calmodulin-beta

Overview
Namecalmodulin-beta
Smed IDSMED30003769
Length (bp)1447
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of calmodulin-beta (SMED30003769) t-SNE clustered cells

Violin plots show distribution of expression levels for calmodulin-beta (SMED30003769) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of calmodulin-beta (SMED30003769) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for calmodulin-beta (SMED30003769) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003769

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30003769SMESG000067105.1 SmedASXL_009407SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30003769SMESG000067105.1 dd_Smed_v4_4944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003769SMESG000067105.1 dd_Smed_v4_4944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003769SMESG000067105.1 dd_Smed_v4_4944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003769SMESG000067105.1 dd_Smed_v4_4944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003769SMESG000067105.1 Contig33951newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30003769SMESG000067105.1 Contig33951uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30003769SMESG000067105.1 dd_Smed_v4_4944_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of calmodulin-beta vs. TrEMBL
Match: A0A0B7BKS0 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF195836 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.431e-47
Identity = 82/152 (53.95%), Postives = 109/152 (71.71%), Query Frame = 3
Query:  384 SRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGR 839
            +RKVP  +++IFDKYV NNVR L+K  +I+ML+ EF L   + E MF TFD+D+NGK+S+WEFQQF  C+G +AQ  V +F ELD D SG LD EEARAG+ E KT +G  ++ KE++FF++ A D+ G IDLG F  LL RLK+Y   A +
Sbjct:    5 NRKVPDHIMKIFDKYVANNVRVLAKQPAIDMLKTEFGLDDAEGEVMFNTFDKDKNGKLSLWEFQQFCVCMGEHAQEIVSKFKELDKDGSGQLDPEEARAGLHELKTATGRLLTDKEVDFFIQTAGDD-GSIDLGHFTNLLYRLKLYNAPAPK 155          

HSP 2 Score: 74.3294 bits (181), Expect = 4.881e-12
Identity = 35/79 (44.30%), Postives = 53/79 (67.09%), Query Frame = 1
Query: 1105 TQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 1341
             Q+ + KF ELD D +G L+ EEARAG++  KT +G  ++ KE++FF++ A  ++G IDLG F  LL RL++Y   A +
Sbjct:   78 AQEIVSKFKELDKDGSGQLDPEEARAGLHELKTATGRLLTDKEVDFFIQTAG-DDGSIDLGHFTNLLYRLKLYNAPAPK 155          
BLAST of calmodulin-beta vs. TrEMBL
Match: K1QAD2 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10017744 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.111e-47
Identity = 84/155 (54.19%), Postives = 106/155 (68.39%), Query Frame = 3
Query:  378 MVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGRK 842
            M   K+PKEV  IFDKY   NVR+L K  +I +L+NEF L   +A  MF+TFD+DQN  MS+WEFQQFY  VG  A   + +F ELDVD+SG LD +EA+ G+    T +G ++ P+EIEFFLK A+DE+G ID+GKFV L  RLKVY   A  K
Sbjct:    2 MRRGKIPKEVQFIFDKYAHQNVRSLKKPDAINLLKNEFNLNDAEATCMFDTFDKDQNEIMSIWEFQQFYETVGNGAAEMLNKFHELDVDRSGKLDQQEAKEGLELMTTATGRKLDPREIEFFLKTASDEEGFIDIGKFVSLFKRLKVYDSPAPPK 156          

HSP 2 Score: 76.2554 bits (186), Expect = 1.479e-12
Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 1
Query: 1117 IQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQA 1335
            + KF ELD D++G L+ +EA+ G+    T +G ++  +EIEFFLK A++E G ID+GKFV+L  RL+VY   A
Sbjct:   81 LNKFHELDVDRSGKLDQQEAKEGLELMTTATGRKLDPREIEFFLKTASDEEGFIDIGKFVSLFKRLKVYDSPA 153          
BLAST of calmodulin-beta vs. TrEMBL
Match: A0A0B6Z0P6 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF44180 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 8.725e-47
Identity = 80/152 (52.63%), Postives = 109/152 (71.71%), Query Frame = 3
Query:  384 SRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGR 839
            +RK+P  ++++FDKYV NNVR L K  +I+MLQ EF L  E+A  MF TFD+D+NGK+S+WEFQQF+ C+G +AQ  V +F ELD D SG LD +EAR G+ + KT +G  ++ KE+EFF+  A D  G+IDLG+F  LL RLK+Y   A +
Sbjct:    5 NRKIPDNIVKMFDKYVANNVRILGKRSAIDMLQVEFGLDEEEASVMFTTFDKDKNGKLSIWEFQQFFICMGEHAQEIVTKFKELDQDGSGQLDPDEARVGLRQLKTATGRLLTDKEVEFFIDTAGD-NGVIDLGQFTNLLYRLKLYTAPAPK 155          

HSP 2 Score: 75.0998 bits (183), Expect = 2.951e-12
Identity = 35/78 (44.87%), Postives = 52/78 (66.67%), Query Frame = 1
Query: 1108 QKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 1341
            Q+ + KF ELD D +G L+ +EAR G+   KT +G  ++ KE+EFF+ + A +NG IDLG+F  LL RL++Y   A +
Sbjct:   79 QEIVTKFKELDQDGSGQLDPDEARVGLRQLKTATGRLLTDKEVEFFI-DTAGDNGVIDLGQFTNLLYRLKLYTAPAPK 155          
BLAST of calmodulin-beta vs. TrEMBL
Match: A0A1S3K902 (calmodulin-like protein 3 OS=Lingula unguis OX=7574 GN=LOC106179854 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 5.684e-44
Identity = 76/150 (50.67%), Postives = 103/150 (68.67%), Query Frame = 3
Query:  378 MVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKG 827
            M  RK+PKEV  +FDKY   N+R L K+++I ML  EF LT EQAE MF+TFD D NG +S+WEFQQFY  VG++    + +F E+D D SG +D EEARAG     T++G  ++ KE++FF+K  + E G +D+GKF  LL RLK ++G
Sbjct:    1 MPQRKLPKEVQAMFDKYTQKNIRRLKKEQAITMLTTEFGLTAEQAENMFKTFDSDGNGSLSMWEFQQFYTIVGSSVGELLAKFNEMDKDGSGAIDPEEARAGFKSLMTKTGRNLTEKEVDFFIKTTSSEDGQVDIGKFGHLLYRLKFFEG 150          

HSP 2 Score: 72.4034 bits (176), Expect = 3.812e-11
Identity = 31/76 (40.79%), Postives = 54/76 (71.05%), Query Frame = 1
Query: 1102 STQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKG 1329
            S  + + KF E+D D +G ++ EEARAG     T++G  +++KE++FF+K  ++E+G++D+GKF  LL RL+ ++G
Sbjct:   75 SVGELLAKFNEMDKDGSGAIDPEEARAGFKSLMTKTGRNLTEKEVDFFIKTTSSEDGQVDIGKFGHLLYRLKFFEG 150          
BLAST of calmodulin-beta vs. TrEMBL
Match: R7V649 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223283 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.734e-43
Identity = 82/149 (55.03%), Postives = 106/149 (71.14%), Query Frame = 3
Query:  378 MVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYK 824
            MV+RK+PKEV  IFD+YV NNVR L+KD++I ML+ EF L  EQA  MFE+FD D NG MS++EFQQFY CVG +AQ  V++F ELD D SG LD+EEA+ G+      SG  +  KEI+FF+ +   + G ID+ +F  LL RLKVY+
Sbjct:    1 MVARKIPKEVQAIFDRYVKNNVRRLAKDEAIAMLEKEFSLAPEQANAMFESFDGDHNGIMSLYEFQQFYQCVGNSAQEMVKKFEELDADGSGKLDVEEAKVGLQ----ASG--LGEKEIDFFINSTKGKDGQIDIAQFGNLLFRLKVYE 143          

HSP 2 Score: 59.6918 bits (143), Expect = 6.042e-7
Identity = 31/75 (41.33%), Postives = 52/75 (69.33%), Query Frame = 1
Query: 1102 STQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYK 1326
            S Q+ ++KF ELD+D +G L++EEA+ G+      SG  + +KEI+FF+ +   ++G+ID+ +F  LL RL+VY+
Sbjct:   75 SAQEMVKKFEELDADGSGKLDVEEAKVGLQA----SG--LGEKEIDFFINSTKGKDGQIDIAQFGNLLFRLKVYE 143          
BLAST of calmodulin-beta vs. Ensembl Cavefish
Match: capns1a (calpain small subunit 1-like [Source:NCBI gene;Acc:103043763])

HSP 1 Score: 50.8322 bits (120), Expect = 7.060e-7
Identity = 43/160 (26.88%), Postives = 71/160 (44.38%), Query Frame = 3
Query:  336 RKFSFHFQSLVSSEM-VSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRL 812
            R+F   FQ L   +M VS   P E++ I +K +I+   +L  D            T E    M    D D  GK+   EF+  +     N + W   + + D D+SG +  +E     + FK  +G  ++ +  +  ++  +DEKG +D   + G L RL
Sbjct:   47 RQFRKVFQQLAGDDMEVS---PAELMNILNK-IISKHGDLKTDG----------FTIESCRSMVAVMDSDSTGKLGFHEFKHLW----NNIKKWQGIYKQFDADRSGVIGADELP---NSFKA-AGFPLNDQLFQLIIRRYSDEKGNMDFDNYTGCLVRL 184          
BLAST of calmodulin-beta vs. Planmine SMEST
Match: SMESG000067105.1 (SMESG000067105.1)

HSP 1 Score: 378.252 bits (970), Expect = 1.609e-129
Identity = 205/209 (98.09%), Postives = 207/209 (99.04%), Query Frame = 3
Query:  216 YGQPTESTLKSAVQXXXXXXXXXXXXXXXXXXXQKCDINIRKFSFHFQSLVSSEMVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGRK 842
            Y + +ESTLKSAVQLCDSPCHHSSSLPSRRLHLQKCDINIRKFSFHFQSLVSSEMVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGRK
Sbjct:  102 YTRYSESTLKSAVQLCDSPCHHSSSLPSRRLHLQKCDINIRKFSFHFQSLVSSEMVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGRK 310          

HSP 2 Score: 133.265 bits (334), Expect = 5.509e-35
Identity = 62/78 (79.49%), Postives = 70/78 (89.74%), Query Frame = 1
Query: 1108 QKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 1341
            Q W+Q+FIELD DK+GHL+MEEARAGM+ FKTESGHE+S KEIEFFLKNAA+E G IDLGKFV LLSRL+VYKGQA R
Sbjct:  232 QAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGR 309          
BLAST of calmodulin-beta vs. Planmine SMEST
Match: SMESG000067105.1 (SMESG000067105.1)

HSP 1 Score: 343.584 bits (880), Expect = 4.514e-116
Identity = 187/208 (89.90%), Postives = 197/208 (94.71%), Query Frame = 3
Query:  216 YGQPTESTLKSAVQXXXXXXXXXXXXXXXXXXXQKCDINIRKFSFHFQSLVSSEMVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGR 839
            Y + +ESTLKSAVQLCDSPCHHSSSLPSRRLHLQKCDINIRKFSFHFQSLVSSEMVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGAN Q W+Q+FIELD DK+GHL+MEEARAGM+ FKTESGHE+S KEIEFFLKNAA+E G IDLGKFV LLSRL+VYKGQA R
Sbjct:   88 YTRYSESTLKSAVQLCDSPCHHSSSLPSRRLHLQKCDINIRKFSFHFQSLVSSEMVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANTQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 295          

HSP 2 Score: 166.777 bits (421), Expect = 1.315e-47
Identity = 79/80 (98.75%), Postives = 80/80 (100.00%), Query Frame = 1
Query: 1102 STQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 1341
            +TQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR
Sbjct:  216 NTQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 295          
BLAST of calmodulin-beta vs. Planmine SMEST
Match: SMESG000067105.1 (SMESG000067105.1)

HSP 1 Score: 286.574 bits (732), Expect = 7.224e-96
Identity = 137/154 (88.96%), Postives = 145/154 (94.16%), Query Frame = 3
Query:  378 MVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEARAGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKGQAGR 839
            MVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGAN Q W+Q+FIELD DK+GHL+MEEARAGM+ FKTESGHE+S KEIEFFLKNAA+E G IDLGKFV LLSRL+VYKGQA R
Sbjct:    1 MVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFETFDQDQNGKMSVWEFQQFYACVGANTQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 154          

HSP 2 Score: 164.466 bits (415), Expect = 1.367e-48
Identity = 79/80 (98.75%), Postives = 80/80 (100.00%), Query Frame = 1
Query: 1102 STQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 1341
            +TQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR
Sbjct:   75 NTQKWIQKFIELDSDKNGHLNMEEARAGMNHFKTESGHEISQKEIEFFLKNAANENGEIDLGKFVALLSRLRVYKGQAQR 154          
The following BLAST results are available for this feature:
BLAST of calmodulin-beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7BKS01.431e-4753.95Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
K1QAD22.111e-4754.19Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A0B6Z0P68.725e-4752.63Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A1S3K9025.684e-4450.67calmodulin-like protein 3 OS=Lingula unguis OX=757... [more]
R7V6491.734e-4355.03Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of calmodulin-beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
capns1a7.060e-726.88calpain small subunit 1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of calmodulin-beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of calmodulin-beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000067105.11.609e-12998.09SMESG000067105.1[more]
SMESG000067105.14.514e-11689.90SMESG000067105.1[more]
SMESG000067105.17.224e-9688.96SMESG000067105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003769 ID=SMED30003769|Name=calmodulin-beta|organism=Schmidtea mediterranea sexual|type=transcript|length=1447bp
CTTAGTCACATCGGATGAAAAATTTTCCCAAAAATCGTAACATACATTTT
GGCGATTTTATTTTGTCCTTTTTATTCAGACAGTAAATTATGTTTCATGC
CAACTGAAAAATACAAATAAAACAGAAAAATATCATTTAATAAGCAGACA
AGTGTTTCGTCATATTTTCAATCTTGATCTTTTCTGGTGATTAAATCATT
TTCTCTAATGTGAAATACGGTCAGCCCACAGAAAGCACACTGAAAAGTGC
TGTGCAATTATGCGATTCTCCTTGCCACCATTCATCAAGTCTTCCTTCTC
GCCGATTACACCTACAAAAATGCGATATAAATATTCGAAAATTTTCATTT
CATTTTCAGTCTCTCGTATCAAGCGAAATGGTCAGCAGAAAAGTGCCTAA
AGAAGTTCTTCAGATATTCGATAAATATGTCATAAATAATGTTCGAAATT
TGTCAAAGGACAAATCCATTGAAATGCTACAAAATGAATTTCAATTGACT
ACTGAACAAGCAGAGCAGATGTTTGAAACATTTGATCAAGATCAAAACGG
AAAAATGAGCGTTTGGGAATTTCAACAGTTTTATGCCTGCGTTGGAGCAA
ATGCTCAAGCATGGGTTCAGAGATTTATTGAACTCGATGTTGACAAAAGT
GGCCATTTGGATATGGAAGAAGCAAGAGCTGGAATGAGTGAATTTAAAAC
TGAGTCCGGTCATGAAATGTCACCGAAAGAAATCGAGTTCTTCCTAAAGA
ATGCCGCCGACGAAAAAGGCCTGATTGATTTAGGGAAATTCGTCGGTTTA
TTGTCGAGATTAAAAGTGTATAAAGGCCAAGCTGGCCGCAAATAAATTCC
GTTTTGTTTTACTTTATTTGTCATTATCAATCGCATGATTTCTTGTTCTC
AGATTCAAATGGAAATTTTTAACACATTATTTTCTGTTGATTTTAATTTT
TTTTTCATTATTTAATCTTTTATCAAATTTATAAATATATATTCTGCTTG
AAATTTATTACGATTGATTATTATTATTATTATTGATTATGTTATAATTA
TTTAATTTTCAATAATGGTTGATTCAAACAAAAATTCATTAATTGATGTT
TAGTACACAAAAATGGATCCAGAAATTTATCGAGCTCGACTCGGACAAAA
ACGGCCATTTAAACATGGAAGAAGCAAGAGCGGGAATGAATCACTTTAAA
ACCGAATCCGGTCATGAAATTTCACAGAAAGAAATTGAATTCTTTCTCAA
GAACGCTGCAAACGAAAACGGGGAAATCGATTTGGGGAAATTTGTGGCGC
TTCTTTCAAGACTGAGGGTGTACAAGGGTCAAGCTCAACGCTAATTTATT
TCCATTTCTTTTACAATTTTTTATGGACACATTGCGCTATTTATGATTTT
ATACGATTTATGAAACTTTTAGCTAAATAAATGTTGAAATTTAAAAA
back to top

protein sequence of SMED30003769-orf-1

>SMED30003769-orf-1 ID=SMED30003769-orf-1|Name=SMED30003769-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MVSRKVPKEVLQIFDKYVINNVRNLSKDKSIEMLQNEFQLTTEQAEQMFE
TFDQDQNGKMSVWEFQQFYACVGANAQAWVQRFIELDVDKSGHLDMEEAR
AGMSEFKTESGHEMSPKEIEFFLKNAADEKGLIDLGKFVGLLSRLKVYKG
QAGRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002111X2 cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 44..72
e-value: 0.59
score: 19.2
coord: 78..106
e-value: 2.0
score: 15.3
IPR002048EF-hand domainPFAMPF13202EF-hand_5coord: 83..100
e-value: 0.011
score: 15.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 40..75
score: 12.282
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 83..109
score: 8.683
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 3..153
e-value: 7.4E-22
score: 79.7
NoneNo IPR availablePANTHERPTHR46212:SF3PROGRAMMED CELL DEATH 6coord: 9..146
NoneNo IPR availablePANTHERPTHR46212FAMILY NOT NAMEDcoord: 9..146
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 53..65
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 3..146