQTID----KVVLIVIDSLRPDMIFEKR----SLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPD-------------QFNVRDPTTP--FFVRDYFQVDYNVSRNIPNIL----SNYKLWDMV-------IMHYLGIDHIGHAEGPFNSAIEEKLSEMDN---KTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFT-------------WDLDSLSQN-----DIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQL 1091
            QK ++D    ++VL V D LR D  FE+     +  P L  II     +   ++ + P+ S     ++I G    + DV   +   K  ++N ++   S+           TW    PD              F    P T   F  +D  ++D  V   +        SN+ L++ V        +H LGID  GHA  P +      ++ +D    KT+ LI   F  D +  T F+LT+DHGM++ G HG    +E   PL+ +        T             W L  L +N     DIAP ++ L+GVP P +++G++P   L+  + P    + L +N  Q+
Sbjct:   44 QKSSLDPPAKRLVLFVADGLRADKFFEQDENGLTRAPYLRHIIESQGCWGV-SHTRVPTESRPGHVALIAGF---YEDV---SAVAKGWKENPVEFDSSFNE------TQFTWSWGSPDILPMFAKGATGDHVFTSMYPATEEDFADKDAAKLDSWVFDKVEEFFIEAKSNHSLFEKVSKGQIIFFLHLLGIDTNGHAHRPSSLEYLNNIAFVDKGIKKTVQLIDDFFGNDAS--TAFVLTSDHGMTNWGSHGAGHAHETLTPLVAWGAGIRGPITSDGTGSQDGLSSLWKLTHLQRNDVNQADIAPLMTSLIGVPYPLNSVGILPTAYLN--NTPHYLAENLFTNAKQI 376          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO45111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTY1])

HSP 1 Score: 51.6026 bits (122), Expect = 1.121e-6
Identity = 38/171 (22.22%), Postives = 74/171 (43.27%), Query Frame = 3
Query: 2277 LIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLITSFEQKTHFAIIFNSFTFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVV 2789
            L++  +G  ++F  GNSNSL+T+D+  G++GM +    +   ++++ T+A    W+   I++                   +KN+   TT   A + +  P+  L+                 + T ++    +LF          WSV++PKLLY + +   +   Y+ V
Sbjct:  199 LLYYWLGQATYFALGNSNSLSTVDIAAGYIGMRAHDGLVALILMSLATYASPVLWLTALIKY------------------QVKNATSYTTMYRACVTMVVPNALLLC---------------VYCTLVYAQRYHLF---------VWSVFSPKLLYETMRALVMFCAYATV 327          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:101158779])

HSP 1 Score: 198.749 bits (504), Expect = 1.166e-51
Identity = 109/276 (39.49%), Postives = 168/276 (60.87%), Query Frame = 3
Query:  210 KQTIDKVVLIVIDSLRPDMIFEKRS--LWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKK--DKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDS-LSQNDIAPSLSVLLGVPIPADNIG-VIP 1019
            K    +VV++++D+LR D +F        P    +I +    S  A  +PP++++ +IK++ TG++ GFIDV+ N +S  + +DNLI   K+    +I FYGD TW++LFP  F   D TT FFV DY +VD NV+R++ + L     WD++I+HYLG+DHIGH  GP +S I+ KL EMD+    +  +L  K  D +   L +L  DHGMS+ G HGGSS+ E+N PL+  +  F +    +    + Q D+ P+L++ LG+PI  +++G VIP
Sbjct:   62 KPLFKRVVVMLVDALREDFVFGPNGPMFLPYTRHVIERGSSLSFVAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALSEDNLIWQAKTAGKKII-FYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKRDD-WDILILHYLGLDHIGHISGPHSSLIQPKLLEMDDILKKIHGSLVSKEADGSLPYLLVLCGDHGMSETGSHGGSSEPEINTPLVLISPIFKRKAEMEKPGVVEQVDLTPTLALGLGLPISQNSVGHVIP 335          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:101158779])

HSP 1 Score: 194.126 bits (492), Expect = 2.237e-50
Identity = 106/267 (39.70%), Postives = 163/267 (61.05%), Query Frame = 3
Query:  237 IVIDSLRPDMIFEKRS--LWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKK--DKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDS-LSQNDIAPSLSVLLGVPIPADNIG-VIP 1019
            +++D+LR D +F        P    +I +    S  A  +PP++++ +IK++ TG++ GFIDV+ N +S  + +DNLI   K+    +I FYGD TW++LFP  F   D TT FFV DY +VD NV+R++ + L     WD++I+HYLG+DHIGH  GP +S I+ KL EMD+    +  +L  K  D +   L +L  DHGMS+ G HGGSS+ E+N PL+  +  F +    +    + Q D+ P+L++ LG+PI  +++G VIP
Sbjct:    1 MLVDALREDFVFGPNGPMFLPYTRHVIERGSSLSFVAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALSEDNLIWQAKTAGKKII-FYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKRDD-WDILILHYLGLDHIGHISGPHSSLIQPKLLEMDDILKKIHGSLVSKEADGSLPYLLVLCGDHGMSETGSHGGSSEPEINTPLVLISPIFKRKAEMEKPGVVEQVDLTPTLALGLGLPISQNSVGHVIP 265          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: pigo (phosphatidylinositol glycan anchor biosynthesis class O [Source:NCBI gene;Acc:101156144])

HSP 1 Score: 141.354 bits (355), Expect = 1.415e-33
Identity = 85/262 (32.44%), Postives = 142/262 (54.20%), Query Frame = 3
Query:  324 VYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK--FSKMFTW-DLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKL 1100
            +Y  RA+  PP+ ++ +IK   TG++  F+DV  N  S  I +DNLI  L      V+ F GD TW  LFP +F    P   F V+D   VD  + +++   +     WD+++ H+LG+DH GH  GP + ++ +KL++MD    ++I+ L      N TL ++  DHGM+D G HGG S  E +  L  ++    F++  +  + + + Q D+ P+L++LLG+PIP  ++G + L +        ++T   ++   QL  L
Sbjct:  109 LYPFRAD--PPTTTMQRIKGFTTGSLPTFVDVGNNFASSAILEDNLIHQLGQTGRHVV-FMGDDTWESLFPKKFFRSLPFPSFNVKDLHTVDNGILQHLYTTMVGDD-WDVLVAHFLGVDHCGHRFGPDHPSMADKLTQMDGVIRSVIEHL-----QNDTLLVVMGDHGMTDTGDHGGESLKETDAALFLYSPTPVFAESNSQNEPNVVPQTDLVPTLALLLGIPIPYSSVGQVLLPLF------QEKTAGAVAGLSQLEAL 355          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: pign (phosphatidylinositol glycan anchor biosynthesis class N [Source:NCBI gene;Acc:101163532])

HSP 1 Score: 73.9442 bits (180), Expect = 6.956e-13
Identity = 47/169 (27.81%), Postives = 84/169 (49.70%), Query Frame = 3
Query:  651 DMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLI---QALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFN------------KKFSKMF--TWDLDSL-----SQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQL 1091
            ++  +H LGID  GHA  P +      +  +D     L+   +  F  D   +T ++ T+DHGM++ G HG    +E   PL+ +             + +   F   W L+ +     +Q DIAP ++ L+GVPIP +++GV+P  IL L ++   + +++ +N  Q+
Sbjct:  206 NIFFLHLLGIDTNGHAHRPMSEEYLNNIGLVDKGIAELVPVMEEFFGHD--GRTAYVFTSDHGMTNWGSHGAGHPSETLTPLVVWGAGVNVAQRVTEPQSYEDHFLQEWKLEHIRRVDVNQADIAPLMASLVGVPIPVNSVGVLP--ILYLNNSGQFKAESMYTNAIQV 370          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000653.1 (SMESG000000653.1)

HSP 1 Score: 1722.6 bits (4460), Expect = 0.000e+0
Identity = 903/907 (99.56%), Postives = 904/907 (99.67%), Query Frame = 3
Query:   87 MTYLKYASFLVLLMSLTMYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKNVLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKGLQRISDISVWVFYSIIVFQILFNLTMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLITSFEQKTHFAIIFNSFTFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYFL 2807
            MTYLKYASFLVLLMSLTMYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFN+AIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSK FTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIASSFSSINSSIFSIHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWCYLCSTLLLLYLFKEFATKNVLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKGLQRISDISVWVFYSIIVFQILFNLTMKKFNQKFKISSIIFFTSFIICRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLI SFEQKTHFAIIFNSF FITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYFL
Sbjct:    1 MTYLKYASFLVLLMSLTMYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNNAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKTFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIASSFSSINSSIFSIHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWCYLCSTLLLLYLFKEFATKNVLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKGLQRISDISVWVFYSIIVFQILFNLTMKKFNQKFKISSIIFFTSFIICRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLIKSFEQKTHFAIIFNSFIFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYFL 907          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000653.1 (SMESG000000653.1)

HSP 1 Score: 1687.55 bits (4369), Expect = 0.000e+0
Identity = 886/890 (99.55%), Postives = 887/890 (99.66%), Query Frame = 3
Query:  138 MYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKNVLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKGLQRISDISVWVFYSIIVFQILFNLTMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLITSFEQKTHFAIIFNSFTFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYFL 2807
            MYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFN+AIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSK FTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIASSFSSINSSIFSIHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWCYLCSTLLLLYLFKEFATKNVLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKGLQRISDISVWVFYSIIVFQILFNLTMKKFNQKFKISSIIFFTSFIICRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLI SFEQKTHFAIIFNSF FITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYFL
Sbjct:    1 MYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNNAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFSKTFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIASSFSSINSSIFSIHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWCYLCSTLLLLYLFKEFATKNVLETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKGLQRISDISVWVFYSIIVFQILFNLTMKKFNQKFKISSIIFFTSFIICRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLIKSFEQKTHFAIIFNSFIFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYFL 890          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000707.1 (SMESG000000707.1)

HSP 1 Score: 446.047 bits (1146), Expect = 6.133e-140
Identity = 311/909 (34.21%), Postives = 492/909 (54.13%), Query Frame = 3
Query:  201 FFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYST-----RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFS-KMFTW-DLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLL-NCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSL-VSFGILLMESGIF-ISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLM-------GAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKNVLETDAISVVKS-TYFATFIILIS----DRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADI-KGLQRISDISVWVFYSIIV--------------FQILFNL----TMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLITSFEQKTHFAIIFNSFTFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYF 2804
            +FQK ++DKV+LIVID+LR DM  EK S + +L      T VYS      +  +Q PS+++ +IK+I TG +  F D+I N  S +I  DN+IDIL  +R F +NF+GD TW KLFP++F   D T  FFV+DY++VD NV+RNI  +++N   WDM IMHYLG+DHIGH EGPF+  I  KL+E+      +++ +     +N +L I+T DHGMSDLGGHGG++ NE+     F + K + K F +    ++ Q+D++  +++L GVPIP+++ GVIP ++L LID P+D+++AL SN+  L  L   N    +S F +I + I S+H  C       NCT +L  QH+ LI L+++I ++      Q N + +E+   L+ +S + + F    + +G F   +   +  + +S +  TF    + + C +  F      +IF++  H L+        AK F++        + +  L+I +    + F S+   FI+EE+Q W ++ ++         F    +  T  +S+  S + F   +I IS    DRFLRT+N+TG+ W+++PD GDWL R  N NYLMI + I + ++        S  N   +  L+V N  +R+  + K    I +  +++ Y +I               FQ+ ++L    +     +  K+S+++     +ICR  NI+L      KR   R+IWL  +RH  +I Q L FNMIGM+SFFQQGNS+SL+T+D+Q G+VGM  + P +I  ++ IHT+ G+ +WI +WIEWL+                                 I++ D   ++S  Q    A +  SF+ I++   L + L   L +  +  WSV+ P+LLY  F    L+  Y V+  +YF
Sbjct:   52 YFQKSSVDKVILIVIDALRFDMT-EKYSSFNDL-----NTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWNKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISNGTFPYCLRAFIHFIGLSVITATF----SQNRCEYQLFYFLKIFIIFVIFVHILLQLNRLDNAAKEFMELFCQIADKVKNRFLIIPVLHFISQFSSS---FIEEEHQFWYFMSTSF--------FLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLMILLLISIFLIFFCLSGTSSGTNFVIFSFLIV-NFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAILRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGY------------------------------ISQSDLSHVSSRIQFISLAQLVGSFSLISTSSCLSLMLICSLMRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYF 908          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000707.1 (SMESG000000707.1)

HSP 1 Score: 421.009 bits (1081), Expect = 3.147e-131
Identity = 292/870 (33.56%), Postives = 466/870 (53.56%), Query Frame = 3
Query:  318 TWVYST-----RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFS-KMFTW-DLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIAXXXXXXXXXXXXXHRNCSFPYLL-NCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSL-VSFGILLMESGIF-ISVAGVLFVLSISSMLLTFVYIENLDNCNFTAFKISTSALIFILTCHTLM-------GAKIFIKKIFPTDFNILSEELVIKLCLMFNLFGSAIPGFIKEENQVWXXXXXXXXXXXXFKEFATKNVLETDAISVVKS-TYFATFIILIS----DRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADI-KGLQRISDISVWVFYSIIV--------------FQILFNL----TMXXXXXXXXXXXXXXXXXXXXCRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLITSFEQKTHFAIIFNSFTFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYF 2804
            T VYS      +  +Q PS+++ +IK+I TG +  F D+I N  S +I  DN+IDIL  +R F +NF+GD TW KLFP++F   D T  FFV+DY++VD NV+RNI  +++N   WDM IMHYLG+DHIGH EGPF+  I  KL+E+      +++ +     +N +L I+T DHGMSDLGGHGG++ NE+     F + K + K F +    ++ Q+D++  +++L GVPIP+++ GVIP ++L LID P+D+++AL SN+  L  L   N    +S F +I + I S+H  C       NCT +L  QH+ LI L+++I ++      Q N + +E+   L+ +S + + F    + +G F   +   +  + +S +  TF    + + C +  F      +IF++  H L+        AK F++        + +  L+I +    + F S+   FI+EE+Q W ++ ++         F    +  T  +S+  S + F   +I IS    DRFLRT+N+TG+ W+++PD GDWL R  N NYLMI + I + ++        S  N   +  L+V N  +R+  + K    I +  +++ Y +I               FQ+ ++L    +     +  K+S+++     +ICR  NI+L      KR   R+IWL  +RH  +I Q L FNMIGM+SFFQQGNS+SL+T+D+Q G+VGM  + P +I  ++ IHT+ G+ +WI +WIEWL+                                 I++ D   ++S  Q    A +  SF+ I++   L + L   L +  +  WSV+ P+LLY  F    L+  Y V+  +YF
Sbjct:   13 TGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWNKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISNGTFPYCLRAFIHFIGLSVITATF----SQNRCEYQLFYFLKIFIIFVIFVHILLQLNRLDNAAKEFMELFCQIADKVKNRFLIIPVLHFISQFSSS---FIEEEHQFWYFMSTSF--------FLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLMILLLISIFLIFFCLSGTSSGTNFVIFSFLIV-NFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAILRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGY------------------------------ISQSDLSHVSSRIQFISLAQLVGSFSLISTSSCLSLMLICSLMRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYF 836          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000064847.1 (SMESG000064847.1)

HSP 1 Score: 143.28 bits (360), Expect = 2.383e-34
Identity = 101/330 (30.61%), Postives = 172/330 (52.12%), Query Frame = 3
Query:  111 FLVLLMSLTMYFFGYVPKTS--YPKHDLKNRLFFQKQT-IDKVVLIVIDSLRPDMI---FEKRSLWPNLMGIINK------TWVYSTRANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRN-FVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSN-----YKLWDMVIMHYLGIDHIGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKK----FSKMFTWDLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILS 1034
            F+ +L S+  + +G++   S  Y        + + K +   ++V++++DSL+ + I     K S +   + II         +V+ +     PP+ +L +IK + TG++  FID+  N  S ++ +DN+I+  + +R+ F + F GD TWM LFP++FN+  P   F ++D   VD  V   + N L N     Y   ++++ H LGIDH GH  G  +  ++ KL E+ N+ +  I     KD    TLF++  DHGM+  G HGG S  E++      + K    ++K      + LSQ D+ P+LS + GV IP  N+GV+   +L+
Sbjct:    9 FIGILFSIGNFLYGFLINRSEIYEISSCNTDVVYCKYSPYKRIVILLVDSLKYEFIDPNLVKESYYQGQVNIIRSLINKKSKYVHVSHFISDPPTTTLQRIKGMTTGSLPTFIDISSNFGSSELLEDNIIN--QWHRSGFGLKFVGDDTWMDLFPNKFNISAPYPSFNIKDLDSVDKKVEEFVLNSLKNTTIGKYNKPEIILGHMLGIDHCGHTYGKNHRQMKRKLMEL-NEFIKKIVEFVDKD----TLFVMLGDHGMTTSGDHGGDSIEEIDAGFFLMSGKPLNVYNKNSKQTENYLSQIDLVPTLSAITGVAIPFSNLGVLKPELLT 331          
The following BLAST results are available for this feature:
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIGG2.136e-5939.14phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG2.665e-5639.02phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG3.182e-5639.02phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG9.280e-5639.64phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG1.139e-5439.64phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F28C6.42.708e-3432.03pep chromosome:WBcel235:II:8596300:8599308:-1 gene... [more]
F28C6.42.708e-3432.03pep chromosome:WBcel235:II:8596286:8599317:-1 gene... [more]
F28C6.42.708e-3432.03pep chromosome:WBcel235:II:8596300:8600265:-1 gene... [more]
F28C6.43.959e-3432.03pep chromosome:WBcel235:II:8596322:8599308:-1 gene... [more]
F28C6.43.959e-3432.03pep chromosome:WBcel235:II:8596322:8599317:-1 gene... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIG-G7.236e-3535.14gene:FBgn0033187 transcript:FBtr0088904[more]
PIG-O1.855e-3432.67gene:FBgn0034346 transcript:FBtr0086691[more]
PIG-N1.801e-1323.22gene:FBgn0033479 transcript:FBtr0088431[more]
CG139781.941e-826.86gene:FBgn0039518 transcript:FBtr0085182[more]
CG67904.896e-732.32gene:FBgn0037915 transcript:FBtr0082460[more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PIGG1.994e-5439.13si:ch73-49o8.1 [Source:ZFIN;Acc:ZDB-GENE-141215-6][more]
pigo2.210e-3931.53phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign6.318e-1431.25phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign6.318e-1431.25phosphatidylinositol glycan anchor biosynthesis, c... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIGG4.985e-5438.08phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG6.504e-5440.00phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG1.450e-5338.00phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG3.415e-4234.00phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo2.725e-2534.92phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pigg1.770e-5736.92phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigg2.099e-5736.92phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigo3.373e-3531.66phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigo3.938e-3431.66phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigo4.280e-3431.66phosphatidylinositol glycan anchor biosynthesis, c... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5H8A4|PIGG_HUMAN1.528e-5539.02GPI ethanolamine phosphate transferase 2 OS=Homo s... [more]
sp|P40367|GPI7_YEAST7.452e-5333.42GPI ethanolamine phosphate transferase 2 OS=Saccha... [more]
sp|Q4WDM5|GPI7_ASPFU3.863e-5235.99GPI ethanolamine phosphate transferase 2 OS=Neosar... [more]
sp|Q6CLN2|GPI7_KLULA5.587e-5235.20GPI ethanolamine phosphate transferase 2 OS=Kluyve... [more]
sp|Q09782|GPI7_SCHPO1.763e-4834.43GPI ethanolamine phosphate transferase 2 OS=Schizo... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H8TIF54.408e-6428.20GPI ethanolamine phosphate transferase 2 (Fragment... [more]
A0A182T0869.087e-6427.09Uncharacterized protein OS=Anopheles maculatus OX=... [more]
A0A182YR491.446e-6227.34Uncharacterized protein OS=Anopheles stephensi OX=... [more]
A0A182WM241.245e-6126.24Uncharacterized protein OS=Anopheles minimus OX=11... [more]
A0A182RE554.904e-6125.99Uncharacterized protein OS=Anopheles funestus OX=6... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-49o8.17.415e-5337.79phosphatidylinositol glycan anchor biosynthesis cl... [more]
si:ch73-49o8.13.141e-5237.67phosphatidylinositol glycan anchor biosynthesis cl... [more]
si:ch73-49o8.13.573e-5237.67phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo4.743e-3731.04phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign6.803e-1426.20phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-49o8.11.925e-4732.61phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo4.215e-4033.45phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign1.209e-1422.96phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign1.325e-1424.43phosphatidylinositol glycan anchor biosynthesis, c... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
LAS211.073e-5433.42Integral plasma membrane protein; involved in the ... [more]
GPI131.093e-2733.48ER membrane localized phosphoryltransferase; adds ... [more]
MCD41.976e-1430.00Protein involved in GPI anchor synthesis; multimem... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO451107.483e-4839.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476576.633e-4032.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475994.898e-1526.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451111.121e-622.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-49o8.11.166e-5139.49phosphatidylinositol glycan anchor biosynthesis cl... [more]
si:ch73-49o8.12.237e-5039.70phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo1.415e-3332.44phosphatidylinositol glycan anchor biosynthesis cl... [more]
pign6.956e-1327.81phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000653.10.000e+099.56SMESG000000653.1[more]
SMESG000000653.10.000e+099.55SMESG000000653.1[more]
SMESG000000707.16.133e-14034.21SMESG000000707.1[more]
SMESG000000707.13.147e-13133.56SMESG000000707.1[more]
SMESG000064847.12.383e-3430.61SMESG000064847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003771 ID=SMED30003771|Name=GPI ethanolamine phosphate transferase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3401bp
CCGTATTACTTTAAAAAGAATTAATTTGAATTTTGAGTGAAAGAAATTTA
GATCGCTGTGCAATAAATATTTTGCGGTAAAAATTTATGACTTATCTAAA
GTATGCATCCTTCTTGGTTTTGCTGATGTCTTTGACGATGTATTTTTTCG
GATATGTGCCAAAAACATCTTATCCTAAACATGATCTTAAAAATCGATTA
TTCTTTCAAAAACAAACAATTGACAAAGTGGTGCTCATTGTTATAGATTC
TCTAAGGCCTGACATGATCTTCGAAAAAAGGTCTTTGTGGCCCAATTTGA
TGGGCATAATAAACAAAACTTGGGTCTACTCAACAAGAGCAAATATTCAA
CCCCCTAGTATGAGTTTAGCAAAAATAAAAAGCATTATAACGGGAGCTGT
TGTAGGATTTATTGATGTTATATTTAACACAGATTCGGGGAAAATAAAAC
AGGACAATCTAATTGATATTTTAAAATCATATCGAAATTTTGTGATAAAC
TTTTATGGGGATATTACTTGGATGAAACTGTTCCCTGACCAATTTAATGT
TCGAGATCCAACGACTCCATTCTTTGTTAGAGATTATTTTCAAGTCGATT
ACAATGTTTCCAGAAACATCCCAAACATTCTCTCAAACTACAAATTATGG
GATATGGTAATTATGCATTATCTTGGAATCGACCATATAGGTCACGCAGA
AGGCCCTTTCAATAGTGCAATTGAAGAGAAATTATCAGAAATGGATAATA
AAACCATGACATTAATACAAGCACTATTTAAAAAAGACAAAACTAACAAA
ACACTTTTCATTCTAACAGCTGATCATGGAATGAGTGACCTAGGAGGTCA
TGGTGGCTCATCAAAAAATGAAGTGAACGTTCCACTTTTATTTTTCAATA
AAAAATTTTCAAAGATGTTTACCTGGGATTTGGATTCTTTATCACAAAAT
GATATTGCCCCTTCGCTATCAGTGTTACTCGGAGTGCCAATACCCGCGGA
TAATATTGGAGTTATCCCATTACGGATTTTGTCTTTAATTGATAATCCCA
TGGATCAAACGCAAGCTTTATTATCAAATTATGATCAACTGTCCAAATTG
ATGGGCCATAATTCAGTGGATATTGCTTCTTCCTTTTCCAGTATCAATTC
ATCCATTTTTTCAATACATAGAAACTGCTCATTTCCATATTTATTGAATT
GCACGGGAAATCTTTCAAATCAGCACAAAAAATTAATCAATTTAATGAAA
CAAATTACGGAAGTTTTGAAATTTCGATTCATTCAGCACAATTTCGTTAT
TTTGGAAATTGCACATTTTCTTGTCATTTTGTCTTCTTTGGTTTCCTTTG
GAATTTTGTTGATGGAGAGCGGGATTTTTATTTCTGTTGCTGGTGTTCTT
TTTGTTTTGTCGATTTCATCGATGCTTCTAACATTTGTCTATATTGAAAA
TCTGGATAATTGCAATTTTACGGCCTTTAAAATTTCTACAAGTGCCTTAA
TTTTCATTCTTACTTGCCATACTTTAATGGGAGCCAAAATATTTATTAAA
AAAATCTTTCCTACAGATTTCAATATTTTGTCGGAGGAATTAGTCATCAA
ATTGTGCCTGATGTTCAATTTATTCGGCTCAGCAATCCCAGGATTCATTA
AAGAAGAGAACCAAGTCTGGTGCTATTTGTGCAGCACTCTTTTACTGTTG
TATCTTTTCAAAGAGTTTGCGACGAAGAATGTTTTGGAAACCGACGCGAT
TTCAGTTGTTAAAAGCACATATTTCGCAACATTTATTATTTTAATATCAG
ATCGATTTCTAAGAACTCTAAACAGAACGGGTGAATTGTGGTCCCATATT
CCAGATTTCGGTGATTGGCTAGTTCGAAAAAGCAACACAAATTATTTGAT
GATATCAATCGGTATTTGTCTAGTCATTGTGGTTGTAATATATTGGGATA
GAGAGTCCATTTTAAATTCTTTTTTCTATATATTATTGGTTGTGCTCAAT
GGAATTCACAGATATGCTGATATTAAAGGATTACAAAGGATATCTGACAT
ATCAGTTTGGGTATTCTATTCAATAATCGTCTTTCAAATTTTGTTTAACT
TAACCATGAAAAAATTCAATCAAAAATTCAAAATTAGCAGCATAATATTT
TTTACTTCATTTATTATTTGCCGCAATCAAAATATTCTTTTGTGGACAGT
CATAGAGATCAAAAGATTGTTTTATAGAAAGATTTGGTTGGAAGAAATCC
GTCATTTGCCCTTAATTTTTCAATATCTCATTTTTAATATGATTGGTATG
GTTTCATTCTTTCAACAGGGAAATTCAAATAGCTTAACCACATTAGACGT
GCAACCGGGATTTGTTGGAATGACATCATTTGTTCCCCAGATTATATTTC
CAGTGGTCGCAATTCACACTTTTGCCGGAAATTTCTACTGGATATTCATT
TGGATAGAGTGGTTAGCAGGAGATCGACTAAAGATCCAATACAAATTGGT
GGTTAATCAAGAAGCAAATCTAAAAAATTCTCTAGAAAAAACAACCGATT
CTACAGCAATAATCCCAATAACTGAACCAGATAAGCCTTTGATAACAAGT
TTCGAGCAAAAGACACATTTTGCTATCATCTTTAATTCTTTCACATTTAT
AACTTCTCTGTTTTTACTGATGATTTATTTGTTCGCCATTCTGCATAAAA
ACCAAATCACCGCTTGGTCGGTCTATGCTCCGAAACTGTTGTATATGTCA
TTTCAAGGTGGATTTCTGCTAATTATTTACAGTGTTGTAGGGCGATTGTA
TTTTTTGTGAAACCTACCATATGGTACCCTATTTATAGAAAATGAAAAAT
TTCTACAAAATCTCAATTCCAAAAATCTATTATTAAATTAAAATCAATTA
AATTTATCAGTATTATTTTTGTGAGTATTATTTTTAAAACAATTTTTTCG
ATCAACAAAGTGATGAATAATTTTTTCTATAACTCTTTTCATGTGTCCAA
TCTTTCTATCCATTTCTCTGACCTTGAGAGGCTGGATGAGGCGGTTGTCT
TCTGTTCTTGTTATTTTTTAATGGCAAGTCTGTTCCAGATATCACAAGTA
AAATGGGAGAATGTTTTTTTTGATTTTAGAGATTTAATAGTTTTATTTTT
ATTCCCTACAATGAAAATGAGATACCAATACTGACAGGCCTTGTGTTGGC
TTGTTTGATTGCAATTTTGTTTGTATGTGTTTCAAATCTATATCATGTTT
AATTGAACCAATTTATCAGATCAGTAAAATATTATCTTCCTTTCCCACTA
AATGTATTCTGTGATTGTTAAAAATGAATTTTTTTTTGACATTCACTATT
CTTGTTTATCGATTTCTGGAAATATTTGTCTAAAAATAAAATACTATGAA
T
back to top

protein sequence of SMED30003771-orf-1

>SMED30003771-orf-1 ID=SMED30003771-orf-1|Name=SMED30003771-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=908bp
MTYLKYASFLVLLMSLTMYFFGYVPKTSYPKHDLKNRLFFQKQTIDKVVL
IVIDSLRPDMIFEKRSLWPNLMGIINKTWVYSTRANIQPPSMSLAKIKSI
ITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFP
DQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDH
IGHAEGPFNSAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMS
DLGGHGGSSKNEVNVPLLFFNKKFSKMFTWDLDSLSQNDIAPSLSVLLGV
PIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIASSF
SSINSSIFSIHRNCSFPYLLNCTGNLSNQHKKLINLMKQITEVLKFRFIQ
HNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLFVLSISSMLLTF
VYIENLDNCNFTAFKISTSALIFILTCHTLMGAKIFIKKIFPTDFNILSE
ELVIKLCLMFNLFGSAIPGFIKEENQVWCYLCSTLLLLYLFKEFATKNVL
ETDAISVVKSTYFATFIILISDRFLRTLNRTGELWSHIPDFGDWLVRKSN
TNYLMISIGICLVIVVVIYWDRESILNSFFYILLVVLNGIHRYADIKGLQ
RISDISVWVFYSIIVFQILFNLTMKKFNQKFKISSIIFFTSFIICRNQNI
LLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSL
TTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKI
QYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLITSFEQKTHFAIIFN
SFTFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSV
VGRLYFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006506GPI anchor biosynthetic process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0051377mannose-ethanolamine phosphotransferase activity
GO:0003824catalytic activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039527PIGG/GPI7
IPR002591Phosphodiest/P_Trfase
IPR017849Alkaline_Pase-like_a/b/a
IPR017850Alkaline_phosphatase_core_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002591Type I phosphodiesterase/nucleotide pyrophosphatase/phosphate transferasePFAMPF01663Phosphodiestcoord: 186..252
e-value: 5.1E-10
score: 39.5
IPR017850Alkaline-phosphatase-like, core domain superfamilyGENE3DG3DSA:3.40.720.10coord: 46..327
e-value: 5.4E-43
score: 149.5
IPR017850Alkaline-phosphatase-like, core domain superfamilySUPERFAMILYSSF53649Alkaline phosphatase-likecoord: 46..310
IPR039527GPI ethanolamine phosphate transferase 2PANTHERPTHR23072PHOSPHATIDYLINOSITOL GLYCAN-RELATEDcoord: 8..900
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
NoneNo IPR availableTMHMMTMhelixcoord: 765..787
NoneNo IPR availableTMHMMTMhelixcoord: 603..620
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 847..869
NoneNo IPR availableTMHMMTMhelixcoord: 468..487
NoneNo IPR availableTMHMMTMhelixcoord: 684..706
NoneNo IPR availableTMHMMTMhelixcoord: 625..644
NoneNo IPR availableTMHMMTMhelixcoord: 726..745
NoneNo IPR availableTMHMMTMhelixcoord: 884..906
NoneNo IPR availableTMHMMTMhelixcoord: 657..674
NoneNo IPR availableTMHMMTMhelixcoord: 404..426