N-alpha-acetyltransferase 40

Overview
NameN-alpha-acetyltransferase 40
Smed IDSMED30003764
Length (bp)811
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-alpha-acetyltransferase 40 (SMED30003764) t-SNE clustered cells

Violin plots show distribution of expression levels for N-alpha-acetyltransferase 40 (SMED30003764) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-alpha-acetyltransferase 40 (SMED30003764) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-alpha-acetyltransferase 40 (SMED30003764) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003764

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30003764SMESG000077166.1 SMED30003764smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30003764SMESG000077166.1 SmedASXL_006775SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003764SMESG000077166.1 SmedASXL_006775SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30003764SMESG000077166.1 dd_Smed_v4_5816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003764SMESG000077166.1 dd_Smed_v4_5816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003764SMESG000077166.1 dd_Smed_v4_5816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003764SMESG000077166.1 dd_Smed_v4_5816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003764SMESG000077166.1 dd_Smed_v4_5816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003764SMESG000077166.1 dd_Smed_v4_5816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003764SMESG000077166.1 Contig41011uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003764SMESG000077166.1 Contig41011newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
ovarySMED30003764SMESG000077166.1 DN298385ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30003764SMESG000077166.1 DN298385ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30003764SMESG000077166.1 dd_Smed_v6_5816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30003764SMESG000077166.1 dd_Smed_v4_5816_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003764SMESG000077166.1 SMED_10477_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30003764SMESG000077166.1 SMED_10477_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30003764SMESG000077166.1 SmWIOct06_031585GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30003764SMESG000077166.1 SMED_10477_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30003764SMESG000077166.1 SMED_10477_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Human
Match: NAA40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:HGNC Symbol;Acc:HGNC:25845])

HSP 1 Score: 126.716 bits (317), Expect = 4.485e-35
Identity = 75/193 (38.86%), Postives = 111/193 (57.51%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC +   +     +  F++ + NM+ MY+ S WGW   +K++E+ +  + +++    + S    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID + PS +G    D  Y I+S
Sbjct:    8 VDAANRLGDPL----EAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLI--AWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILS 194          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Human
Match: NAA40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:HGNC Symbol;Acc:HGNC:25845])

HSP 1 Score: 126.716 bits (317), Expect = 8.064e-35
Identity = 75/193 (38.86%), Postives = 111/193 (57.51%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC +   +     +  F++ + NM+ MY+ S WGW   +K++E+ +  + +++    + S    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID + PS +G    D  Y I+S
Sbjct:   29 VDAANRLGDPL----EAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLI--AWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Celegans
Match: Y38A10A.7 (pep chromosome:WBcel235:V:6096197:6097093:1 gene:WBGene00021392.1 transcript:Y38A10A.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38A10A.7)

HSP 1 Score: 103.605 bits (257), Expect = 8.501e-27
Identity = 55/150 (36.67%), Postives = 84/150 (56.00%), Query Frame = 1
Query:  253 MSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMS 702
            +SD D    F + ++NM  MY  S WG+  N K+ EL  + SRFI+ +   G +    +  +RF  D+N PV YC+E+Q+    +  G+G  +++    L+ KT+M K+M TVF +N   L FF K G+  D T PS +    +DY I+S
Sbjct:   47 LSDEDFEWVFSLFKENMYDMYHKSQWGYDENSKRNELRATTSRFIIAKNSKGDKI--GYTTYRFVVDHNIPVAYCWELQIVPAYQNKGIGGMMLDTLEKLSSKTNMSKVMATVFLYNGPSLGFFHKHGYNSDVTCPSDDS--GLDYAILS 192          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Fly
Match: Naa40 (gene:FBgn0039687 transcript:FBtr0085461)

HSP 1 Score: 92.4337 bits (228), Expect = 1.591e-22
Identity = 65/193 (33.68%), Postives = 102/193 (52.85%), Query Frame = 1
Query:  127 ENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIEC-FKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMS 702
            +  V +A    NPL  L   +Q +K+      F++ C  KSD  S L K + F++ E N+   YK    GW    K  EL  + +R++V +  +  ++  A+  FRF+ D+ D VLYCYE+Q+ ++ R+ GLG F+M      A+   + K+MLTV  +NE  + FFK+ G+  D   P  + +   DY I S
Sbjct:   13 QRFVETAARAKNPLESL--SYQSYKAPSGEE-FKLICRAKSDADSKLLKWA-FKLAETNVGPYYKQLKMGWQPKIKAAELNKNWARYLVAQ--NEKKENVAYAMFRFDMDHGDCVLYCYEMQVAAEYRRKGLGKFIMSTLEDCARLWHLEKVMLTVLNNNEASISFFKQLGYVKDEISP--DVLEQADYQIFS 197          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Zebrafish
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) [Source:NCBI gene;Acc:550325])

HSP 1 Score: 131.339 bits (329), Expect = 7.721e-37
Identity = 76/193 (39.38%), Postives = 112/193 (58.03%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL  +     +FK  D+N L  +IEC +   +S       +E+   NM+ +Y+ S WGW   +K++E+ +  + +++ R  D +    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID T PS +G    D  Y I+S
Sbjct:   29 VDAANKLEDPLSAMP----VFKKYDRNGLNLQIECKRVTALSPDTVEWAYELTRANMQTLYEQSEWGWKEREKREEMKDERAWYLLARDADST--PLAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLIANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDETSPSMSGCCGEDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Zebrafish
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) [Source:NCBI gene;Acc:550325])

HSP 1 Score: 92.0485 bits (227), Expect = 5.988e-23
Identity = 49/96 (51.04%), Postives = 62/96 (64.58%), Query Frame = 1
Query:  424 AFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID T PS +G    D  Y I+S
Sbjct:   20 AFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLIANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDETSPSMSGCCGEDCSYEILS 115          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Zebrafish
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) [Source:NCBI gene;Acc:550325])

HSP 1 Score: 64.6994 bits (156), Expect = 7.159e-13
Identity = 37/114 (32.46%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLY 474
            V +AN L +PL  +     +FK  D+N L  +IEC +   +S       +E+   NM+ +Y+ S WGW   +K++E+ +  + +++ R  D +    AF HFRF+ +  D VLY
Sbjct:    8 VDAANKLEDPLSAM----PVFKKYDRNGLNLQIECKRVTALSPDTVEWAYELTRANMQTLYEQSEWGWKEREKREEMKDERAWYLLARDADST--PLAFSHFRFDVECGDEVLY 115          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Zebrafish
Match: naa40 (N-alpha-acetyltransferase 40-like [Source:NCBI gene;Acc:101882407])

HSP 1 Score: 64.3142 bits (155), Expect = 1.748e-12
Identity = 37/114 (32.46%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLY 474
            V +AN L +PL  +     +FK  D+N L  +IEC +   +S       +E+   NM+ +Y+ S WGW   +K++E+ +  + +++ R  D +    AF HFRF+ +  D VLY
Sbjct:   29 VDAANKLEDPLSAMP----VFKKYDRNGLNLQIECKRVTALSPDTVEWAYELTRANMQTLYEQSEWGWKEREKREEMKDERAWYLLARDADST--PLAFSHFRFDVECGDEVLY 136          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Xenopus
Match: abcf2 (ATP binding cassette subfamily F member 2 [Source:Xenbase;Acc:XB-GENE-959633])

HSP 1 Score: 133.265 bits (334), Expect = 2.512e-37
Identity = 78/193 (40.41%), Postives = 112/193 (58.03%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFK-KFGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC K  D+     +  FE+ + NM+ +Y+ S WGW   +K++EL +  + +++ R  D      AFVHFRF+ +  D VLYCYE+QL + VR+ G+G FL++    +A  T M K++LTVFKHN    +FF+    FEID T PS +G    D  Y I+S
Sbjct:   29 VQAANQLGDPL----SAFPVFKKFDRNGLNLSIECCKVSDLDQKTIDWAFELTKTNMQLLYEQSEWGWKEREKREELTDERAWYLIAR--DELAAPVAFVHFRFDVECGDEVLYCYEVQLETHVRRKGVGKFLVQILQLMANSTQMKKVVLTVFKHNHGAYQFFRDALQFEIDETSPSVSGCCSDDCTYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Xenopus
Match: abcf2 (ATP binding cassette subfamily F member 2 [Source:Xenbase;Acc:XB-GENE-959633])

HSP 1 Score: 133.265 bits (334), Expect = 2.512e-37
Identity = 78/193 (40.41%), Postives = 112/193 (58.03%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFK-KFGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC K  D+     +  FE+ + NM+ +Y+ S WGW   +K++EL +  + +++ R  D      AFVHFRF+ +  D VLYCYE+QL + VR+ G+G FL++    +A  T M K++LTVFKHN    +FF+    FEID T PS +G    D  Y I+S
Sbjct:   29 VQAANQLGDPL----SAFPVFKKFDRNGLNLSIECCKVSDLDQKTIDWAFELTKTNMQLLYEQSEWGWKEREKREELTDERAWYLIAR--DELAAPVAFVHFRFDVECGDEVLYCYEVQLETHVRRKGVGKFLVQILQLMANSTQMKKVVLTVFKHNHGAYQFFRDALQFEIDETSPSVSGCCSDDCTYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Mouse
Match: Naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:MGI Symbol;Acc:MGI:1918249])

HSP 1 Score: 126.331 bits (316), Expect = 6.705e-35
Identity = 75/193 (38.86%), Postives = 111/193 (57.51%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC +   +     +  F++ + NM+ MY+ S WGW   +K++E+ +  + +++    + S    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID + PS +G    D  Y I+S
Sbjct:   29 VDAANRLGDPL----EAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLI--AWENSSIPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Mouse
Match: Naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:MGI Symbol;Acc:MGI:1918249])

HSP 1 Score: 116.316 bits (290), Expect = 1.932e-31
Identity = 64/166 (38.55%), Postives = 97/166 (58.43%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK 630
            V +AN L +PL      F +FK  D+N L   IEC +   +     +  F++ + NM+ MY+ S WGW   +K++E+ +  + +++    + S    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++
Sbjct:   29 VDAANRLGDPL----EAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLI--AWENSSIPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFRE 188          
BLAST of N-alpha-acetyltransferase 40 vs. UniProt/SwissProt
Match: sp|Q6NUH2|NAA40_XENLA (N-alpha-acetyltransferase 40 OS=Xenopus laevis OX=8355 GN=naa40 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 5.850e-37
Identity = 78/193 (40.41%), Postives = 113/193 (58.55%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFK-KFGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC K  D+     +  FE+ + NM+ +Y+ S WGW   +K++EL +  + +++ R  D    + AFVHFRF+ +  D VLYCYE+QL + VR+ G+G FL++    +A  T M K++LTVFKHN    +FF+    FEID T PS +G    D  Y I+S
Sbjct:   29 VQAANQLGDPL----GAFPVFKKFDRNGLNLSIECCKVSDLDQKTIDWAFELTKTNMQLLYEQSEWGWKEREKREELTDERAWYLIAR--DELAALVAFVHFRFDVECGDEVLYCYEVQLETRVRRKGVGKFLVQILQLMANSTQMKKVVLTVFKHNHGAYQFFRDALQFEIDETSPSVSGCCSDDCTYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. UniProt/SwissProt
Match: sp|Q568K5|NAA40_DANRE (N-alpha-acetyltransferase 40 OS=Danio rerio OX=7955 GN=naa40 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 5.828e-36
Identity = 76/193 (39.38%), Postives = 112/193 (58.03%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL  +     +FK  D+N L  +IEC +   +S       +E+   NM+ +Y+ S WGW   +K++E+ +  + +++ R  D +    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID T PS +G    D  Y I+S
Sbjct:   29 VDAANKLEDPLSAMP----VFKKYDRNGLNLQIECKRVTALSPDTVEWAYELTRANMQTLYEQSEWGWKEREKREEMKDERAWYLLARDADST--PLAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLIANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDETSPSMSGCCGEDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. UniProt/SwissProt
Match: sp|Q86UY6|NAA40_HUMAN (N-alpha-acetyltransferase 40 OS=Homo sapiens OX=9606 GN=NAA40 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.873e-34
Identity = 75/193 (38.86%), Postives = 111/193 (57.51%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC +   +     +  F++ + NM+ MY+ S WGW   +K++E+ +  + +++    + S    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID + PS +G    D  Y I+S
Sbjct:   29 VDAANRLGDPL----EAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLI--AWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. UniProt/SwissProt
Match: sp|Q8VE10|NAA40_MOUSE (N-alpha-acetyltransferase 40 OS=Mus musculus OX=10090 GN=Naa40 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.690e-34
Identity = 75/193 (38.86%), Postives = 111/193 (57.51%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC +   +     +  F++ + NM+ MY+ S WGW   +K++E+ +  + +++    + S    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID + PS +G    D  Y I+S
Sbjct:   29 VDAANRLGDPL----EAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLI--AWENSSIPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. UniProt/SwissProt
Match: sp|Q9USH6|NAA40_SCHPO (N-alpha-acetyltransferase 40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa40 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.813e-12
Identity = 48/168 (28.57%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  211 KNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSK-----NGVFDVDYIIM 699
            KNL   +E +   +   L +  CF +++KNM+ +Y+ S++GW  ++K KE+      +I C     S+++  F+ F    +     LY YEIQL   +R   +G +L++    LA + ++  + LTVF  N   L F+  F F    + P +       V   DY I+
Sbjct:   32 KNLGVWVEIYHHLEKGLLQQ--CFNLVKKNMEALYRQSSFGWDDSEKLKEMEMEKLEYI-CIFEKTSKKLVGFLSFEDTVEAGLTCLYIYEIQLDEHIRGRNVGKWLLKNASILAYRRNLKYIFLTVFSANLNALNFYHHFDFVPHESSPQEKKFRSGKVIHPDYYIL 196          
BLAST of N-alpha-acetyltransferase 40 vs. TrEMBL
Match: A0A3L8DAF6 (N-acetyltransferase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_010917 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 8.273e-40
Identity = 80/197 (40.61%), Postives = 121/197 (61.42%), Query Frame = 1
Query:  112 KNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMS 702
            K    + L+  AN L NPL +L   F  + + D N   ++ C ++ +         F+I+E+NMK MY+ ++WGW+A++K+ EL    S ++V    D   +   F HFRF+ D  D VLYCYE+QL   VR+ GLG F+M A  ++A++T MLK++LTVFKHN + ++FF   GF++D T PS   + +VDYII+S
Sbjct:   16 KAAAQQQLINKANALANPLEKL-QKFHEYTTKD-NCTVKLSCIRARNAEPECLFWVFDIMERNMKSMYEQTSWGWNADEKQAELTEETSWYLVASCND---KYLGFSHFRFDVDNGDIVLYCYELQLEPLVRRKGLGRFMMLALESVARQTQMLKIVLTVFKHNPSAIQFFYALGFKLDSTSPS--ALANVDYIILS 205          
BLAST of N-alpha-acetyltransferase 40 vs. TrEMBL
Match: A0A088A0H8 (N-acetyltransferase domain-containing protein OS=Apis mellifera OX=7460 GN=LOC725628 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.219e-38
Identity = 78/201 (38.81%), Postives = 118/201 (58.71%), Query Frame = 1
Query:  112 KNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD 714
            K    +NLV  AN + NP+  L   F  + + D N +  + C ++ D      +  F+I+E+NMK +Y+ SNWGW    K+KEL  S + +++  + D   +   F HFRF+ DY + VLYCYEIQL   +R+ GLG F+M A  ++A +  M K++LTVFKHN + + FF   G++ID T P  +    +DYII+S  +D
Sbjct:   14 KEAIAKNLVDKANSVKNPIEHL-HFFHKYITKD-NEIIELSCMRAKDADSKCISWIFDIMERNMKSLYEQSNWGWDPIAKQKELTESTAWYLIASSND---KFVGFSHFRFDVDYREEVLYCYEIQLEYTIRRKGLGHFMMFALESMASENKMRKVILTVFKHNPSAMHFFYSLGYKIDKTSPPASD--QLDYIILSKAVD 207          
BLAST of N-alpha-acetyltransferase 40 vs. TrEMBL
Match: E2C819 (N-acetyltransferase 11 OS=Harpegnathos saltator OX=610380 GN=EAI_02603 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 6.526e-38
Identity = 72/197 (36.55%), Postives = 117/197 (59.39%), Query Frame = 1
Query:  112 KNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMS 702
            K    + L+  AN L NPL  ++P+F  + + D   + +I C ++ +     ++  F+I E+N+K MYK S+WGW A +K+ EL    + +++    D   +   F HFRF+ D+ D VLYCYE+QL   +R+ GLG F+M A  ++A +  M K++LTVF HN T ++FF   G+++D T P  +    +DY+I+S
Sbjct:   16 KTAAQQLLINKANALMNPL-DILPEFHEYVTKDD--VIKISCIRAKNAQPECRSWIFDITERNVKDMYKQSSWGWDAAEKQAELTEETAWYLIASRDD---KFLGFSHFRFDIDHGDVVLYCYELQLEPSIRRRGLGRFMMSALESMASRNQMQKVVLTVFAHNPTAIQFFFALGYKLDHTSPPASA--KLDYMILS 204          
BLAST of N-alpha-acetyltransferase 40 vs. TrEMBL
Match: A0A2A3ERY8 (N-acetyltransferase OS=Apis cerana cerana OX=94128 GN=APICC_06587 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.909e-38
Identity = 78/201 (38.81%), Postives = 118/201 (58.71%), Query Frame = 1
Query:  112 KNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD 714
            K    +NLV  AN + NP+  L   F  + + D N +  + C ++ D      +  F+I+E+NMK +Y+ SNWGW    K+KEL  S + +++  + D   +   F HFRF+ DY + VLYCYEIQL   +R+ GLG F+M A  ++A +  M K++LTVFKHN + + FF   G++ID T P  +    +DYII+S  +D
Sbjct:   20 KEAIAKNLVDKANSVKNPIEHL-HFFHKYITKD-NEIIELSCMRAKDADSKCISWIFDIMERNMKSLYEQSNWGWDPIAKQKELTESTAWYLIASSND---KFVGFSHFRFDVDYREEVLYCYEIQLEYTIRRKGLGHFIMFALESIASENKMRKVILTVFKHNPSAMHFFYSLGYKIDKTSPPASD--QLDYIILSKAVD 213          
BLAST of N-alpha-acetyltransferase 40 vs. TrEMBL
Match: A0A0M8ZT47 (N-alpha-acetyltransferase 40 OS=Melipona quadrifasciata OX=166423 GN=WN51_04820 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.599e-37
Identity = 81/201 (40.30%), Postives = 116/201 (57.71%), Query Frame = 1
Query:  112 KNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD 714
            K     +LV  AN + NPL  L   F  + + D N    + C K+ D         F+I+E+NMK +Y+ S+WGW    K+KEL    + ++V  + D   +   F HFRF+ DY + VLYCYEIQL S VR+ GLG F+M A  ++A K  M K++LTV KHN + ++FF   G++ID T PS +    +DYII+S  +D
Sbjct:   14 KEAIARSLVDKANSVKNPLESL-NFFHKYVTKD-NQTIELSCVKAKDAQSKCIFWIFDIMERNMKSLYEQSDWGWDPVAKQKELTEPTAWYLVATSND---KFVGFSHFRFDIDYREEVLYCYEIQLESAVRRKGLGHFMMSALESMASKNKMRKVILTVLKHNPSAMQFFYSLGYKIDKTSPSTSD--QLDYIILSKAVD 207          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Cavefish
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:NCBI gene;Acc:103028030])

HSP 1 Score: 133.265 bits (334), Expect = 1.395e-37
Identity = 77/193 (39.90%), Postives = 112/193 (58.03%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC +   +S +     +E+   NM+ +Y+ S WGW   +K++E+ +  + +++ R  D +    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID T PS +G    D  Y I+S
Sbjct:   26 VDAANKLDDPLAA----FPVFKKYDRNGLNLEIECKRVATLSPITVEWAYELTRSNMQTLYEQSEWGWKEREKREEMKDERAWYLLARDTDST--PVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLIANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDTSPSMSGCCGDDCSYEILS 212          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Cavefish
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:NCBI gene;Acc:103028030])

HSP 1 Score: 133.265 bits (334), Expect = 1.524e-37
Identity = 77/193 (39.90%), Postives = 112/193 (58.03%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F +FK  D+N L   IEC +   +S +     +E+   NM+ +Y+ S WGW   +K++E+ +  + +++ R  D +    AF HFRF+ +  D VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FEID T PS +G    D  Y I+S
Sbjct:   29 VDAANKLDDPLAA----FPVFKKYDRNGLNLEIECKRVATLSPITVEWAYELTRSNMQTLYEQSEWGWKEREKREEMKDERAWYLLARDTDST--PVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLIANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDTSPSMSGCCGDDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Nematostella
Match: EDO32371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV95])

HSP 1 Score: 120.553 bits (301), Expect = 2.652e-33
Identity = 68/181 (37.57%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  133 LVASANLLYNPLLQLVPDFQLFKSMDKN-LLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYN-DPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFK-KFGFEIDPTDPSK 666
            LV +AN L NP   L+     F+  ++N L   I C +  +M   D +  F++ ++NM+ +Y+ S+WGW+  +K++E+ +  + +++ R   G RQ  A   FRFE D N + V+YCYEIQ+   ++  G+G FLM+    +  K SM K++LTVFK N  G +FF     +EID T PSK
Sbjct:   16 LVDAANKLENPFEPLI----AFRKYNRNGLELEIACQRVTEMKAEDVDWAFDLTKRNMETLYEESDWGWNDKRKREEMTDDNAWYLIARNSQGGRQ--ALCEFRFELDENMEEVIYCYEIQIEPSLQHKGVGKFLMQILELIGHKCSMKKIVLTVFKENTVGYKFFTDSLKYEIDETAPSK 190          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Medaka
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:NCBI gene;Acc:101172283])

HSP 1 Score: 136.346 bits (342), Expect = 1.033e-38
Identity = 77/193 (39.90%), Postives = 112/193 (58.03%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKK-FGFEIDPTDPSKNGVF--DVDYIIMS 702
            V +AN L +PL      F  FK  D+N L  +IEC +   ++ L     FE+   NM+ +Y+ S WGW   +K+ E+++  + +++ R  D S    AF HFRF+ +  + VLYCYE+QL S VR+ GLG FL++    +A  T M K+MLTVFKHN    +FF++   FE+D T PS +G    D  Y I+S
Sbjct:   29 VDAANKLEDPL----SSFPAFKKYDRNGLNLQIECRRVTSLNPLSVEWAFELTRANMQALYEQSEWGWKEREKRDEMYDERAWYLLARDSDSS--PVAFCHFRFDVECGEEVLYCYEVQLESKVRRKGLGKFLIQILQLIANSTQMKKVMLTVFKHNHGAFQFFREALQFEVDETSPSMSGCCGDDCSYEILS 215          
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Medaka
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:NCBI gene;Acc:101172283])

HSP 1 Score: 97.4413 bits (241), Expect = 8.052e-24
Identity = 53/146 (36.30%), Postives = 83/146 (56.85%), Query Frame = 1
Query:  136 VASANLLYNPLLQLVPDFQLFKSMDKNLL-FRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSM 570
            V +AN L +PL      F  FK  D+N L  +IEC +   ++ L     FE+   NM+ +Y+ S WGW   +K+ E+++  + +++ R  D S    AF HFRF+ +  + VLYCYE+QL S VR+ GLG FL++    +A +  +
Sbjct:   29 VDAANKLEDPL----SSFPAFKKYDRNGLNLQIECRRVTSLNPLSVEWAFELTRANMQALYEQSEWGWKEREKRDEMYDERAWYLLARDSDSS--PVAFCHFRFDVECGEEVLYCYEVQLESKVRRKGLGKFLIQILQLIANRARI 168          
BLAST of N-alpha-acetyltransferase 40 vs. Planmine SMEST
Match: SMESG000077166.1 (SMESG000077166.1)

HSP 1 Score: 441.425 bits (1134), Expect = 3.535e-159
Identity = 215/215 (100.00%), Postives = 215/215 (100.00%), Query Frame = 1
Query:   70 MMDTDDNEIEEFLIKNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD 714
            MMDTDDNEIEEFLIKNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD
Sbjct:    1 MMDTDDNEIEEFLIKNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD 215          
BLAST of N-alpha-acetyltransferase 40 vs. Planmine SMEST
Match: SMESG000077166.1 (SMESG000077166.1)

HSP 1 Score: 439.113 bits (1128), Expect = 2.679e-158
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 1
Query:   73 MDTDDNEIEEFLIKNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD 714
            MDTDDNEIEEFLIKNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD
Sbjct:    1 MDTDDNEIEEFLIKNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNLLFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFNSLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGLGSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKNGVFDVDYIIMSIFLD 214          
The following BLAST results are available for this feature:
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NAA404.485e-3538.86N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
NAA408.064e-3538.86N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y38A10A.78.501e-2736.67pep chromosome:WBcel235:V:6096197:6097093:1 gene:W... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Naa401.591e-2233.68gene:FBgn0039687 transcript:FBtr0085461[more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
naa407.721e-3739.38N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa405.988e-2351.04N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa407.159e-1332.46N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa401.748e-1232.46N-alpha-acetyltransferase 40-like [Source:NCBI gen... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
abcf22.512e-3740.41ATP binding cassette subfamily F member 2 [Source:... [more]
abcf22.512e-3740.41ATP binding cassette subfamily F member 2 [Source:... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Naa406.705e-3538.86N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
Naa401.932e-3138.55N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NUH2|NAA40_XENLA5.850e-3740.41N-alpha-acetyltransferase 40 OS=Xenopus laevis OX=... [more]
sp|Q568K5|NAA40_DANRE5.828e-3639.38N-alpha-acetyltransferase 40 OS=Danio rerio OX=795... [more]
sp|Q86UY6|NAA40_HUMAN3.873e-3438.86N-alpha-acetyltransferase 40 OS=Homo sapiens OX=96... [more]
sp|Q8VE10|NAA40_MOUSE4.690e-3438.86N-alpha-acetyltransferase 40 OS=Mus musculus OX=10... [more]
sp|Q9USH6|NAA40_SCHPO1.813e-1228.57N-alpha-acetyltransferase 40 OS=Schizosaccharomyce... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L8DAF68.273e-4040.61N-acetyltransferase domain-containing protein OS=O... [more]
A0A088A0H86.219e-3838.81N-acetyltransferase domain-containing protein OS=A... [more]
E2C8196.526e-3836.55N-acetyltransferase 11 OS=Harpegnathos saltator OX... [more]
A0A2A3ERY88.909e-3838.81N-acetyltransferase OS=Apis cerana cerana OX=94128... [more]
A0A0M8ZT471.599e-3740.30N-alpha-acetyltransferase 40 OS=Melipona quadrifas... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naa401.395e-3739.90N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa401.524e-3739.90N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO323712.652e-3337.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naa401.033e-3839.90N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa408.052e-2436.30N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase 40 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077166.13.535e-159100.00SMESG000077166.1[more]
SMESG000077166.12.679e-158100.00SMESG000077166.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003764 ID=SMED30003764|Name=N-alpha-acetyltransferase 40|organism=Schmidtea mediterranea sexual|type=transcript|length=811bp
GTTATAAAGGAGCTTTGTTTAAAAATAACCTTGAAATTTAAAATAATTGT
GTAAATCTTATTTATAAAGATGATGGACACAGATGACAATGAAATCGAAG
AATTTTTAATTAAAAATGTCACTCCTGAGAATTTAGTTGCTTCAGCTAAT
TTACTGTACAATCCACTCCTTCAATTAGTTCCCGATTTTCAATTATTTAA
AAGCATGGATAAGAATTTACTTTTCAGAATTGAATGCTTCAAATCAGACG
ATATGTCAGATTTGGATAAAAATTCTTGTTTTGAAATTATCGAAAAAAAC
ATGAAAAAAATGTATAAAATTTCAAATTGGGGATGGAGTGCCAATAAAAA
GAAAAAAGAATTATTTAATTCTCTTTCTCGTTTTATAGTTTGTCGAACCG
TAGATGGATCTAGACAGATTAAAGCCTTTGTTCATTTTCGCTTTGAAACT
GATTATAATGATCCCGTATTGTATTGTTATGAAATTCAGTTATGTTCAGA
CGTGAGAAAATGTGGTCTAGGTTCTTTTCTCATGGAAGCTCAGTTGGCAT
TAGCTAAGAAAACCAGTATGCTTAAATTAATGCTAACGGTATTCAAGCAT
AATGAAACCGGATTGAGGTTCTTTAAAAAATTCGGGTTCGAAATCGATCC
AACTGATCCTTCGAAAAACGGCGTTTTTGATGTTGATTATATAATAATGT
CAATTTTTCTTGATTAATTAGTTTTAATTCATTTTTTATTCTGTTTACTA
TTTTAAAGTAGTGCATTTATTTTTAATGAAATCTCGGTGTATATTTTTCT
GAAAAAGTTAA
back to top

protein sequence of SMED30003764-orf-1

>SMED30003764-orf-1 ID=SMED30003764-orf-1|Name=SMED30003764-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
MMDTDDNEIEEFLIKNVTPENLVASANLLYNPLLQLVPDFQLFKSMDKNL
LFRIECFKSDDMSDLDKNSCFEIIEKNMKKMYKISNWGWSANKKKKELFN
SLSRFIVCRTVDGSRQIKAFVHFRFETDYNDPVLYCYEIQLCSDVRKCGL
GSFLMEAQLALAKKTSMLKLMLTVFKHNETGLRFFKKFGFEIDPTDPSKN
GVFDVDYIIMSIFLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039949NAA40
IPR016181Acyl_CoA_acyltransferase
IPR000182GNAT_dom
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006474N-terminal protein amino acid acetylation
GO:0043967histone H4 acetylation
GO:0043968histone H2A acetylation
Vocabulary: molecular function
TermDefinition
GO:0010485H4 histone acetyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0043998H2A histone acetyltransferase activity
GO:1990189peptide-serine-N-acetyltransferase activity
GO:0008080N-acetyltransferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000182GNAT domainPFAMPF00583Acetyltransf_1coord: 117..190
e-value: 5.8E-6
score: 26.5
IPR000182GNAT domainPROSITEPS51186GNATcoord: 68..215
score: 11.92
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 40..212
e-value: 1.1E-46
score: 160.6
IPR039949N-alpha-acetyltransferase 40PANTHERPTHR20531FAMILY NOT NAMEDcoord: 20..211
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 66..214