POU domain protein 1

Overview
NamePOU domain protein 1
Smed IDSMED30003768
Length (bp)951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of POU domain protein 1 (SMED30003768) t-SNE clustered cells

Violin plots show distribution of expression levels for POU domain protein 1 (SMED30003768) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of POU domain protein 1 (SMED30003768) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for POU domain protein 1 (SMED30003768) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003768

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003768SMESG000057970.1 dd_Smed_v4_17324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003768SMESG000057970.1 dd_Smed_v4_17324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003768SMESG000057970.1 dd_Smed_v4_17324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003768SMESG000057970.1 dd_Smed_v6_17324_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of POU domain protein 1 vs. Ensembl Human
Match: POU3F2 (POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:9215])

HSP 1 Score: 146.747 bits (369), Expect = 5.715e-65
Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSSS SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  313 ALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 414          

HSP 2 Score: 121.324 bits (303), Expect = 5.715e-65
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  256 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 321          
BLAST of POU domain protein 1 vs. Ensembl Human
Match: POU3F4 (POU class 3 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:9217])

HSP 1 Score: 149.443 bits (376), Expect = 9.338e-65
Identity = 77/127 (60.63%), Postives = 93/127 (73.23%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNED 556
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK +LE+ F+K  KP+AQ+ISSLA+ L LEKEVVRVWFCNRRQKEKR+TP     DQ  +EV     YS TV  D
Sbjct:  237 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP---GDQQPHEV-----YSHTVKTD 355          

HSP 2 Score: 117.857 bits (294), Expect = 9.338e-65
Identity = 54/60 (90.00%), Postives = 58/60 (96.67%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            E+ P+SD+LEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  186 EETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 245          
BLAST of POU domain protein 1 vs. Ensembl Human
Match: POU3F3 (POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:9216])

HSP 1 Score: 144.821 bits (364), Expect = 2.170e-64
Identity = 74/127 (58.27%), Postives = 93/127 (73.23%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNED 556
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I++LA+ L LEKEVVRVWFCNRRQKEKR+TP   +  Q  ++V S +    TV+ D
Sbjct:  365 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPP-GIQQQTPDDVYSQV---GTVSAD 487          

HSP 2 Score: 121.324 bits (303), Expect = 2.170e-64
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  308 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 373          
BLAST of POU domain protein 1 vs. Ensembl Human
Match: POU3F3 (POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:9216])

HSP 1 Score: 144.821 bits (364), Expect = 2.170e-64
Identity = 74/127 (58.27%), Postives = 93/127 (73.23%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNED 556
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I++LA+ L LEKEVVRVWFCNRRQKEKR+TP   +  Q  ++V S +    TV+ D
Sbjct:  365 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPP-GIQQQTPDDVYSQV---GTVSAD 487          

HSP 2 Score: 121.324 bits (303), Expect = 2.170e-64
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  308 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 373          
BLAST of POU domain protein 1 vs. Ensembl Human
Match: POU3F1 (POU class 3 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9214])

HSP 1 Score: 143.28 bits (360), Expect = 3.723e-64
Identity = 68/103 (66.02%), Postives = 79/103 (76.70%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPS 484
            +  +  +   KL+PLL KWL E DSSS SPTN DKI+AQ RKRKKRTSIE  VK  LES F+K  KPSA +I+ LA+ L LEKEVVRVWFCNRRQKEKR+TP+
Sbjct:  298 ALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPA 400          

HSP 2 Score: 122.094 bits (305), Expect = 3.723e-64
Identity = 57/60 (95.00%), Postives = 58/60 (96.67%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ED PSSDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  247 EDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 306          
BLAST of POU domain protein 1 vs. Ensembl Celegans
Match: ceh-6 (Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Prot;Acc:P20268])

HSP 1 Score: 119.398 bits (298), Expect = 9.579e-31
Identity = 68/135 (50.37%), Postives = 88/135 (65.19%), Query Frame = 2
Query:  170 IRSFTVKLQKYVKLRPLLQKWLHEADSSSESP-TNFDKISAQS-RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPS-FDVSD--QFDNEVSST---MPYSSTVN 550
              +  +  +   KL+PLL KWL EADS++ SP + F+K++ Q+ RKRKKRTSIE NVK  LE  F    KP+AQ+I+ +A +L LEKEVVRVWFCNRRQKEKRI P+ +D       +N    T    PY + VN
Sbjct:  236 FEALQLSFKNMCKLKPLLFKWLEEADSTTGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEKRIAPNQYDAPHPMALNNGYPMTADLFPYQAVVN 370          

HSP 2 Score: 108.997 bits (271), Expect = 7.142e-27
Identity = 50/54 (92.59%), Postives = 52/54 (96.30%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            DDLE FAK FKQRRIKLGYTQADVG+ALGTLYGN+FSQTTICRFEALQLSFKNM
Sbjct:  193 DDLEGFAKQFKQRRIKLGYTQADVGVALGTLYGNIFSQTTICRFEALQLSFKNM 246          
BLAST of POU domain protein 1 vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 80.4925 bits (197), Expect = 2.991e-27
Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ++LE FA+ FK++RIK G+TQ DVG+ALG  YG  FSQTTI RFEAL LSFKNM
Sbjct:  294 NELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNM 347          

HSP 2 Score: 60.077 bits (144), Expect = 2.991e-27
Identity = 38/139 (27.34%), Postives = 64/139 (46.04%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWL------------------------------HEADSSSESPTN-FDKISAQS--------RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRI 475
            +  +  +   KLRPLL++WL                              H  D    S +N    ++A S        ++R+KRT+++ N +  L++ F    +P    ++ +A  L L+++VVRVWFCNRRQK +R+
Sbjct:  339 ALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRV 477          
BLAST of POU domain protein 1 vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 80.4925 bits (197), Expect = 3.015e-27
Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ++LE FA+ FK++RIK G+TQ DVG+ALG  YG  FSQTTI RFEAL LSFKNM
Sbjct:  296 NELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNM 349          

HSP 2 Score: 59.6918 bits (143), Expect = 3.015e-27
Identity = 38/139 (27.34%), Postives = 64/139 (46.04%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWL------------------------------HEADSSSESPTN-FDKISAQS--------RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRI 475
            +  +  +   KLRPLL++WL                              H  D    S +N    ++A S        ++R+KRT+++ N +  L++ F    +P    ++ +A  L L+++VVRVWFCNRRQK +R+
Sbjct:  341 ALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRV 479          
BLAST of POU domain protein 1 vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 81.2629 bits (199), Expect = 2.425e-17
Identity = 42/102 (41.18%), Postives = 65/102 (63.73%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSS---SESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKR 472
            S T+     V L+P+L  WL +A+ +    ++  + + I   + K++KRTSI A  K  LE  F +  +PS + I+S+A++L L+K VVRVWFCN+RQK+KR
Sbjct:  153 SLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 254          

HSP 2 Score: 65.4698 bits (158), Expect = 6.826e-12
Identity = 39/68 (57.35%), Postives = 46/68 (67.65%), Query Frame = 3
Query:   33 PSSD------DLEQFAKMFKQRRIKLGYTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNML 206
            P+SD       LE FA+ FKQRRIKLG TQADVG AL  L     G++ SQ+TICRFE+L LS  NM+
Sbjct:   96 PTSDMDTDPRQLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSL-SQSTICRFESLTLSHNNMV 162          
BLAST of POU domain protein 1 vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 81.2629 bits (199), Expect = 3.508e-17
Identity = 42/102 (41.18%), Postives = 65/102 (63.73%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSS---SESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKR 472
            S T+     V L+P+L  WL +A+ +    ++  + + I   + K++KRTSI A  K  LE  F +  +PS + I+S+A++L L+K VVRVWFCN+RQK+KR
Sbjct:  209 SLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 310          

HSP 2 Score: 65.4698 bits (158), Expect = 9.022e-12
Identity = 39/68 (57.35%), Postives = 46/68 (67.65%), Query Frame = 3
Query:   33 PSSD------DLEQFAKMFKQRRIKLGYTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNML 206
            P+SD       LE FA+ FKQRRIKLG TQADVG AL  L     G++ SQ+TICRFE+L LS  NM+
Sbjct:  152 PTSDMDTDPRQLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSL-SQSTICRFESLTLSHNNMV 218          
BLAST of POU domain protein 1 vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0345911)

HSP 1 Score: 145.206 bits (365), Expect = 3.363e-65
Identity = 68/102 (66.67%), Postives = 81/102 (79.41%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLLQKWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LE  F K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  263 ALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 364          

HSP 2 Score: 122.865 bits (307), Expect = 3.363e-65
Identity = 57/64 (89.06%), Postives = 59/64 (92.19%), Query Frame = 3
Query:   12 SGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            SG  ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  208 SGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 271          
BLAST of POU domain protein 1 vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0076944)

HSP 1 Score: 145.206 bits (365), Expect = 3.363e-65
Identity = 68/102 (66.67%), Postives = 81/102 (79.41%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLLQKWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LE  F K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  263 ALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 364          

HSP 2 Score: 122.865 bits (307), Expect = 3.363e-65
Identity = 57/64 (89.06%), Postives = 59/64 (92.19%), Query Frame = 3
Query:   12 SGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            SG  ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  208 SGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 271          
BLAST of POU domain protein 1 vs. Ensembl Fly
Match: nub (gene:FBgn0085424 transcript:FBtr0112642)

HSP 1 Score: 116.701 bits (291), Expect = 3.121e-47
Identity = 59/128 (46.09%), Postives = 84/128 (65.62%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTN-FDKISAQS---------RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTM 529
            +  +  +   KL+PLLQKWL +AD + ++    FD  + Q+         R+RKKRTSIE  ++  LE +F+   KP++++I+ LA++LS+EKEVVRVWFCNRRQKEKRI PS D     D++ SS M
Sbjct:  832 ALNLSFKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEIIGRRRKKRTSIETTIRGALEKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRINPSLDSPTGADDDESSYM 959          

HSP 2 Score: 91.2781 bits (225), Expect = 3.121e-47
Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:   54 QFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            QFAK FKQRRIKLG+TQ DVGLA+G LYGN FSQTTI RFEAL LSFKNM
Sbjct:  791 QFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 840          
BLAST of POU domain protein 1 vs. Ensembl Fly
Match: nub (gene:FBgn0085424 transcript:FBtr0112643)

HSP 1 Score: 116.316 bits (290), Expect = 3.669e-47
Identity = 59/128 (46.09%), Postives = 84/128 (65.62%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTN-FDKISAQS---------RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTM 529
            +  +  +   KL+PLLQKWL +AD + ++    FD  + Q+         R+RKKRTSIE  ++  LE +F+   KP++++I+ LA++LS+EKEVVRVWFCNRRQKEKRI PS D     D++ SS M
Sbjct:  472 ALNLSFKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEIIGRRRKKRTSIETTIRGALEKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRINPSLDSPTGADDDESSYM 599          

HSP 2 Score: 91.2781 bits (225), Expect = 3.669e-47
Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:   54 QFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            QFAK FKQRRIKLG+TQ DVGLA+G LYGN FSQTTI RFEAL LSFKNM
Sbjct:  431 QFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 480          
BLAST of POU domain protein 1 vs. Ensembl Fly
Match: nub (gene:FBgn0085424 transcript:FBtr0342628)

HSP 1 Score: 116.316 bits (290), Expect = 3.669e-47
Identity = 59/128 (46.09%), Postives = 84/128 (65.62%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTN-FDKISAQS---------RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTM 529
            +  +  +   KL+PLLQKWL +AD + ++    FD  + Q+         R+RKKRTSIE  ++  LE +F+   KP++++I+ LA++LS+EKEVVRVWFCNRRQKEKRI PS D     D++ SS M
Sbjct:  472 ALNLSFKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEIIGRRRKKRTSIETTIRGALEKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRINPSLDSPTGADDDESSYM 599          

HSP 2 Score: 91.2781 bits (225), Expect = 3.669e-47
Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:   54 QFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            QFAK FKQRRIKLG+TQ DVGLA+G LYGN FSQTTI RFEAL LSFKNM
Sbjct:  431 QFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 480          
BLAST of POU domain protein 1 vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:NCBI gene;Acc:30386])

HSP 1 Score: 145.206 bits (365), Expect = 2.536e-65
Identity = 68/102 (66.67%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  293 ALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTP 394          

HSP 2 Score: 123.635 bits (309), Expect = 2.536e-65
Identity = 58/66 (87.88%), Postives = 60/66 (90.91%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H S   ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  236 HDSHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 301          
BLAST of POU domain protein 1 vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:NCBI gene;Acc:30386])

HSP 1 Score: 144.821 bits (364), Expect = 3.593e-65
Identity = 68/102 (66.67%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  293 ALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTP 394          

HSP 2 Score: 123.635 bits (309), Expect = 3.593e-65
Identity = 58/66 (87.88%), Postives = 60/66 (90.91%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H S   ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  236 HDSHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 301          
BLAST of POU domain protein 1 vs. Ensembl Zebrafish
Match: pou3f3b (POU class 3 homeobox 3b [Source:NCBI gene;Acc:30321])

HSP 1 Score: 148.288 bits (373), Expect = 4.385e-65
Identity = 76/127 (59.84%), Postives = 90/127 (70.87%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSF------DVSDQFDNEVSSTMPYS 538
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP        DV  Q  N  + T P S
Sbjct:  289 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYSQVGNVSADTPPPS 415          

HSP 2 Score: 119.783 bits (299), Expect = 4.385e-65
Identity = 56/66 (84.85%), Postives = 58/66 (87.88%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  232 HDPHSDEDTPTSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 297          
BLAST of POU domain protein 1 vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:NCBI gene;Acc:30386])

HSP 1 Score: 144.05 bits (362), Expect = 7.834e-65
Identity = 68/102 (66.67%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  293 ALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTP 394          

HSP 2 Score: 122.865 bits (307), Expect = 7.834e-65
Identity = 58/66 (87.88%), Postives = 60/66 (90.91%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H S   ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  236 HDSHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 301          
BLAST of POU domain protein 1 vs. Ensembl Zebrafish
Match: pou3f3b (POU class 3 homeobox 3b [Source:NCBI gene;Acc:30321])

HSP 1 Score: 145.976 bits (367), Expect = 2.033e-64
Identity = 69/102 (67.65%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  289 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTP 390          

HSP 2 Score: 119.783 bits (299), Expect = 2.033e-64
Identity = 56/66 (84.85%), Postives = 58/66 (87.88%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  232 HDPHSDEDTPTSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 297          
BLAST of POU domain protein 1 vs. Ensembl Xenopus
Match: slc25a38 (solute carrier family 25 member 38 [Source:Xenbase;Acc:XB-GENE-5814283])

HSP 1 Score: 147.132 bits (370), Expect = 3.048e-65
Identity = 74/126 (58.73%), Postives = 89/126 (70.63%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSF-------DVSDQFDNEVSSTMP 532
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I++LA+ L LEKEVVRVWFCNRRQKEKR+TP         DV  Q  N  + T P
Sbjct:  313 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGNVGADTPP 438          

HSP 2 Score: 122.094 bits (305), Expect = 3.048e-65
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  256 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 321          
BLAST of POU domain protein 1 vs. Ensembl Xenopus
Match: pou3f2 (POU class 3 homeobox 2 [Source:NCBI gene;Acc:100486226])

HSP 1 Score: 146.747 bits (369), Expect = 3.103e-65
Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSSS SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  252 ALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 353          

HSP 2 Score: 122.094 bits (305), Expect = 3.103e-65
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  195 HHDHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 260          
BLAST of POU domain protein 1 vs. Ensembl Xenopus
Match: tecta.1 (tectorin alpha, gene 1 [Source:Xenbase;Acc:XB-GENE-1011878])

HSP 1 Score: 142.124 bits (357), Expect = 2.509e-64
Identity = 66/103 (64.08%), Postives = 80/103 (77.67%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPS 484
            +  +  +   KL+PLL KWL E DS++ SPTN DKI+AQ RKRKKRTSIE  VK  LE+ F+K  KPSA +I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP+
Sbjct:  245 ALQLSFKNMCKLKPLLNKWLEETDSTTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPA 347          

HSP 2 Score: 124.02 bits (310), Expect = 2.509e-64
Identity = 58/66 (87.88%), Postives = 60/66 (90.91%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H+    ED PSSDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  188 HQDHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 253          
BLAST of POU domain protein 1 vs. Ensembl Xenopus
Match: pou3f4 (POU class 3 homeobox 4 [Source:NCBI gene;Acc:100036711])

HSP 1 Score: 146.362 bits (368), Expect = 1.003e-63
Identity = 69/105 (65.71%), Postives = 84/105 (80.00%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFD 490
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK +LE+ F+K  KP+AQ+ISSLA+ L LEKEVVRVWFCNRRQKEKR+TP  D
Sbjct:  236 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGD 340          

HSP 2 Score: 117.857 bits (294), Expect = 1.003e-63
Identity = 54/60 (90.00%), Postives = 58/60 (96.67%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            E+ P+SD+LEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  185 EETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 244          
BLAST of POU domain protein 1 vs. Ensembl Xenopus
Match: POU2F2 (POU class 2 homeobox 2 [Source:NCBI gene;Acc:100497329])

HSP 1 Score: 107.071 bits (266), Expect = 2.405e-45
Identity = 54/112 (48.21%), Postives = 71/112 (63.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEA-----DSSSESPTNFDKISA-----QSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLLQKWL +A     DS+  SP               R+RKKRTSIE NV+  LE SF+   KP++++I  +AE+L +EKEV+RVWFCNRRQKEKRI P
Sbjct:  238 ALNLSFKNMCKLKPLLQKWLSDAETMSVDSTLPSPNPLSSPGGGYEGLPGRRRKKRTSIETNVRYALEKSFIANQKPTSEEILVIAEQLKMEKEVIRVWFCNRRQKEKRINP 349          

HSP 2 Score: 95.5153 bits (236), Expect = 2.405e-45
Identity = 43/54 (79.63%), Postives = 48/54 (88.89%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ++LEQFA+ FKQRRIKLG+TQ DVGLA+G LYGN FSQTTI RFEAL LSFKNM
Sbjct:  193 EELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 246          
BLAST of POU domain protein 1 vs. Ensembl Mouse
Match: Pou3f2 (POU domain, class 3, transcription factor 2 [Source:MGI Symbol;Acc:MGI:101895])

HSP 1 Score: 146.747 bits (369), Expect = 4.148e-65
Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSSS SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  315 ALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 416          

HSP 2 Score: 121.324 bits (303), Expect = 4.148e-65
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  258 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 323          
BLAST of POU domain protein 1 vs. Ensembl Mouse
Match: Pou3f4 (POU domain, class 3, transcription factor 4 [Source:MGI Symbol;Acc:MGI:101894])

HSP 1 Score: 149.443 bits (376), Expect = 7.486e-65
Identity = 77/127 (60.63%), Postives = 93/127 (73.23%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNED 556
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK +LE+ F+K  KP+AQ+ISSLA+ L LEKEVVRVWFCNRRQKEKR+TP     DQ  +EV     YS TV  D
Sbjct:  237 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP---GDQQPHEV-----YSHTVKTD 355          

HSP 2 Score: 117.857 bits (294), Expect = 7.486e-65
Identity = 54/60 (90.00%), Postives = 58/60 (96.67%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            E+ P+SD+LEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  186 EETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 245          
BLAST of POU domain protein 1 vs. Ensembl Mouse
Match: Pou3f3 (POU domain, class 3, transcription factor 3 [Source:MGI Symbol;Acc:MGI:102564])

HSP 1 Score: 144.821 bits (364), Expect = 1.511e-64
Identity = 74/127 (58.27%), Postives = 93/127 (73.23%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNED 556
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I++LA+ L LEKEVVRVWFCNRRQKEKR+TP   +  Q  ++V S +    TV+ D
Sbjct:  362 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPP-GIQQQTPDDVYSQV---GTVSAD 484          

HSP 2 Score: 121.709 bits (304), Expect = 1.511e-64
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  305 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 370          
BLAST of POU domain protein 1 vs. Ensembl Mouse
Match: Pou3f3 (POU domain, class 3, transcription factor 3 [Source:MGI Symbol;Acc:MGI:102564])

HSP 1 Score: 144.821 bits (364), Expect = 1.511e-64
Identity = 74/127 (58.27%), Postives = 93/127 (73.23%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNED 556
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I++LA+ L LEKEVVRVWFCNRRQKEKR+TP   +  Q  ++V S +    TV+ D
Sbjct:  362 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPP-GIQQQTPDDVYSQV---GTVSAD 484          

HSP 2 Score: 121.709 bits (304), Expect = 1.511e-64
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  305 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 370          
BLAST of POU domain protein 1 vs. Ensembl Mouse
Match: Pou3f1 (POU domain, class 3, transcription factor 1 [Source:MGI Symbol;Acc:MGI:101896])

HSP 1 Score: 143.665 bits (361), Expect = 2.658e-64
Identity = 68/103 (66.02%), Postives = 79/103 (76.70%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPS 484
            +  +  +   KL+PLL KWL E DSSS SPTN DKI+AQ RKRKKRTSIE  VK  LES F+K  KPSA +I+ LA+ L LEKEVVRVWFCNRRQKEKR+TP+
Sbjct:  296 ALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPA 398          

HSP 2 Score: 121.709 bits (304), Expect = 2.658e-64
Identity = 57/60 (95.00%), Postives = 58/60 (96.67%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ED PSSDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  245 EDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 304          
BLAST of POU domain protein 1 vs. UniProt/SwissProt
Match: sp|P31370|POU1_DUGJA (POU domain protein 1 OS=Dugesia japonica OX=6161 GN=POU1 PE=2 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 4.717e-147
Identity = 207/253 (81.82%), Postives = 229/253 (90.51%), Query Frame = 2
Query:  170 IRSFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNEDRGDKSLKNPFDNHDKVIKPSGDSNHEATRCSSSKRLKMRKEPDQISINDENGSCHAESSGIVSETHFRQECDNHSICGYNIHDLHESSVLMSDPVSFYPRSFFMKNNIYSSGATPALFDHNQMI 928
              +  +  +   KLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVK ILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDV++QFDNEVSSTMPYS T+N+DR +K++KN F+NH+K+IK +G++NHE    SS KRLK+RKEPDQISINDEN SC AESSGIV +TH+RQECDNHSICGYNIHD+HESSVLMSDPVSFYPRSFFMKNNIYS+G TP LFDH+QMI
Sbjct:  308 FEALQLSFKNMCKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKSILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVNEQFDNEVSSTMPYS-TLNDDRNEKTIKNSFENHEKLIKQTGETNHEQNNNSSVKRLKIRKEPDQISINDENTSCRAESSGIVPDTHYRQECDNHSICGYNIHDIHESSVLMSDPVSFYPRSFFMKNNIYSNGTTPTLFDHSQMI 559          

HSP 2 Score: 143.665 bits (361), Expect = 1.952e-37
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 3
Query:    3 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  252 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 318          
BLAST of POU domain protein 1 vs. UniProt/SwissProt
Match: sp|P31360|PO3F2_MOUSE (POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.435e-64
Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSSS SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  315 ALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 416          

HSP 2 Score: 121.324 bits (303), Expect = 2.435e-64
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  258 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 323          
BLAST of POU domain protein 1 vs. UniProt/SwissProt
Match: sp|P20265|PO3F2_HUMAN (POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4)

HSP 1 Score: 146.747 bits (369), Expect = 2.435e-64
Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSSS SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  313 ALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 414          

HSP 2 Score: 121.324 bits (303), Expect = 2.435e-64
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  256 HDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 321          
BLAST of POU domain protein 1 vs. UniProt/SwissProt
Match: sp|P16241|CF1A_DROME (POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5)

HSP 1 Score: 145.206 bits (365), Expect = 2.497e-64
Identity = 68/102 (66.67%), Postives = 81/102 (79.41%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLLQKWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LE  F K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  263 ALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 364          

HSP 2 Score: 122.865 bits (307), Expect = 2.497e-64
Identity = 57/64 (89.06%), Postives = 59/64 (92.19%), Query Frame = 3
Query:   12 SGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            SG  ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  208 SGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 271          
BLAST of POU domain protein 1 vs. UniProt/SwissProt
Match: sp|P70030|P3F2B_XENLA (POU domain, class 3, transcription factor 2-B OS=Xenopus laevis OX=8355 GN=pou3f2-b PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.761e-64
Identity = 69/102 (67.65%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSSS SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KP+AQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  255 ALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 356          

HSP 2 Score: 122.094 bits (305), Expect = 2.761e-64
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  198 HHDHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 263          
BLAST of POU domain protein 1 vs. TrEMBL
Match: Q94551 (POU domain protein OS=Girardia tigrina OX=6162 GN=GtPOU-1 PE=3 SV=2)

HSP 1 Score: 293.508 bits (750), Expect = 1.522e-92
Identity = 150/189 (79.37%), Postives = 163/189 (86.24%), Query Frame = 2
Query:  170 IRSFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNEDRGDKSLKNPFDNHDKVIKPSGDSNHEATRCSSSKRLKMRKEPDQISINDENGSCHAESSG 736
              +  +  +   KLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVK ILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDV++ FDNEVSSTMP++ST  EDR DK LKN F+NHDK+ K +GDSN + T CSSSKRLK+RKE DQ+SINDEN SC AE  G
Sbjct:  309 FEALQLSFKNMCKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKSILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVNEHFDNEVSSTMPFASTT-EDRTDKGLKNQFENHDKLGKSAGDSNLDQTNCSSSKRLKIRKETDQVSINDENTSCRAEFLG 496          

HSP 2 Score: 142.895 bits (359), Expect = 5.077e-35
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 3
Query:    3 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  253 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 319          
BLAST of POU domain protein 1 vs. TrEMBL
Match: A0A1B6EDS5 (POU domain protein OS=Clastoptera arizonana OX=38151 GN=g.12551 PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.699e-64
Identity = 78/152 (51.32%), Postives = 97/152 (63.82%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNEDRGDKSLKNPFDNHDKVIKPSGDSNH 631
            +  +  +   KL+PLLQKWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LE  F K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP   +  Q D+ +   MP         G   L   + + D    P G  +H
Sbjct:  274 ALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGPQ-DSLLEGQMP-------PGGPHGLHQAYHHQDMHGSPMGPHSH 417          

HSP 2 Score: 124.79 bits (312), Expect = 4.699e-64
Identity = 58/67 (86.57%), Postives = 60/67 (89.55%), Query Frame = 3
Query:    3 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            D  SG  ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  216 DAPSGGEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 282          
BLAST of POU domain protein 1 vs. TrEMBL
Match: T1IUA9 (POU domain protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.070e-63
Identity = 70/114 (61.40%), Postives = 86/114 (75.44%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEV 517
            +  +  +   KL+PLLQKWL EADS++ SPT+ DKI+AQ RKRKKRTSIE  VK  LES F K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP   ++   + E+
Sbjct:  207 ALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALESHFHKQPKPSAQEIASLADSLQLEKEVVRVWFCNRRQKEKRMTPPGSINPNHNGEM 320          

HSP 2 Score: 124.405 bits (311), Expect = 1.070e-63
Identity = 56/67 (83.58%), Postives = 61/67 (91.04%), Query Frame = 3
Query:    3 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            +H+    +D P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  149 EHQESGEDDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 215          
BLAST of POU domain protein 1 vs. TrEMBL
Match: A0A0L8G742 (POU domain protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22038788mg PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.074e-63
Identity = 68/102 (66.67%), Postives = 83/102 (81.37%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLLQKWL EADS+S SPT+ DKI+AQ RKRKKRTSIE  VK  LE+ F+K  KPSAQ+I++LA++L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  220 ALQLSFKNMCKLKPLLQKWLEEADSTSGSPTSIDKIAAQGRKRKKRTSIEVTVKGALENHFIKQPKPSAQEITNLADQLQLEKEVVRVWFCNRRQKEKRMTP 321          

HSP 2 Score: 126.331 bits (316), Expect = 2.074e-63
Identity = 58/67 (86.57%), Postives = 60/67 (89.55%), Query Frame = 3
Query:    3 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            DH     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  162 DHHEPSDEDAPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 228          
BLAST of POU domain protein 1 vs. TrEMBL
Match: A0A4W4DP91 (POU domain protein OS=Electrophorus electricus OX=8005 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.274e-63
Identity = 74/119 (62.18%), Postives = 87/119 (73.11%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSF------DVSDQFDNE 514
            +  +  +   KL+PLL KWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+ISSLA+ L LEKEVVRVWFCNRRQKEKR+TP        DV  Q  NE
Sbjct:  273 ALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEISSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYSQVGNE 391          

HSP 2 Score: 124.02 bits (310), Expect = 3.274e-63
Identity = 58/67 (86.57%), Postives = 61/67 (91.04%), Query Frame = 3
Query:    3 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            +H S   ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  215 NHDSHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 281          
BLAST of POU domain protein 1 vs. Ensembl Cavefish
Match: pou3f3a (POU class 3 homeobox 3 [Source:NCBI gene;Acc:103040687])

HSP 1 Score: 146.362 bits (368), Expect = 1.483e-65
Identity = 78/140 (55.71%), Postives = 95/140 (67.86%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSF------DVSDQFDNEVSSTMPYSSTVNEDRGDKSLK 577
            +  +  +   KL+PLL KWL EADS++ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP        DV  Q  N  + T P S     +  D+ LK
Sbjct:  293 ALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVGQSPEDVYSQAGNVSADTPPPSMDCKREFCDRLLK 432          

HSP 2 Score: 122.865 bits (307), Expect = 1.483e-65
Identity = 58/66 (87.88%), Postives = 60/66 (90.91%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H S   ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  236 HDSHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 301          
BLAST of POU domain protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000040961.1 (POU domain, class 3, transcription factor 3-B-like [Source:NCBI gene;Acc:103021364])

HSP 1 Score: 144.821 bits (364), Expect = 5.507e-64
Identity = 69/102 (67.65%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  339 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTP 440          

HSP 2 Score: 119.398 bits (298), Expect = 5.507e-64
Identity = 55/60 (91.67%), Postives = 57/60 (95.00%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  288 EDTPTSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 347          
BLAST of POU domain protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000041388.1 (POU domain, class 3, transcription factor 3-B-like [Source:NCBI gene;Acc:103021364])

HSP 1 Score: 144.821 bits (364), Expect = 7.307e-64
Identity = 69/102 (67.65%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  293 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTP 394          

HSP 2 Score: 119.013 bits (297), Expect = 7.307e-64
Identity = 55/60 (91.67%), Postives = 57/60 (95.00%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  242 EDTPTSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 301          
BLAST of POU domain protein 1 vs. Ensembl Cavefish
Match: pou3f1 (POU class 3 homeobox 1 [Source:NCBI gene;Acc:30398])

HSP 1 Score: 140.584 bits (353), Expect = 8.498e-64
Identity = 67/102 (65.69%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL E DS+S SPTN DKI+AQ RKRKKRTSIE  VK  LE+ F+K  KPSA +IS+LA  L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  230 ALQLSFKNMCKLKPLLNKWLEETDSNSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEISTLAGTLQLEKEVVRVWFCNRRQKEKRMTP 331          

HSP 2 Score: 122.865 bits (307), Expect = 8.498e-64
Identity = 58/66 (87.88%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED PSSDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  173 HELHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 238          
BLAST of POU domain protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000030028.1 (POU domain, class 3, transcription factor 3-B-like [Source:NCBI gene;Acc:103021364])

HSP 1 Score: 144.436 bits (363), Expect = 9.363e-64
Identity = 69/102 (67.65%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  339 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTP 440          

HSP 2 Score: 119.013 bits (297), Expect = 9.363e-64
Identity = 55/60 (91.67%), Postives = 57/60 (95.00%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  288 EDTPTSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 347          
BLAST of POU domain protein 1 vs. Ensembl Sea Lamprey
Match: pou2f1b (POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2422])

HSP 1 Score: 104.375 bits (259), Expect = 2.122e-45
Identity = 53/101 (52.48%), Postives = 76/101 (75.25%), Query Frame = 2
Query:  206 KLRPLLQKWLHE-----ADSS----SESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            KL+PLL+KWL++     ADSS    + SP+  + +    R+RKKRTSI+ +V++ LE SF++  KP+++++S +AE+L +EKEVVRVWFCNRRQKEKRI P
Sbjct:  268 KLKPLLEKWLNDTEHIPADSSPGNQNASPSGLEGLG---RRRKKRTSIDTHVRVALEKSFLENCKPTSEELSMIAEQLHMEKEVVRVWFCNRRQKEKRINP 365          

HSP 2 Score: 95.1301 bits (235), Expect = 2.122e-45
Identity = 46/62 (74.19%), Postives = 51/62 (82.26%), Query Frame = 3
Query:   18 KTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            + ED    ++LE FAKMFKQRRIKLG+TQ DVGLA+G LYGN FSQTTI RFEAL LSFKNM
Sbjct:  205 QPEDPRDLEELEVFAKMFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 266          
BLAST of POU domain protein 1 vs. Ensembl Sea Lamprey
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 72.4034 bits (176), Expect = 6.805e-24
Identity = 34/91 (37.36%), Postives = 61/91 (67.03%), Query Frame = 2
Query:  206 KLRPLLQKWLHEADSSSESPTNF--DKISAQ-SRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEK 469
            K++P+L++W+ EA++  ++      D +  + S+KRK+RTS       +L + F + + PS Q+++++AE+L  ++EVVRVWFCN+RQ  K
Sbjct:  199 KIKPVLERWMEEAEARKQAGLQSLSDFVGGEPSKKRKRRTSFTPQALELLNAHFERNTHPSGQEMTAIAERLCYDREVVRVWFCNKRQALK 289          

HSP 2 Score: 55.0694 bits (131), Expect = 6.805e-24
Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKN 200
            +++ +FA+ FK RR+ LG TQ  VG AL    G  +SQ+ ICRFE L ++ K+
Sbjct:  144 EEMREFARAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRFEKLDITPKS 196          
BLAST of POU domain protein 1 vs. Ensembl Sea Lamprey
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 72.0182 bits (175), Expect = 7.330e-24
Identity = 34/91 (37.36%), Postives = 61/91 (67.03%), Query Frame = 2
Query:  206 KLRPLLQKWLHEADSSSESPTNF--DKISAQ-SRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEK 469
            K++P+L++W+ EA++  ++      D +  + S+KRK+RTS       +L + F + + PS Q+++++AE+L  ++EVVRVWFCN+RQ  K
Sbjct:  196 KIKPVLERWMEEAEARKQAGLQSLSDFVGGEPSKKRKRRTSFTPQALELLNAHFERNTHPSGQEMTAIAERLCYDREVVRVWFCNKRQALK 286          

HSP 2 Score: 55.4546 bits (132), Expect = 7.330e-24
Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKN 200
            +++ +FA+ FK RR+ LG TQ  VG AL    G  +SQ+ ICRFE L ++ K+
Sbjct:  141 EEMREFARAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRFEKLDITPKS 193          
BLAST of POU domain protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002675.1 (pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 gene:ENSPMAG00000002443.1 transcript:ENSPMAT00000002675.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.006e-23
Identity = 34/92 (36.96%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  206 KLRPLLQKWLHEADS----SSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEK 469
            K+RP+L++W+ EA++     + + T+F   S  S++RK+RTS      +IL + F     P++ +++ +AE+L  ++EVVR+WFCN+RQ  K
Sbjct:   61 KMRPILERWMGEAEARHRMGTHTLTDFIG-SEPSKRRKRRTSFTQEALVILNAHFDVGMHPTSAEMTQIAEQLGYDREVVRIWFCNKRQALK 151          

HSP 2 Score: 56.9954 bits (136), Expect = 1.006e-23
Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKN 200
            +++ +FAK+FK RR+ LG TQ  VG AL    G  +SQ+ ICRFE L L+ K+
Sbjct:    6 EEIREFAKVFKLRRLALGLTQTQVGQALSAAEGPAYSQSAICRFEKLDLTPKS 58          
BLAST of POU domain protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009070.1 (pep scaffold:Pmarinus_7.0:GL476573:36580:49436:1 gene:ENSPMAG00000008205.1 transcript:ENSPMAT00000009070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 5.399e-23
Identity = 37/92 (40.22%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  206 KLRPLLQKWLHEADS----SSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEK 469
            K++P+L++W+ EA++      +S ++F   S  SRKR++RTS        L + F + + PS Q+++++AE L  E+EVVRVWFCN+RQ  K
Sbjct:  207 KIKPVLERWMAEAEARQRTGLQSLSDFVG-SEPSRKRRRRTSFTPQALEALNAYFERNTHPSGQEMTAIAEHLCYEREVVRVWFCNKRQMLK 297          

HSP 2 Score: 52.7582 bits (125), Expect = 5.399e-23
Identity = 21/53 (39.62%), Postives = 35/53 (66.04%), Query Frame = 3
Query:   42 DDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKN 200
            +++ +FA+ FK RR+ +G TQ  VG A+ +     +SQ+ ICRFE L ++ K+
Sbjct:  152 EEIREFARAFKIRRLSMGLTQTQVGQAMSSTEAPAYSQSAICRFEKLDITPKS 204          
BLAST of POU domain protein 1 vs. Ensembl Nematostella
Match: EDO33532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRV9])

HSP 1 Score: 123.25 bits (308), Expect = 1.535e-57
Identity = 59/101 (58.42%), Postives = 75/101 (74.26%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRIT 478
            +  +  +   KL+PLLQKWL EAD+++ +    DK++   RKRKKRTSIE  VK  LE+ F K  KP+AQ+IS+LAE L L+KEVVRVWFCNRRQKEKR+T
Sbjct:   85 ALQLSFKNMCKLKPLLQKWLEEADNNNGATGGVDKLATTGRKRKKRTSIEVAVKGALENHFCKSPKPTAQEISALAENLGLDKEVVRVWFCNRRQKEKRMT 185          

HSP 2 Score: 117.857 bits (294), Expect = 1.535e-57
Identity = 55/60 (91.67%), Postives = 58/60 (96.67%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            +D P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:   34 DDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 93          
BLAST of POU domain protein 1 vs. Ensembl Nematostella
Match: EDO43881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXQ0])

HSP 1 Score: 110.923 bits (276), Expect = 1.658e-47
Identity = 57/111 (51.35%), Postives = 77/111 (69.37%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSS--------ESPTNFDKISAQS--RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRIT 478
            +  + L+   KL+PLLQKWL E D+SS        ++P+NF   +     +KRK+RT IE NVK +LE+ F K+ +PS  DISSLAE L L++EVVRVWFCNRRQKE+R++
Sbjct:   52 ALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQKERRVS 162          

HSP 2 Score: 96.2857 bits (238), Expect = 1.658e-47
Identity = 44/59 (74.58%), Postives = 50/59 (84.75%), Query Frame = 3
Query:   27 DLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            D  + D+L  FAK F+QRR+ LG+TQADVG+ALGTLYGNV SQTTICRFEALQLS KNM
Sbjct:    2 DPTTPDELSTFAKQFRQRRVALGFTQADVGVALGTLYGNVLSQTTICRFEALQLSLKNM 60          
BLAST of POU domain protein 1 vs. Ensembl Nematostella
Match: EDO30968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ94])

HSP 1 Score: 110.923 bits (276), Expect = 1.804e-43
Identity = 57/111 (51.35%), Postives = 77/111 (69.37%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSS--------ESPTNFDKISAQS--RKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRIT 478
            +  + L+   KL+PLLQKWL E D+SS        ++P+NF   +     +KRK+RT IE NVK +LE+ F K+ +PS  DISSLAE L L++EVVRVWFCNRRQKE+R++
Sbjct:   36 ALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQKERRVS 146          

HSP 2 Score: 82.8037 bits (203), Expect = 1.804e-43
Identity = 37/44 (84.09%), Postives = 41/44 (93.18%), Query Frame = 3
Query:   72 KQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            +QRR+ LG+TQADVG+ALGTLYGNV SQTTICRFEALQLS KNM
Sbjct:    1 RQRRVALGFTQADVGVALGTLYGNVLSQTTICRFEALQLSLKNM 44          
BLAST of POU domain protein 1 vs. Ensembl Nematostella
Match: EDO38767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC36])

HSP 1 Score: 93.5893 bits (231), Expect = 1.478e-36
Identity = 47/98 (47.96%), Postives = 69/98 (70.41%), Query Frame = 2
Query:  206 KLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSD 499
            KL+P+L +WL EA+ S  +    +K  A+ R+RK+RT+I    K  LE+ FMK +KPS+ +I  +A+ L L+KEVVRVWFCNRRQ+EKR+  S ++ +
Sbjct:   62 KLKPILARWLEEAERSGGACG--EKFGAE-RRRKRRTTIGLAAKEALENHFMKQTKPSSPEIVRIADGLRLDKEVVRVWFCNRRQREKRVKTSLNIHN 156          

HSP 2 Score: 77.0258 bits (188), Expect = 1.478e-36
Identity = 36/52 (69.23%), Postives = 42/52 (80.77%), Query Frame = 3
Query:   45 DLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKN 200
            +LE+FA  FK RRIKLG+TQ +VG AL  ++G  FSQTTICRFE LQLSFKN
Sbjct:    8 ELEEFATQFKLRRIKLGFTQTNVGAALAAVHGTDFSQTTICRFENLQLSFKN 59          
BLAST of POU domain protein 1 vs. Ensembl Nematostella
Match: EDO47033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB5])

HSP 1 Score: 80.1073 bits (196), Expect = 2.428e-18
Identity = 44/100 (44.00%), Postives = 62/100 (62.00%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRI 475
            S T+     + L+P+L  WL EA+ + ++          S K++KRTSI A  K  LE+ F    +PS+  I+S+AEKL L K VVRVWFCN+RQK+KR+
Sbjct:   52 SLTLSHNNMMALKPVLTAWLEEAEKAYKTKQCNSAFLPNSDKKRKRTSIGAAEKRSLEAYFAMNPRPSSDKIASIAEKLDLSKNVVRVWFCNQRQKKKRM 151          

HSP 2 Score: 66.6254 bits (161), Expect = 1.932e-13
Identity = 36/58 (62.07%), Postives = 43/58 (74.14%), Query Frame = 3
Query:   45 DLEQFAKMFKQRRIKLGYTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNML 206
            +LE FA+ FKQRRIKLG TQADVG AL  L     G++ SQ+TICRFE+L LS  NM+
Sbjct:    5 ELEWFAERFKQRRIKLGVTQADVGSALAHLKIPGVGSL-SQSTICRFESLTLSHNNMM 61          
BLAST of POU domain protein 1 vs. Ensembl Medaka
Match: pou3f1 (POU class 3 homeobox 1 [Source:NCBI gene;Acc:101175025])

HSP 1 Score: 140.198 bits (352), Expect = 4.385e-64
Identity = 66/102 (64.71%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL E DS++ SPTN DKI+AQ RKRKKRTSIE  VK  LE+ F+K  KPSA +IS+LA  L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  245 ALQLSFKNMCKLKPLLNKWLEETDSNTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEISTLAGTLQLEKEVVRVWFCNRRQKEKRMTP 346          

HSP 2 Score: 124.02 bits (310), Expect = 4.385e-64
Identity = 58/66 (87.88%), Postives = 60/66 (90.91%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H+    ED PSSDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  188 HQDHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 253          
BLAST of POU domain protein 1 vs. Ensembl Medaka
Match: pou3f2b (POU domain, class 3, transcription factor 2 [Source:NCBI gene;Acc:101159940])

HSP 1 Score: 140.198 bits (352), Expect = 1.149e-63
Identity = 69/120 (57.50%), Postives = 85/120 (70.83%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPY 535
            +  +  +   KL+PLL KWL EADS+S SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KP+A +I SLA+ L LEKEVVRVWFCNRRQKEKR+TP        ++    T P+
Sbjct:  198 ALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEIISLADNLHLEKEVVRVWFCNRRQKEKRMTPPGGALPGSEDVYGDTPPH 317          

HSP 2 Score: 122.865 bits (307), Expect = 1.149e-63
Identity = 57/66 (86.36%), Postives = 59/66 (89.39%), Query Frame = 3
Query:    6 HRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            H     ED P+SDDLEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  141 HHDHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 206          
BLAST of POU domain protein 1 vs. Ensembl Medaka
Match: pou3f2a (POU domain, class 3, transcription factor 2-like [Source:NCBI gene;Acc:111947099])

HSP 1 Score: 142.124 bits (357), Expect = 2.883e-63
Identity = 67/103 (65.05%), Postives = 80/103 (77.67%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPS 484
            +  +  +   KL+PLL KWL EADS+S SPT+ DKI+AQ RKRKKRTSIE  VK  LES F+K  KP A +I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP+
Sbjct:  219 ALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPGAAEINSLADSLQLEKEVVRVWFCNRRQKEKRMTPA 321          

HSP 2 Score: 119.783 bits (299), Expect = 2.883e-63
Identity = 55/60 (91.67%), Postives = 58/60 (96.67%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ED P+SD+LEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  168 EDTPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 227          
BLAST of POU domain protein 1 vs. Ensembl Medaka
Match: pou3f3a (POU domain, class 3, transcription factor 3-B [Source:NCBI gene;Acc:101174234])

HSP 1 Score: 141.739 bits (356), Expect = 4.152e-63
Identity = 67/102 (65.69%), Postives = 81/102 (79.41%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADS++ SPT+ DKI+ Q RKRKKRTSIE +VK  LES F+K  KPSAQ+I+SLA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  208 ALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIATQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEINSLADTLQLEKEVVRVWFCNRRQKEKRMTP 309          

HSP 2 Score: 119.398 bits (298), Expect = 4.152e-63
Identity = 55/60 (91.67%), Postives = 57/60 (95.00%), Query Frame = 3
Query:   24 EDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            ED P+SDDLE FAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  157 EDTPTSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 216          
BLAST of POU domain protein 1 vs. Ensembl Medaka
Match: pou3f3b (POU domain, class 3, transcription factor 3-B [Source:NCBI gene;Acc:101162433])

HSP 1 Score: 145.976 bits (367), Expect = 8.355e-61
Identity = 69/102 (67.65%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
            +  +  +   KL+PLL KWL EADSS+ SPT+ DKI+AQ RKRKKRTSIE +VK  LES F+K  KPSAQ+IS+LA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  287 ALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEISTLADNLQLEKEVVRVWFCNRRQKEKRMTP 388          

HSP 2 Score: 107.457 bits (267), Expect = 8.355e-61
Identity = 50/52 (96.15%), Postives = 51/52 (98.08%), Query Frame = 3
Query:   48 LEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            LEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  244 LEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 295          
BLAST of POU domain protein 1 vs. Planmine SMEST
Match: SMESG000057970.1 (SMESG000057970.1)

HSP 1 Score: 496.893 bits (1278), Expect = 5.538e-175
Identity = 241/253 (95.26%), Postives = 244/253 (96.44%), Query Frame = 2
Query:  170 IRSFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNEDRGDKSLKNPFDNHDKVIKPSGDSNHEATRCSSSKRLKMRKEPDQISINDENGSCHAESSGIVSETHFRQECDNHSICGYNIHDLHESSVLMSDPVSFYPRSFFMKNNIYSSGATPALFDHNQMI 928
              +  +  +   KLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNEDRGDKSLKNPFDNHDKVIKPSGDSNHEATRCSSSKRLKMRKEPDQISINDENGSCHAESSGIVSETHFRQECDNHSICGYNIHDLHESSVLMSDPVSFYPRSFFMKNNIYSSGATPALFDHNQMI
Sbjct:  314 FEALQLSFKNMCKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFDNEVSSTMPYSSTVNEDRGDKSLKNPFDNHDKVIKPSGDSNHEATRCSSSKRLKMRKEPDQISINDENGSCHAESSGIVSETHFRQECDNHSICGYNIHDLHESSVLMSDPVSFYPRSFFMKNNIYSSGATPALFDHNQMI 566          

HSP 2 Score: 143.28 bits (360), Expect = 1.928e-38
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 3
Query:    3 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  258 DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 324          
BLAST of POU domain protein 1 vs. Planmine SMEST
Match: SMESG000008858.1 (SMESG000008858.1)

HSP 1 Score: 110.923 bits (276), Expect = 1.281e-50
Identity = 59/100 (59.00%), Postives = 76/100 (76.00%), Query Frame = 2
Query:  206 KLRPLLQKWLHEADSS-SESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQ 502
            KLRPLL KWL EAD S S +  N +K++ Q+R+RKKRT+IE N K ILESSF K  KP+A  I SL+E++ ++KEVVRVWFCNRRQKEK+ + +  +S Q
Sbjct:  369 KLRPLLSKWLEEADLSLSNTVVNVEKLANQNRQRKKRTNIEMNTKDILESSFNKDPKPTAAHIISLSERILMDKEVVRVWFCNRRQKEKKSSLTKSISRQ 468          

HSP 2 Score: 108.227 bits (269), Expect = 1.281e-50
Identity = 50/53 (94.34%), Postives = 52/53 (98.11%), Query Frame = 3
Query:   45 DLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            +LEQFAK FKQRRIKLG+TQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM
Sbjct:  315 ELEQFAKTFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 367          
BLAST of POU domain protein 1 vs. Planmine SMEST
Match: SMESG000076173.1 (SMESG000076173.1)

HSP 1 Score: 132.494 bits (332), Expect = 5.886e-35
Identity = 63/104 (60.58%), Postives = 76/104 (73.08%), Query Frame = 2
Query:  170 IRSFTVKLQKYVKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 481
              +  +  +   KLRPLL KWL EADS+  +P+  DK++A  RKRKKRTSIE  VK  LES F + SKP+AQ I+ LA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  256 FEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP 359          

HSP 2 Score: 108.612 bits (270), Expect = 2.594e-26
Identity = 50/56 (89.29%), Postives = 55/56 (98.21%), Query Frame = 3
Query:   36 SSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 203
            S+D+LEQFAK+FKQRRIKLG+TQADVGLALG LYG+VFSQTTICRFEALQLSFKNM
Sbjct:  211 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNM 266          
BLAST of POU domain protein 1 vs. Planmine SMEST
Match: SMESG000058834.1 (SMESG000058834.1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.425e-21
Identity = 40/109 (36.70%), Postives = 65/109 (59.63%), Query Frame = 2
Query:  206 KLRPLLQKWLHEADSSSESPTN-FDKISAQ--SRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQK----EKRI---TPSFDVSDQ 502
            K++P+L+KW+ E++    S +N  D  S    ++KRK+RTS       IL   F + S P+  ++ +LA  L+ ++EV+RVWFCN+RQ      KRI   TP+ + ++Q
Sbjct:  387 KIKPILEKWIKESEEKYLSGSNSVDDGSGSDINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQ 495          

HSP 2 Score: 53.5286 bits (127), Expect = 4.425e-21
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 3
Query:   45 DLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFK 197
            ++++FA+ FK RR+ +G TQ  VG AL    G  +SQ+ ICRFE L ++ K
Sbjct:  333 EIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPK 383          
BLAST of POU domain protein 1 vs. Planmine SMEST
Match: SMESG000030759.1 (SMESG000030759.1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.046e-18
Identity = 43/101 (42.57%), Postives = 66/101 (65.35%), Query Frame = 2
Query:  176 SFTVKLQKYVKLRPLLQKWLHEADSSSESPTNF-DKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRI 475
            S T+     + L+P+LQ WL +A++ ++   N  D  S    +++KRTSI  + K  LE+ F    +PS++ I  +AEKL+L+K VVRVWFCN+RQK+KR+
Sbjct:  242 SLTLSHNNMIALKPVLQTWLEDAETEAKERLNGSDAFSDIDERKRKRTSITDSEKRSLEAFFTIQPRPSSEKIIQIAEKLNLKKNVVRVWFCNQRQKQKRM 342          

HSP 2 Score: 66.2402 bits (160), Expect = 5.561e-12
Identity = 36/58 (62.07%), Postives = 43/58 (74.14%), Query Frame = 3
Query:   45 DLEQFAKMFKQRRIKLGYTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNML 206
            +LE FA+ FKQRRIKL  TQADVG ALG L     G++ SQ+TICRFE+L LS  NM+
Sbjct:  195 ELEAFAEWFKQRRIKLRVTQADVGRALGNLKLAGVGSL-SQSTICRFESLTLSHNNMI 251          
The following BLAST results are available for this feature:
BLAST of POU domain protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POU3F25.715e-6568.63POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F49.338e-6560.63POU class 3 homeobox 4 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F32.170e-6458.27POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F32.170e-6458.27POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F13.723e-6466.02POU class 3 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-69.579e-3150.37Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Pr... [more]
ceh-182.991e-2768.52Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
ceh-183.015e-2768.52Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
unc-862.425e-1741.18Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
unc-863.508e-1741.18Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vvl3.363e-6566.67gene:FBgn0086680 transcript:FBtr0345911[more]
vvl3.363e-6566.67gene:FBgn0086680 transcript:FBtr0076944[more]
nub3.121e-4746.09gene:FBgn0085424 transcript:FBtr0112642[more]
nub3.669e-4746.09gene:FBgn0085424 transcript:FBtr0112643[more]
nub3.669e-4746.09gene:FBgn0085424 transcript:FBtr0342628[more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f3a2.536e-6566.67POU class 3 homeobox 3a [Source:NCBI gene;Acc:3038... [more]
pou3f3a3.593e-6566.67POU class 3 homeobox 3a [Source:NCBI gene;Acc:3038... [more]
pou3f3b4.385e-6559.84POU class 3 homeobox 3b [Source:NCBI gene;Acc:3032... [more]
pou3f3a7.834e-6566.67POU class 3 homeobox 3a [Source:NCBI gene;Acc:3038... [more]
pou3f3b2.033e-6467.65POU class 3 homeobox 3b [Source:NCBI gene;Acc:3032... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a383.048e-6558.73solute carrier family 25 member 38 [Source:Xenbase... [more]
pou3f23.103e-6568.63POU class 3 homeobox 2 [Source:NCBI gene;Acc:10048... [more]
tecta.12.509e-6464.08tectorin alpha, gene 1 [Source:Xenbase;Acc:XB-GENE... [more]
pou3f41.003e-6365.71POU class 3 homeobox 4 [Source:NCBI gene;Acc:10003... [more]
POU2F22.405e-4548.21POU class 2 homeobox 2 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pou3f24.148e-6568.63POU domain, class 3, transcription factor 2 [Sourc... [more]
Pou3f47.486e-6560.63POU domain, class 3, transcription factor 4 [Sourc... [more]
Pou3f31.511e-6458.27POU domain, class 3, transcription factor 3 [Sourc... [more]
Pou3f31.511e-6458.27POU domain, class 3, transcription factor 3 [Sourc... [more]
Pou3f12.658e-6466.02POU domain, class 3, transcription factor 1 [Sourc... [more]
back to top
BLAST of POU domain protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31370|POU1_DUGJA4.717e-14781.82POU domain protein 1 OS=Dugesia japonica OX=6161 G... [more]
sp|P31360|PO3F2_MOUSE2.435e-6468.63POU domain, class 3, transcription factor 2 OS=Mus... [more]
sp|P20265|PO3F2_HUMAN2.435e-6468.63POU domain, class 3, transcription factor 2 OS=Hom... [more]
sp|P16241|CF1A_DROME2.497e-6466.67POU domain protein CF1A OS=Drosophila melanogaster... [more]
sp|P70030|P3F2B_XENLA2.761e-6467.65POU domain, class 3, transcription factor 2-B OS=X... [more]
back to top
BLAST of POU domain protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q945511.522e-9279.37POU domain protein OS=Girardia tigrina OX=6162 GN=... [more]
A0A1B6EDS54.699e-6451.32POU domain protein OS=Clastoptera arizonana OX=381... [more]
T1IUA91.070e-6361.40POU domain protein OS=Strigamia maritima OX=126957... [more]
A0A0L8G7422.074e-6366.67POU domain protein OS=Octopus bimaculoides OX=3765... [more]
A0A4W4DP913.274e-6362.18POU domain protein OS=Electrophorus electricus OX=... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f3a1.483e-6555.71POU class 3 homeobox 3 [Source:NCBI gene;Acc:10304... [more]
ENSAMXT00000040961.15.507e-6467.65POU domain, class 3, transcription factor 3-B-like... [more]
ENSAMXT00000041388.17.307e-6467.65POU domain, class 3, transcription factor 3-B-like... [more]
pou3f18.498e-6465.69POU class 3 homeobox 1 [Source:NCBI gene;Acc:30398... [more]
ENSAMXT00000030028.19.363e-6467.65POU domain, class 3, transcription factor 3-B-like... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou2f1b2.122e-4552.48POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pou6f26.805e-2437.36POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pou6f27.330e-2437.36POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000002675.11.006e-2336.96pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 ge... [more]
ENSPMAT00000009070.15.399e-2340.22pep scaffold:Pmarinus_7.0:GL476573:36580:49436:1 g... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of POU domain protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335321.535e-5758.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438811.658e-4751.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309681.804e-4351.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387671.478e-3647.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470332.428e-1844.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of POU domain protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f14.385e-6464.71POU class 3 homeobox 1 [Source:NCBI gene;Acc:10117... [more]
pou3f2b1.149e-6357.50POU domain, class 3, transcription factor 2 [Sourc... [more]
pou3f2a2.883e-6365.05POU domain, class 3, transcription factor 2-like [... [more]
pou3f3a4.152e-6365.69POU domain, class 3, transcription factor 3-B [Sou... [more]
pou3f3b8.355e-6167.65POU domain, class 3, transcription factor 3-B [Sou... [more]
back to top
BLAST of POU domain protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057970.15.538e-17595.26SMESG000057970.1[more]
SMESG000008858.11.281e-5059.00SMESG000008858.1[more]
SMESG000076173.15.886e-3560.58SMESG000076173.1[more]
SMESG000058834.14.425e-2136.70SMESG000058834.1[more]
SMESG000030759.17.046e-1842.57SMESG000030759.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003768 ID=SMED30003768|Name=POU domain protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=951bp
CTGACCATCGCTCGGGGAAAACCGAAGACTTGCCGAGTAGTGATGATTTG
GAACAGTTTGCAAAGATGTTCAAGCAAAGACGCATCAAACTCGGCTACAC
TCAAGCCGATGTTGGACTGGCTTTAGGGACGCTTTATGGAAATGTATTCA
GTCAAACTACGATTTGTCGATTCGAAGCTTTACAGTTAAGCTTCAAAAAT
ATGTTAAACTTCGCCCATTGCTCCAGAAATGGTTGCATGAAGCCGATTCC
AGTTCAGAATCGCCAACAAATTTCGACAAGATTTCGGCCCAGAGTAGAAA
ACGCAAAAAACGGACAAGTATCGAAGCGAATGTAAAACTAATTTTAGAAA
GCAGCTTCATGAAGTTATCTAAACCATCTGCTCAGGATATTAGTTCGTTG
GCAGAGAAATTGAGCTTGGAAAAAGAGGTGGTTAGGGTTTGGTTTTGCAA
TAGGCGACAAAAAGAAAAACGAATCACTCCAAGTTTCGATGTCAGTGATC
AGTTTGACAATGAAGTTAGTTCAACTATGCCATATTCTTCGACAGTCAAT
GAAGATAGAGGCGATAAAAGTTTGAAGAACCCTTTCGACAACCATGATAA
AGTTATTAAACCCTCTGGTGATTCCAATCATGAAGCAACTCGTTGTTCGT
CGTCGAAACGGCTGAAAATGAGAAAAGAACCAGATCAGATTTCAATAAAT
GATGAGAATGGTTCTTGTCACGCGGAATCCTCGGGAATCGTATCCGAAAC
CCATTTTAGACAAGAATGTGATAATCATTCGATTTGCGGCTACAATATCC
ATGATTTACACGAATCTTCCGTCCTCATGTCAGACCCAGTTTCATTTTAT
CCTAGATCATTTTTTATGAAAAATAATATCTATTCTAGTGGCGCTACTCC
GGCTTTGTTTGACCATAATCAAATGATATAAAATATAAATTGTAGAGATC
G
back to top

protein sequence of SMED30003768-orf-1

>SMED30003768-orf-1 ID=SMED30003768-orf-1|Name=SMED30003768-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
DHRSGKTEDLPSSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFS
QTTICRFEALQLSFKNMLNFAHCSRNGCMKPIPVQNRQQISTRFRPRVEN
AKNGQVSKRM*
back to top

protein sequence of SMED30003768-orf-2

>SMED30003768-orf-2 ID=SMED30003768-orf-2|Name=SMED30003768-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITPSFDVSDQFD
NEVSSTMPYSSTVNEDRGDKSLKNPFDNHDKVIKPSGDSNHEATRCSSSK
RLKMRKEPDQISINDENGSCHAESSGIVSETHFRQECDNHSICGYNIHDL
HESSVLMSDPVSFYPRSFFMKNNIYSSGATPALFDHNQMI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013847POU
IPR000327POU_dom
IPR010982Lambda_DNA-bd_dom_sf
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013847POU domainPRINTSPR00028POUDOMAINcoord: 99..111
score: 42.36
coord: 27..44
score: 79.22
coord: 50..63
score: 89.58
coord: 66..81
score: 71.09
IPR000327POU-specific domainSMARTSM00352poucoord: 8..82
e-value: 1.5E-51
score: 187.2
IPR000327POU-specific domainPFAMPF00157Poucoord: 13..82
e-value: 5.6E-39
score: 132.0
IPR000327POU-specific domainPROSITEPS00035POU_1coord: 26..38
IPR000327POU-specific domainPROSITEPS00465POU_2coord: 50..63
IPR000327POU-specific domainPROSITEPS51179POU_3coord: 8..82
score: 56.819
IPR010982Lambda repressor-like, DNA-binding domain superfamilyGENE3DG3DSA:1.10.260.40coord: 12..82
e-value: 2.3E-42
score: 144.8
IPR010982Lambda repressor-like, DNA-binding domain superfamilySUPERFAMILYSSF47413lambda repressor-like DNA-binding domainscoord: 14..82
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..94
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..111
NoneNo IPR availablePANTHERPTHR11636:SF118POU DOMAIN, CLASS 3, TRANSCRIPTION FACTOR 3coord: 2..111
NoneNo IPR availablePANTHERPTHR11636POU DOMAINcoord: 2..111