Vang-3

Overview
NameVang-3
Smed IDSMED30003750
Length (bp)3017
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vang-3 (SMED30003750) t-SNE clustered cells

Violin plots show distribution of expression levels for Vang-3 (SMED30003750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vang-3 (SMED30003750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vang-3 (SMED30003750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Vang-3 vs. Ensembl Human
Match: VANGL2 (VANGL planar cell polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:15511])

HSP 1 Score: 122.865 bits (307), Expect = 1.530e-28
Identity = 64/168 (38.10%), Postives = 103/168 (61.31%), Query Frame = 3
Query: 2271 ASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            A E+AF ++ R  E  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L+ GP ++   Y ++ ++       W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQKNPR-EVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQ---YHKERWL----AKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 74.3294 bits (181), Expect = 6.024e-13
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L ++ +R Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y     S+Q  A+ IL+ Y  DF VYNP
Sbjct:  200 YGVRIL-DARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQ-FTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNP 288          
BLAST of Vang-3 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 114.39 bits (285), Expect = 8.227e-26
Identity = 67/171 (39.18%), Postives = 98/171 (57.31%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R     +  +  +++   EAAQAIF ++ + LQK+LR TRQQ   SME ++ HL  C+   +  +AFLE +LS GP L+   Y +  ++     T W L SD  V+  + DG VF L   D SL   VK +P   L+EE    K +KF+ +L SETSV
Sbjct:  359 LVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQ---YDKDRWLS----TQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 522          

HSP 2 Score: 76.2554 bits (186), Expect = 1.516e-13
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L +S  R Y   V  A  + D LL +HYL +V++ LR++      ++V+R  DGE++ Y     S+Q AA+ +L+NY  DF +YNP
Sbjct:  202 YGVRIL-DSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNP 290          
BLAST of Vang-3 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 114.39 bits (285), Expect = 8.755e-26
Identity = 67/171 (39.18%), Postives = 98/171 (57.31%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R     +  +  +++   EAAQAIF ++ + LQK+LR TRQQ   SME ++ HL  C+   +  +AFLE +LS GP L+   Y +  ++     T W L SD  V+  + DG VF L   D SL   VK +P   L+EE    K +KF+ +L SETSV
Sbjct:  361 LVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQ---YDKDRWLS----TQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          

HSP 2 Score: 76.2554 bits (186), Expect = 1.498e-13
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L +S  R Y   V  A  + D LL +HYL +V++ LR++      ++V+R  DGE++ Y     S+Q AA+ +L+NY  DF +YNP
Sbjct:  204 YGVRIL-DSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNP 292          
BLAST of Vang-3 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 114.39 bits (285), Expect = 8.755e-26
Identity = 67/171 (39.18%), Postives = 98/171 (57.31%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R     +  +  +++   EAAQAIF ++ + LQK+LR TRQQ   SME ++ HL  C+   +  +AFLE +LS GP L+   Y +  ++     T W L SD  V+  + DG VF L   D SL   VK +P   L+EE    K +KF+ +L SETSV
Sbjct:  361 LVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQ---YDKDRWLS----TQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          

HSP 2 Score: 76.2554 bits (186), Expect = 1.498e-13
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L +S  R Y   V  A  + D LL +HYL +V++ LR++      ++V+R  DGE++ Y     S+Q AA+ +L+NY  DF +YNP
Sbjct:  204 YGVRIL-DSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNP 292          
BLAST of Vang-3 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 114.39 bits (285), Expect = 8.755e-26
Identity = 67/171 (39.18%), Postives = 98/171 (57.31%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R     +  +  +++   EAAQAIF ++ + LQK+LR TRQQ   SME ++ HL  C+   +  +AFLE +LS GP L+   Y +  ++     T W L SD  V+  + DG VF L   D SL   VK +P   L+EE    K +KF+ +L SETSV
Sbjct:  361 LVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQ---YDKDRWLS----TQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          

HSP 2 Score: 76.2554 bits (186), Expect = 1.498e-13
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L +S  R Y   V  A  + D LL +HYL +V++ LR++      ++V+R  DGE++ Y     S+Q AA+ +L+NY  DF +YNP
Sbjct:  204 YGVRIL-DSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNP 292          
BLAST of Vang-3 vs. Ensembl Celegans
Match: vang-1 (Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q95ZZ6])

HSP 1 Score: 80.8777 bits (198), Expect = 2.117e-15
Identity = 87/369 (23.58%), Postives = 143/369 (38.75%), Query Frame = 3
Query: 1689 VKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNA--KLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLS-QGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSR----NIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            V ++R PDGE         S+Q AA +IL+ Y   F  +N  ++   +     +                              G  GG A +K Y+++       ++ ++ R+L   ++        RR+                +M+           RK                            L+ A+EDAF ++    E+  N        + +  AAQ +F+ +++PL K+L+TTR Q R     V  H+  CL   L +R FL+ F S + P  E  G  +   I DE V+S + +   LV +    +I  G         + L CT+ S+P FNLTE+  P    KF  K+ +E++V
Sbjct:  247 VTIVRDPDGEMHTLNIGAGSIQEAATEILRFYTTRFSSFNIHLDNARQTAVAKQS-----------------------------GMQGGTAGFKMYNIEQFGGQETVSEVNTRALMEAAA--------RRRIGGY----------AEVMQEELDFEKRLKKRKYR--------------------------LIAAAEDAFSHVQNTAESGTNQKPGINNQMDSLTAAQNVFTWIVRPLTKYLKTTRLQSRHPSGEVTRHIERCLTLKLSHRTFLQRFFSDRIPQREIVGESKWSVICDEAVSSGVQHGTYLVLKSHNPDIDCG---------VQLVCTISSIPFFNLTEQAKPGN-EKFSLKISNESAV 532          
BLAST of Vang-3 vs. Ensembl Celegans
Match: vang-1 (Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q95ZZ6])

HSP 1 Score: 80.4925 bits (197), Expect = 2.209e-15
Identity = 87/369 (23.58%), Postives = 143/369 (38.75%), Query Frame = 3
Query: 1689 VKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNA--KLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLS-QGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSR----NIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            V ++R PDGE         S+Q AA +IL+ Y   F  +N  ++   +     +                              G  GG A +K Y+++       ++ ++ R+L   ++        RR+                +M+           RK                            L+ A+EDAF ++    E+  N        + +  AAQ +F+ +++PL K+L+TTR Q R     V  H+  CL   L +R FL+ F S + P  E  G  +   I DE V+S + +   LV +    +I  G         + L CT+ S+P FNLTE+  P    KF  K+ +E++V
Sbjct:  244 VTIVRDPDGEMHTLNIGAGSIQEAATEILRFYTTRFSSFNIHLDNARQTAVAKQS-----------------------------GMQGGTAGFKMYNIEQFGGQETVSEVNTRALMEAAA--------RRRIGGY----------AEVMQEELDFEKRLKKRKYR--------------------------LIAAAEDAFSHVQNTAESGTNQKPGINNQMDSLTAAQNVFTWIVRPLTKYLKTTRLQSRHPSGEVTRHIERCLTLKLSHRTFLQRFFSDRIPQREIVGESKWSVICDEAVSSGVQHGTYLVLKSHNPDIDCG---------VQLVCTISSIPFFNLTEQAKPGN-EKFSLKISNESAV 529          
BLAST of Vang-3 vs. Ensembl Fly
Match: Vang (gene:FBgn0015838 transcript:FBtr0330624)

HSP 1 Score: 143.28 bits (360), Expect = 4.440e-35
Identity = 77/172 (44.77%), Postives = 105/172 (61.05%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKL-LGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L+ A+E+AF ++ R      N     L L   EAA A+F ++ + LQK+LR TRQQPR + E ++ HL +CL +DL  RAFLEP+L++ PV++          +   V SW L  D +VSR IG+   F L Q D+SL  TV  LP+FNL EE+   K NKF+ KL+SETSV
Sbjct:  421 LITAAEEAFTHIKR----IHNEPAPALPLDPQEAASAVFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTESPVMQSEK-------ERRWVQSWSLICDEIVSRPIGNECTFQLIQNDVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKLNSETSV 581          

HSP 2 Score: 69.3218 bits (168), Expect = 1.206e-11
Identity = 31/84 (36.90%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 1578 YSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPP 1829
            Y S V  A+   D LL +HY+ +V++ LR        +K++R PDG ++ Y   + S+Q AA+ +L++Y VDF ++NP++E  P
Sbjct:  271 YKSLVGYATNFVDTLLFIHYVAVVLLELRH-QQPCYYIKIIRSPDGVSRSYMLGQLSIQRAAVWVLQHYYVDFPIFNPYLERIP 353          
BLAST of Vang-3 vs. Ensembl Fly
Match: Vang (gene:FBgn0015838 transcript:FBtr0088566)

HSP 1 Score: 142.51 bits (358), Expect = 5.362e-35
Identity = 77/172 (44.77%), Postives = 105/172 (61.05%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKL-LGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L+ A+E+AF ++ R      N     L L   EAA A+F ++ + LQK+LR TRQQPR + E ++ HL +CL +DL  RAFLEP+L++ PV++          +   V SW L  D +VSR IG+   F L Q D+SL  TV  LP+FNL EE+   K NKF+ KL+SETSV
Sbjct:  421 LITAAEEAFTHIKR----IHNEPAPALPLDPQEAASAVFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTESPVMQSEK-------ERRWVQSWSLICDEIVSRPIGNECTFQLIQNDVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKLNSETSV 581          

HSP 2 Score: 68.9366 bits (167), Expect = 1.306e-11
Identity = 31/84 (36.90%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 1578 YSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPP 1829
            Y S V  A+   D LL +HY+ +V++ LR        +K++R PDG ++ Y   + S+Q AA+ +L++Y VDF ++NP++E  P
Sbjct:  271 YKSLVGYATNFVDTLLFIHYVAVVLLELRH-QQPCYYIKIIRSPDGVSRSYMLGQLSIQRAAVWVLQHYYVDFPIFNPYLERIP 353          
BLAST of Vang-3 vs. Ensembl Zebrafish
Match: vangl2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:245949])

HSP 1 Score: 116.701 bits (291), Expect = 1.227e-26
Identity = 84/215 (39.07%), Postives = 130/215 (60.47%), Query Frame = 3
Query: 2139 STTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRY--DENCRNNSNAK-LLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            ++TG++       A    NS+N+ YYEE E ++RV KR+ RL++A E+AF ++ R   DE   +  + + ++   EAAQAIF+ + + +QK+LRTTRQQP  SME +I HL+ C+ +++  +AFLE +L+ GP ++   YQ++    +     W L S+  V+  +  G VF L + D +L  TV  LP  NL EE    K +KF+ +L SETSV
Sbjct:  319 NSTGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKRLQDDEAAASPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQ---YQRE----NGRGRQWTLVSEEPVTAALRQGLVFSLRRLDFALVVTVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV 526          

HSP 2 Score: 68.9366 bits (167), Expect = 1.974e-11
Identity = 35/91 (38.46%), Postives = 52/91 (57.14%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+LE   +R Y   V  A  + D LL + YL LV++ +R +      +KV+R  DG ++ Y     S+Q AA+ +L +Y  DF VYNP
Sbjct:  201 YGVRVLE-PRERDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLR-PAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNP 289          
BLAST of Vang-3 vs. Ensembl Zebrafish
Match: vangl1 (VANGL planar cell polarity protein 1 [Source:ZFIN;Acc:ZDB-GENE-040621-2])

HSP 1 Score: 110.538 bits (275), Expect = 1.196e-24
Identity = 62/171 (36.26%), Postives = 95/171 (55.56%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R  +  +       +   EAAQAIF ++ + LQK+LRTTRQQ   SM+ +  HL  C+  ++  +AFLE +L+ GP L       Q   +      W L S+  V+  + +G+ F L   D SL  T K++P+  L+EE    K +KF+ +L SETSV
Sbjct:  364 LVVAVEEAFTHVRRLQDEEKKKPPGDEMDPREAAQAIFPSMARALQKYLRTTRQQHCHSMDSIQAHLAFCITNNMTPKAFLESYLTAGPTL-------QYGRESSQTRHWTLVSEASVTSPLRNGSEFQLKSSDFSLVVTSKTIPHLKLSEEYVHPKSHKFVLQLQSETSV 527          

HSP 2 Score: 67.3958 bits (163), Expect = 5.785e-11
Identity = 34/93 (36.56%), Postives = 55/93 (59.14%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFI 1817
            +G+R+L +S    Y   V  A  + D LL +HYL +V++ +R +     ++ V+R  DGET  Y   + S+Q AA+ IL++Y  DF V+NP +
Sbjct:  206 FGVRIL-DSQDDNYQGIVQFAVSLVDALLFIHYLAVVLLEIRHLQ-PCFSLCVVRSTDGETHHYNMGQLSIQRAALVILEHYYKDFTVHNPAL 296          
BLAST of Vang-3 vs. Ensembl Xenopus
Match: krt12.2 (keratin 12, gene 2 [Source:Xenbase;Acc:XB-GENE-6492280])

HSP 1 Score: 124.79 bits (312), Expect = 3.370e-29
Identity = 82/212 (38.68%), Postives = 129/212 (60.85%), Query Frame = 3
Query: 2139 STTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            ++TG++       A    NS+N+ YYEE E+E+RV KR+ RL++A E+AF ++ R  +  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L  GP +       Q + D  +   W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  318 NSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLVVAVEEAFTHIKRLQDEDQKNPR-EIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTI-------QYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 76.2554 bits (186), Expect = 1.102e-13
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+LE S  + Y   V  A  + D LL VHYL +V++ LR++  +   VKV+R  DG ++ Y     S+Q  A+ IL+NY  DF VYNP
Sbjct:  200 YGVRILE-SRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQ-FTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNP 288          
BLAST of Vang-3 vs. Ensembl Mouse
Match: Vangl2 (VANGL planar cell polarity 2 [Source:MGI Symbol;Acc:MGI:2135272])

HSP 1 Score: 146.362 bits (368), Expect = 3.698e-36
Identity = 131/425 (30.82%), Postives = 213/425 (50.12%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNY-LVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPY--QPPPGALGG----------LAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            YG+R+L ++ +R Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y           +  L+N   +   + +P + A                         LPPG  I     +P  G + G          L KY ++D     P+ N           P+ L    S + +K +  K      + S     ++TG++       A    NS+N+ YYEE E+E+RV KRR RL++A E+AF ++ R  E  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L+ GP ++   Y ++ ++  +    W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  200 YGVRIL-DARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQ-FTLKVVRSTDGASRFYN----------VGHLRNLGRMSEGMRSPLVGA------------------------YLPPGFSIEEMSSRPSLGKVAGACIQRVAVWILEKY-YHDF----PVYN-----------PALLNLPKSVLAKKVSGFKVYSLGEENST---NNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLVVAVEEAFTHIKRLQEEEQKNPR-EVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQ---YHKERWLAKQ----WTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 561          
BLAST of Vang-3 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 117.857 bits (294), Expect = 5.130e-29
Identity = 68/171 (39.77%), Postives = 99/171 (57.89%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R     +  S  +++   EAAQAIF ++ + LQK+LRTTRQQ   SME ++ HL  C+   +  +AFLE +LS GP L+   Y +  ++     T W L S+  V+  + DG VF L   D SL   VK +P   L+EE    K +KF+ +L SETSV
Sbjct:   90 LVVAVEEAFIHIQRLQAEEQQKSPGEVMDPREAAQAIFPSMARALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERYLSAGPTLQ---YDKDRWLS----TQWRLISEEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 253          
BLAST of Vang-3 vs. Ensembl Mouse
Match: Vangl2 (VANGL planar cell polarity 2 [Source:MGI Symbol;Acc:MGI:2135272])

HSP 1 Score: 122.865 bits (307), Expect = 1.013e-28
Identity = 64/168 (38.10%), Postives = 103/168 (61.31%), Query Frame = 3
Query: 2271 ASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            A E+AF ++ R  E  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L+ GP ++   Y ++ ++       W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQKNPR-EVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQ---YHKERWL----AKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 73.9442 bits (180), Expect = 4.511e-13
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L ++ +R Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y     S+Q  A+ IL+ Y  DF VYNP
Sbjct:  200 YGVRIL-DARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQ-FTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNP 288          
BLAST of Vang-3 vs. Ensembl Mouse
Match: Vangl2 (VANGL planar cell polarity 2 [Source:MGI Symbol;Acc:MGI:2135272])

HSP 1 Score: 122.865 bits (307), Expect = 1.013e-28
Identity = 64/168 (38.10%), Postives = 103/168 (61.31%), Query Frame = 3
Query: 2271 ASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            A E+AF ++ R  E  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L+ GP ++   Y ++ ++       W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQKNPR-EVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQ---YHKERWL----AKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 73.9442 bits (180), Expect = 4.511e-13
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L ++ +R Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y     S+Q  A+ IL+ Y  DF VYNP
Sbjct:  200 YGVRIL-DARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQ-FTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNP 288          
BLAST of Vang-3 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 116.701 bits (291), Expect = 1.210e-26
Identity = 68/171 (39.77%), Postives = 99/171 (57.89%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R     +  S  +++   EAAQAIF ++ + LQK+LRTTRQQ   SME ++ HL  C+   +  +AFLE +LS GP L+   Y +  ++     T W L S+  V+  + DG VF L   D SL   VK +P   L+EE    K +KF+ +L SETSV
Sbjct:  363 LVVAVEEAFIHIQRLQAEEQQKSPGEVMDPREAAQAIFPSMARALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERYLSAGPTLQ---YDKDRWLS----TQWRLISEEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 526          

HSP 2 Score: 75.485 bits (184), Expect = 1.654e-13
Identity = 35/91 (38.46%), Postives = 57/91 (62.64%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L++ +Q  Y   V  A  + D LL +HYL +V++ LR++      ++V+R  DGE++ Y     S+Q AA+ +L+NY  DF +YNP
Sbjct:  206 YGVRILDSRDQ-NYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNP 294          
BLAST of Vang-3 vs. UniProt/SwissProt
Match: sp|Q90Z05|VNG2B_XENLA (Vang-like protein 2-B OS=Xenopus laevis OX=8355 GN=vangl2-b PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.093e-28
Identity = 84/213 (39.44%), Postives = 131/213 (61.50%), Query Frame = 3
Query: 2139 STTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRY-DENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            ++TG++       A    NS+N+ YYEE E+E+RV KR+ RL++A E+AF ++ R  DE+ +N    +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L  GP +       Q + D  +   W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  318 NSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLVVAVEEAFTHIKRLQDEDPKNPR--EIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLGPGPTI-------QYHKDRWLAKQWTLVSEEPVTNGLKDGVVFELKRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 75.8702 bits (185), Expect = 8.197e-13
Identity = 38/91 (41.76%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+LE S  + Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y     S+Q  A+ IL+NY  DF VYNP
Sbjct:  200 YGVRILE-SRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQ-FTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNP 288          
BLAST of Vang-3 vs. UniProt/SwissProt
Match: sp|Q90X64|VNG2A_XENLA (Vang-like protein 2-A OS=Xenopus laevis OX=8355 GN=vangl2-a PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.769e-28
Identity = 82/212 (38.68%), Postives = 129/212 (60.85%), Query Frame = 3
Query: 2139 STTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            ++TG++       A    NS+N+ YYEE E+E+RV KR+ RL++A E+AF ++ R  +  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L  GP +       Q + D  +   W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  318 NSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLVVAVEEAFTHIKRLQDEDQKNPR-EIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTI-------QYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 75.8702 bits (185), Expect = 8.197e-13
Identity = 38/91 (41.76%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+LE S  + Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y     S+Q  A+ IL+NY  DF VYNP
Sbjct:  200 YGVRILE-SRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQ-FTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNP 288          
BLAST of Vang-3 vs. UniProt/SwissProt
Match: sp|Q4VBG5|VANG2_XENTR (Vang-like protein 2 OS=Xenopus tropicalis OX=8364 GN=vangl2 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.785e-28
Identity = 82/212 (38.68%), Postives = 129/212 (60.85%), Query Frame = 3
Query: 2139 STTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            ++TG++       A    NS+N+ YYEE E+E+RV KR+ RL++A E+AF ++ R  +  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L  GP +       Q + D  +   W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  318 NSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLVVAVEEAFTHIKRLQDEDQKNPR-EIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTI-------QYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 76.2554 bits (186), Expect = 5.838e-13
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+LE S  + Y   V  A  + D LL VHYL +V++ LR++  +   VKV+R  DG ++ Y     S+Q  A+ IL+NY  DF VYNP
Sbjct:  200 YGVRILE-SRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQ-FTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNP 288          
BLAST of Vang-3 vs. UniProt/SwissProt
Match: sp|P84889|VANG2_RAT (Vang-like protein 2 OS=Rattus norvegicus OX=10116 GN=Vangl2 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 7.088e-28
Identity = 64/168 (38.10%), Postives = 103/168 (61.31%), Query Frame = 3
Query: 2271 ASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            A E+AF ++ R  E  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L+ GP ++   Y ++ ++       W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQKNPR-EVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQ---YHKERWL----AKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 73.9442 bits (180), Expect = 3.156e-12
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L ++ +R Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y     S+Q  A+ IL+ Y  DF VYNP
Sbjct:  200 YGVRIL-DARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQ-FTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNP 288          
BLAST of Vang-3 vs. UniProt/SwissProt
Match: sp|Q91ZD4|VANG2_MOUSE (Vang-like protein 2 OS=Mus musculus OX=10090 GN=Vangl2 PE=1 SV=3)

HSP 1 Score: 122.865 bits (307), Expect = 7.088e-28
Identity = 64/168 (38.10%), Postives = 103/168 (61.31%), Query Frame = 3
Query: 2271 ASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            A E+AF ++ R  E  + N   +++   EAAQAIF+++ + +QK+LRTT+QQP  +ME ++ HL  C+ +D+  +AFLE +L+ GP ++   Y ++ ++       W L S+  V+  + DG VF L + D SL  + K +P F L+EE    K +KF+ +L SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQKNPR-EVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQ---YHKERWL----AKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          

HSP 2 Score: 73.9442 bits (180), Expect = 3.156e-12
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+L ++ +R Y   V  A  + D LL VHYL +V++ LR++  +   +KV+R  DG ++ Y     S+Q  A+ IL+ Y  DF VYNP
Sbjct:  200 YGVRIL-DARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQ-FTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNP 288          
BLAST of Vang-3 vs. TrEMBL
Match: A0A481MTM9 (Vang-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1533.08 bits (3968), Expect = 0.000e+0
Identity = 902/903 (99.89%), Postives = 903/903 (100.00%), Query Frame = 3
Query:   66 MDVASEKSVKSGIXXXXXXXXXXXXXXXXXTFANRQXXXXXXXXXXXXXXXXYTDYSPQLLPMNNSNDFQMTYTNPTTMNHDQVNLLTKTTIDTNIGSYAFYKMSHNSNINVPNSMKSNWSPYNLMATSSYPILPSQMPPLPALPQINGAXXXXXXXXXXXXXXXXXXXXDENHSHPLYSSKPQHLIHTNDNFQMIQGGQYFTDISQIQXXXXXXXXXXXXXXMDHQSSIINVTNTLVPFQPSPFINQMAPNLKSDWMPSEYNNSAILYSNNSYHQSLTGPGSEAXXXXXXXXXXYLGVVGPTGWNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHXXXXXXXXXXXXXXXXXXXXXXXXXXXYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            MDVASEKSVKSGISNKSLLSNRSLDSSRQSTFANRQKSTNKSSTTNSSLLNSYTDYSPQLLPMNNSNDFQMTYTNPTTMNHDQVNLLTKTTIDTNIGSYAFYKMSHNSNINVPNSMKSNWSPYNLMATSSYPILPSQMPPLPALPQINGASSPTVGGNSSSSTYANTTASDENHSHPLYSSKPQHLIHTNDNFQMIQGGQYFTDISQIQNNFNTIPNPNYNN+MDHQSSIINVTNTLVPFQPSPFINQMAPNLKSDWMPSEYNNSAILYSNNSYHQSLTGPGSEATGTTTLLGDDYLGVVGPTGWNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHTTLPRLTFLRSFLLFLIFIITIVFWLFYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPRRRAGSRGGQSSRVSSQTGGVSSLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDRYYEEVEYEKRVAKRRVRLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV
Sbjct:    1 MDVASEKSVKSGISNKSLLSNRSLDSSRQSTFANRQKSTNKSSTTNSSLLNSYTDYSPQLLPMNNSNDFQMTYTNPTTMNHDQVNLLTKTTIDTNIGSYAFYKMSHNSNINVPNSMKSNWSPYNLMATSSYPILPSQMPPLPALPQINGASSPTVGGNSSSSTYANTTASDENHSHPLYSSKPQHLIHTNDNFQMIQGGQYFTDISQIQNNFNTIPNPNYNNMMDHQSSIINVTNTLVPFQPSPFINQMAPNLKSDWMPSEYNNSAILYSNNSYHQSLTGPGSEATGTTTLLGDDYLGVVGPTGWNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHTTLPRLTFLRSFLLFLIFIITIVFWLFYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPRRRAGSRGGQSSRVSSQTGGVSSLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDRYYEEVEYEKRVAKRRVRLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 903          
BLAST of Vang-3 vs. TrEMBL
Match: A0A443R7P6 (Vang-like protein 2 OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_15962 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 8.333e-59
Identity = 163/417 (39.09%), Postives = 235/417 (56.35%), Query Frame = 3
Query: 1539 YGIRMLE---NSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPY-QPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKL-LGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            Y +R+ E   +  +  Y S V+ A  + D LL +HYL +++I LR +  +   VKV+R PDGE+  Y   + S+Q A++ IL++Y  DF VYNP+++  PR+++ S     +             P N IG +   PP  L      K+YDVDG    +N +  S   LG  S+            A++   GT S  +     S  G+ S+      + H + +NDR++EE EYE+RV KR+ RLM A EDAF ++ R DE       A + +  YEAAQAIF +  + LQK+LR TRQQPR SM+ +I HL  CL++DL  +AF+E ++   PVL++    Q+         +W L  D L+SR I +GTVF L QGD+SL  TV S+P+FN+TEEI   K NKF+F+L+SETSV
Sbjct:  279 YAVRIAERRFSEYELSYHSIVLFAVSLVDALLFIHYLAVILIELRHLTPQ-FFVKVVRSPDGESHCYNIGELSIQRASVWILEHYYKDFSVYNPYLDLIPRKKSKSSTSIVNT------------PSNMIGNHISSPPSTL------KYYDVDGVT--ANSSGFSGGLLGQTSA----------AFANVNENGTFSSNNLEERSSRRGKGSS-----HHHHHHHHNDRFHEEHEYERRVKKRKARLMTAVEDAFTHIKRVDEE----QGAPIPMDPYEAAQAIFPSFARTLQKYLRITRQQPRHSMQSIINHLAMCLSFDLSPKAFVEKYIKSSPVLQNDKEHQK-------TQTWGLICDVLLSRTIENGTVFMLRQGDVSLLVTVHSIPHFNITEEIIDPKSNKFVFRLNSETSV 648          
BLAST of Vang-3 vs. TrEMBL
Match: A0A0F6N0Q3 (Vang-like protein OS=Terebratalia transversa OX=34513 GN=str PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.264e-55
Identity = 179/567 (31.57%), Postives = 266/567 (46.91%), Query Frame = 3
Query: 1110 FDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNV------------DCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHXXXXXXXXXXXXXXXXXXXXXXXXXXXYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            FDCA   G+ +A  L  +AF SP  MV LP   +  W  + C              +CE +   L I L    A   L  L      F RK             ++  P      A I +                       L+F++T  FWLFY +R+L+   ++ Y S +  A  + D LL +HYL ++++ +R+M      V+V+R PDGE++ Y   + S+Q AA+ IL+ Y  DF VYNP++++ P                                          L  +KFYDVDG                    +T  T H R + A   +A  R  RS                         +NDR+YEE EYE+R+ KRR RL++A+++AF ++ R  E       A  +   EAAQAIF ++ + LQK+LR TRQQPR+SME ++ HL  CL++D+  R+F+E ++SQG V+ +         D     +W+L  D L+SR + DGT+F L QGDI++ C+V+ +P+FN+TEE+   K NKF+ +L+SETSV
Sbjct:  106 FDCARYIGSVLAAILGFLAFVSPIVMVLLPKLNIDGWETVPCEASCIVDTKTDTGSNCEPKCEGLLISL----AFKLLILLIGTWALFFRKP------------KATMPRIFIFRAAILF-----------------------LVFVLTFAFWLFYAVRILQK-KEKDYYSIISFAVSLADSLLFIHYLSIILLEIRQMQ-PMYVVRVVRSPDGESRSYNIGQLSIQRAAVTILEQYYKDFPVYNPYLDSIPGSSRRK-----------------------------------NLTNFKFYDVDG--------------------VTHQTPHGRSR-AIFAAAAHRRDRS-------------------------HNDRFYEEQEYERRLRKRRARLIVAADEAFTHIRRLHEE---QGPAIPMDPQEAAQAIFPSMARALQKYLRVTRQQPRYSMENILEHLAACLSHDMSPRSFIERYMSQGNVIHNDR-------DHRPTQTWVLICDTLLSRAVEDGTLFQLRQGDIAILCSVRKIPHFNITEEVINPKDNKFVLRLNSETSV 540          
BLAST of Vang-3 vs. TrEMBL
Match: A0A444TN22 (Vang-like protein 2 OS=Armadillidium vulgare OX=13347 GN=Avbf_03374 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 5.550e-55
Identity = 131/414 (31.64%), Postives = 204/414 (49.28%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEV--VTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            Y +R+LE   + QY + V  +  + D LL +HYL +V++ LR    +  ++KVLR PDGE++ Y   + SVQ AA+ IL+ Y  DF +YNP+++  P ++                        N I             + +K+YDVDG                                       T   R+  ++ +T  R  + HN +       +            RV KR+ RL+ A+E+AF ++ R  E+         +  +EAAQA+F +L + LQK+LR TRQQPR +ME ++ HL  CL++D+  RAFLE ++   PV ++         D E+  + SW L  D+L+SR I +GTVF L Q D+ L C+V ++P+F++ EE+   K NKF+ +L+SETSV
Sbjct:   55 YIVRVLERKEEVQYRAVVYFSVSLVDALLFIHYLAVVLLELRHATPQ-YSIKVLRSPDGESRWYNIGQLSVQRAAVWILEKYYQDFSIYNPYLDRIPSKKKH---------------------NNSIN------------SSFKYYDVDG------------------------------------EGDTGEGRTRAVLAATARRRDSAHNERFYEEHEYDR-----------RVRKRKARLITAAEEAFAHIRRLHEDINRGGTGNPMNPHEAAQAVFPSLSRALQKYLRITRQQPRHTMEAILAHLAQCLSHDMSPRAFLEKYIKTEPVFQN---------DKELKDIQSWGLVCDQLLSRPISNGTVFQLRQNDVLLLCSVHTIPHFSIAEEVIHPKSNKFVLRLNSETSV 378          
BLAST of Vang-3 vs. TrEMBL
Match: A0A2H8TVI4 (Vang-like protein OS=Melanaphis sacchari OX=742174 GN=Vangl1_6 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.841e-54
Identity = 182/611 (29.79%), Postives = 282/611 (46.15%), Query Frame = 3
Query:  978 WNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLP--------VTRLIEWPN---IKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHXXXXXXXXXXXXXXXXXXXXXXXXXXXYGIRMLENSNQR-QYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            W  N  +   +  +QS +  +     P  T Q    P   + HR+    TT TG+   LSL+AF SP AM+ LP         T L        + C  +C+  L+SL  K+ L+  A++  FLR    T  R          + + ++   + + I  GI +  +                           V  +  G+R         +Y + V  +S + DCLL +HY+ +V++ +R +      +KV+R PDGE++ Y   + S+Q AA+ +L+ Y  +F +YNP++E                                     P   +    + +KFYD++G    SN   +S+                        S GT                 N H R+ +S   S+N+R+YEE +YE+RV KRR RL+ A+E+AF ++ R   +    S    +  YEAAQA+F T+ + LQK+LR TRQQPR ++E ++ HL  CL +D   +AFLEP+LS  PVL++   Q+ L        SW L  + L++R + DGTVF L Q D+SL CT+  LP+F++ EE+   K N+F+ KL+SETSV
Sbjct:   84 WGENTTAITGNTSVQSGSMEEMGALWP-DTEQKSAFPI--LCHRYIA--TTLTGL---LSLVAFLSPLAMLVLPKLGVFSPAATNLSPQQRETLLNCGAECKGVLVSLAFKMFLLAVASWAIFLRPMKATMPR----------IYVFRAIVLALVSICCGIFWLFY---------------------------VVQVTEGVRATATGEDLLEYRALVSYSSSLCDCLLCIHYVAIVLMEIRHLQ-PAFYIKVVRSPDGESRSYPIGQLSIQRAAVWVLERYYTEFSIYNPYLER-----------------------------------LPVSKSKKNASSFKFYDIEGIG--SNTLQMSQ------------------------SRGTM----------------NGHARRRDS---SHNERFYEEHDYERRVKKRRARLLTAAEEAFTHVKRSHHDPGGGSA---MDPYEAAQAVFPTIARSLQKYLRVTRQQPRHTVESILSHLALCLTHDASPKAFLEPYLSASPVLQNEKEQKSL-------QSWSLICNELLTRALKDGTVFQLRQNDLSLLCTIHKLPHFSIIEEVINPKSNRFVLKLNSETSV 558          
BLAST of Vang-3 vs. Ensembl Cavefish
Match: vangl2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:103047256])

HSP 1 Score: 122.479 bits (306), Expect = 1.057e-28
Identity = 86/215 (40.00%), Postives = 131/215 (60.93%), Query Frame = 3
Query: 2139 STTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNA---KLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            ++TG++       A    NS+N+ YYEE E ++RV KR+ RL++A E+AF ++ R  E+ +  S     +++   EAAQAIF+ + + +QK+LRTTRQQP  SME +I HL+ C+ +++  +AFLE +L+ GP ++   YQ++    +     W L S+  V+  +  G VF L + D SL  TV SLP  NL EE    K +KF+ +L SETSV
Sbjct:  317 NSTGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKRLQEDEQATSPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIIAHLQFCITHNMTPKAFLERYLTPGPTMQ---YQRE----NGRGRQWTLVSEEPVTSALRQGLVFSLRRLDFSLVVTVTSLPFLNLGEEFIDPKSHKFVMRLQSETSV 524          

HSP 2 Score: 66.2402 bits (160), Expect = 9.650e-11
Identity = 34/91 (37.36%), Postives = 51/91 (56.04%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+LE   ++ Y   V  A  + D LL + YL LV++ +R +      +KV+R  DG ++ Y     S+Q AA+ +L  Y  DF VYNP
Sbjct:  199 YGVRVLE-PKEKDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLR-PAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDQYYSDFPVYNP 287          
BLAST of Vang-3 vs. Ensembl Cavefish
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:103034531])

HSP 1 Score: 118.627 bits (296), Expect = 2.572e-27
Identity = 67/171 (39.18%), Postives = 102/171 (59.65%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++ R  E  +  S  +++   EAAQAIF ++ + LQK+LRTTRQQ   SME +  HL  C+ +++  +AFLE +L  GP L+   Y ++ ++  +    W L S+  V+  + +GTVF L   D SL  T K +P   L+EE    K +KF+ +L SETSV
Sbjct:  366 LVVAVEEAFTHIRRLQEEEQKKSPGEIMDPREAAQAIFPSMARALQKYLRTTRQQHCHSMESIQQHLAFCITHNMTPKAFLESYLMPGPTLQ---YGRERWLAHQ----WTLISEASVTSGLKEGTVFLLKCIDFSLVVTTKKIPYIKLSEEFIDPKSHKFVLRLQSETSV 529          

HSP 2 Score: 70.4774 bits (171), Expect = 4.923e-12
Identity = 34/91 (37.36%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+ +  ++  Y   V  A  + D LL +HYL +V++ LR++     ++ V R  DGET+ Y   + S+Q AA+ +L+NY  DF V+NP
Sbjct:  203 YGVRIFDTKDE-DYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PCFSLCVTRSTDGETRHYNLGQLSIQRAAVAVLENYYRDFPVHNP 291          
BLAST of Vang-3 vs. Ensembl Cavefish
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:103036576])

HSP 1 Score: 108.997 bits (271), Expect = 3.061e-24
Identity = 62/168 (36.90%), Postives = 94/168 (55.95%), Query Frame = 3
Query: 2271 ASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            A E+AF ++ R  E  +      ++   EAAQAIF ++ + LQK+LRTTRQQ   +M+ +  HL  C+  ++  +AFLE +LS GP L+   Y ++ +        W L S+  V+  + DGT F L   D SL  + KS+P+  ++E     K +KF+  L SETSV
Sbjct:  364 AVEEAFTHVQRLQEEEKKKPPGDVMDPREAAQAIFPSMARALQKYLRTTRQQHCHTMDSIQTHLAFCITNNMTPKAFLESYLSSGPTLQ---YGRECW----QALQWTLVSEAAVTSPLRDGTEFQLKNADFSLVVSTKSIPHLKISEVYVHPKSHKFVLLLQSETSV 524          

HSP 2 Score: 62.3882 bits (150), Expect = 1.506e-9
Identity = 30/90 (33.33%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYN 1808
            +G+R+L++ ++  Y   V  A  + D LL  HYL +V++ +R +      + V+R  DGE + Y   + S+Q AA+ +L+ Y  DF V+N
Sbjct:  203 FGVRILDSQDE-NYQGIVQFAVSLVDALLFTHYLAVVLLEVRHLQ-PCFCLCVIRSTDGERRHYNLGQLSIQRAAVVVLEQYYKDFSVHN 290          
BLAST of Vang-3 vs. Ensembl Cavefish
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:103036576])

HSP 1 Score: 108.612 bits (270), Expect = 4.105e-24
Identity = 62/168 (36.90%), Postives = 94/168 (55.95%), Query Frame = 3
Query: 2271 ASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            A E+AF ++ R  E  +      ++   EAAQAIF ++ + LQK+LRTTRQQ   +M+ +  HL  C+  ++  +AFLE +LS GP L+   Y ++ +        W L S+  V+  + DGT F L   D SL  + KS+P+  ++E     K +KF+  L SETSV
Sbjct:  376 AVEEAFTHVQRLQEEEKKKPPGDVMDPREAAQAIFPSMARALQKYLRTTRQQHCHTMDSIQTHLAFCITNNMTPKAFLESYLSSGPTLQ---YGRECW----QALQWTLVSEAAVTSPLRDGTEFQLKNADFSLVVSTKSIPHLKISEVYVHPKSHKFVLLLQSETSV 536          

HSP 2 Score: 62.3882 bits (150), Expect = 1.633e-9
Identity = 30/90 (33.33%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYN 1808
            +G+R+L++ ++  Y   V  A  + D LL  HYL +V++ +R +      + V+R  DGE + Y   + S+Q AA+ +L+ Y  DF V+N
Sbjct:  203 FGVRILDSQDE-NYQGIVQFAVSLVDALLFTHYLAVVLLEVRHLQ-PCFCLCVIRSTDGERRHYNLGQLSIQRAAVVVLEQYYKDFSVHN 290          
BLAST of Vang-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010728.1 (pep scaffold:Pmarinus_7.0:GL486594:2920:5521:1 gene:ENSPMAG00000009715.1 transcript:ENSPMAT00000010728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 2.255e-34
Identity = 67/171 (39.18%), Postives = 98/171 (57.31%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A+E+AF ++ R  E  +       +   EAAQAIF ++ + LQK+LR T+QQP  SME ++ HL +C+ +D+  RAFLE +LS GP +       Q   D  + + W L S   V+  + DGT F L + D+ L  TV   P F L+E     K +KF+ +L SETSV
Sbjct:    2 LVVAAEEAFTHVRRLQEEEQRAGTGLTMDPQEAAQAIFPSMARALQKYLRATKQQPFHSMEGILKHLAHCIAHDMTARAFLEKYLSPGPTV-------QYEPDKWLSSQWRLLSAEPVTSALRDGTAFSLARADLCLVVTVSRAPRFTLSETFLDPKSHKFVLRLQSETSV 165          
BLAST of Vang-3 vs. Ensembl Nematostella
Match: EDO38357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD40])

HSP 1 Score: 123.635 bits (309), Expect = 7.753e-30
Identity = 112/412 (27.18%), Postives = 188/412 (45.63%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            YG+R++    Q  +   +  A  + D LL +HYL +++++LR+ +     +KV+R  DG  K Y     S+Q AAI +L+ Y      Y  F E  P   +                              P   +    +  KFYD+DG                      +  S +  +T ++ +A ++ +R+        GRN                DR+YEE E+E+++ +R+ RL+   E+AF ++ R          +  +   E AQ++F +  +PLQK+LRT +Q  R +M+ ++ HL +CL +D+  +AFLE +L+  P +E  G             SW L  +  V+  + + TVF L    +SL  TV ++P+F + E+ F  + NKF+ KL+SETSV
Sbjct:  136 YGLRIIAKRGQ-DFGEILKFAVTLVDSLLFLHYLSVIVLWLRQ-SEPMFTLKVIRSTDGVNKFYNVGLLSIQRAAIYVLEQY------YKDFPEYNPYMMSV-----------------------------PARSSAKQFSTLKFYDIDGK--------------------LQDNSKVNPRTRAIITASSQGRRN-------PGRN----------------DRFYEEAEFERKLKRRKARLVATCEEAFGHIKRVQ---LERGPSVPMDPEETAQSLFPSFARPLQKYLRTVKQHHRHNMDAILKHLAHCLTFDMSPKAFLERYLNDQPCIEYTGASVG-------PQSWSLVCEEQVTSGLSNSTVFQLKTEVLSLVVTVNNIPHFVVDEDEFDFENNKFVLKLNSETSV 457          
BLAST of Vang-3 vs. Ensembl Nematostella
Match: EDO27076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA95])

HSP 1 Score: 98.9821 bits (245), Expect = 2.784e-24
Identity = 53/140 (37.86%), Postives = 83/140 (59.29%), Query Frame = 3
Query: 2355 EAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            E AQ++F +  +PLQK+LRT +Q  R +M+ ++ HL +CL +D+  +AFLE +L+  P +E  G             SW L  +  V+  + + TVF L    +SL  TV ++P+F + E+ F  + NKF+ KL+SETSV
Sbjct:    5 ETAQSLFPSFARPLQKYLRTVKQHHRHNMDAILKHLAHCLTFDMSPKAFLERYLNDQPCIEYTGASVG-------PQSWSLVCEEQVTSGLSNSTVFQLKTEVLSLVVTVNNIPHFVVDEDEFDFENNKFVLKLNSETSV 137          
BLAST of Vang-3 vs. Ensembl Medaka
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:101165035])

HSP 1 Score: 154.451 bits (389), Expect = 3.390e-39
Identity = 125/412 (30.34%), Postives = 184/412 (44.66%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            Y +R+LE  +   Y   V  A  + D LL +HYL +V++ LR++     +V V R  DGET+ Y   + S+Q AA+ I+++Y  DF V+NP + +  + R                                   A   LA  K Y+VDGP P +N A                             AG    +S  ++ +   R    HN                      RV KR+ RL++A E+AF ++ R  E  +  S   ++   EAAQAIF ++ + LQK+LRTT+QQ   SME +  HL  C+  ++  +AFLE +L+ GP L       Q   D  +   W L S+  V+  + DGTVF L   D SL    K +P   ++EE    K +KF+ +L SETSV
Sbjct:  202 YAVRILEAQDA-DYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PCFSVCVTRSTDGETRHYNLGQLSIQQAALAIIEHYYSDFPVHNPALLSASKSR-----------------------------------AAKHLAGLKVYNVDGPGPGNNPA-----------------------------AGLAHSQSRAMIAAAARRRDTSHNELYYEEAEHER-----------RVRKRKARLVVAVEEAFTHIKRMQEEEQKKSPGDVMDPREAAQAIFPSMTRALQKYLRTTKQQHCHSMESIQQHLAFCITNNMTPKAFLESYLTPGPTL-------QYSRDRWLARQWTLISEASVTSGLRDGTVFLLKCVDFSLVIAAKKIPFVQMSEEYIDPKSHKFVLRLQSETSV 529          
BLAST of Vang-3 vs. Ensembl Medaka
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:101165035])

HSP 1 Score: 154.451 bits (389), Expect = 1.243e-38
Identity = 125/412 (30.34%), Postives = 184/412 (44.66%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            Y +R+LE  +   Y   V  A  + D LL +HYL +V++ LR++     +V V R  DGET+ Y   + S+Q AA+ I+++Y  DF V+NP + +  + R                                   A   LA  K Y+VDGP P +N A                             AG    +S  ++ +   R    HN                      RV KR+ RL++A E+AF ++ R  E  +  S   ++   EAAQAIF ++ + LQK+LRTT+QQ   SME +  HL  C+  ++  +AFLE +L+ GP L       Q   D  +   W L S+  V+  + DGTVF L   D SL    K +P   ++EE    K +KF+ +L SETSV
Sbjct:  310 YAVRILEAQDA-DYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQ-PCFSVCVTRSTDGETRHYNLGQLSIQQAALAIIEHYYSDFPVHNPALLSASKSR-----------------------------------AAKHLAGLKVYNVDGPGPGNNPA-----------------------------AGLAHSQSRAMIAAAARRRDTSHNELYYEEAEHER-----------RVRKRKARLVVAVEEAFTHIKRMQEEEQKKSPGDVMDPREAAQAIFPSMTRALQKYLRTTKQQHCHSMESIQQHLAFCITNNMTPKAFLESYLTPGPTL-------QYSRDRWLARQWTLISEASVTSGLRDGTVFLLKCVDFSLVIAAKKIPFVQMSEEYIDPKSHKFVLRLQSETSV 637          
BLAST of Vang-3 vs. Ensembl Medaka
Match: VANGL2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:101163605])

HSP 1 Score: 111.694 bits (278), Expect = 3.870e-25
Identity = 84/215 (39.07%), Postives = 127/215 (59.07%), Query Frame = 3
Query: 2139 STTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNA---KLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            ++TG++       A    NS+N+ YYEE E E+R+ KR+ RL++A E+AF ++ R  ++   +S     + +   EAAQAIF+ + + +QK+LRTTRQQ   SME +I HL+ C+ +++  +AFLE +L+ GP ++   YQQQ    +     W L S+  V+  +  G VF L + D SL  TV  LP   L EE    K +KF+ +L SETSV
Sbjct:  318 NSTGQSRAMIAAAARRRDNSHNEYYYEEAEMERRIRKRKARLVVAVEEAFTHIKRLHKDEATSSPKHPREEMDPREAAQAIFAPMARAMQKYLRTTRQQAFHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQ---YQQQ----NGGGRQWTLVSEEPVTSALRQGLVFSLRRLDFSLVVTVTPLPFLRLGEEFIDPKSHKFVMRLQSETSV 525          

HSP 2 Score: 70.0922 bits (170), Expect = 6.233e-12
Identity = 36/91 (39.56%), Postives = 52/91 (57.14%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNP 1811
            YG+R+LE   +R Y   V  A+ + D LL + YL LV++ +R +      +KV+R  DG +K Y     S+Q AA+ +L  Y  DF VYNP
Sbjct:  201 YGVRVLE-PRERDYRGIVEYAASLVDALLFIQYLALVLLEVRHLQ-PAFCLKVVRTADGASKFYNVGHLSIQRAAVWVLDRYYSDFPVYNP 289          
BLAST of Vang-3 vs. Ensembl Medaka
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:101170632])

HSP 1 Score: 107.071 bits (266), Expect = 1.460e-23
Identity = 91/249 (36.55%), Postives = 134/249 (53.82%), Query Frame = 3
Query: 2031 LGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNS-NNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L +PS L+       +  A LK     +  S    +++ G  S      A    +S +N+ YYEE +YE+RV KRR RL++A E+AF ++ R  +   N   + ++   EAA A+F ++ + LQK+LRTTR+Q   SME +  HL  CL  ++  +AFLE +LS GP L+   Y  + ++ D+    W L S+  V+  + DG  F L   D SL   VK +P   L+EE    K +KFI  L SETSV
Sbjct:  299 LHNPSILSAAKHRAAKHLAGLKVYNVDAPGSTAAAQTSNGNQSRATVAAAAKRKDSAHNELYYEEADYERRVRKRRARLVVAVEEAFTHVRRMTKEDENAPPSDIMDVREAALAVFPSMARSLQKYLRTTRRQHCHSMESIQKHLAFCLVNNMSPKAFLEAYLSPGPTLQ---YGSERWMADQ----WTLVSEASVTSGLKDGAEFLLKCLDFSLAVVVKGIPYIRLSEEYVDPKSHKFILLLQSETSV 540          

HSP 2 Score: 64.6994 bits (156), Expect = 3.610e-10
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFI 1817
            YG+R+L+  ++  Y  +   A  + D  L VHYL +V++ LR +     +V V+R  DGET+ Y   + S+Q AA+ IL+ Y  DF ++NP I
Sbjct:  214 YGVRILDAQDEDFYGIA-QFAVSLVDSQLFVHYLAVVLLELRHLQ-PCYSVCVIRSTDGETRHYNMGQLSIQRAALSILEYYYRDFPLHNPSI 304          
BLAST of Vang-3 vs. Ensembl Medaka
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:101170632])

HSP 1 Score: 107.071 bits (266), Expect = 1.460e-23
Identity = 91/249 (36.55%), Postives = 134/249 (53.82%), Query Frame = 3
Query: 2031 LGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNS-NNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L +PS L+       +  A LK     +  S    +++ G  S      A    +S +N+ YYEE +YE+RV KRR RL++A E+AF ++ R  +   N   + ++   EAA A+F ++ + LQK+LRTTR+Q   SME +  HL  CL  ++  +AFLE +LS GP L+   Y  + ++ D+    W L S+  V+  + DG  F L   D SL   VK +P   L+EE    K +KFI  L SETSV
Sbjct:  299 LHNPSILSAAKHRAAKHLAGLKVYNVDAPGSTAAAQTSNGNQSRATVAAAAKRKDSAHNELYYEEADYERRVRKRRARLVVAVEEAFTHVRRMTKEDENAPPSDIMDVREAALAVFPSMARSLQKYLRTTRRQHCHSMESIQKHLAFCLVNNMSPKAFLEAYLSPGPTLQ---YGSERWMADQ----WTLVSEASVTSGLKDGAEFLLKCLDFSLAVVVKGIPYIRLSEEYVDPKSHKFILLLQSETSV 540          

HSP 2 Score: 64.6994 bits (156), Expect = 3.610e-10
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 3
Query: 1539 YGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFI 1817
            YG+R+L+  ++  Y  +   A  + D  L VHYL +V++ LR +     +V V+R  DGET+ Y   + S+Q AA+ IL+ Y  DF ++NP I
Sbjct:  214 YGVRILDAQDEDFYGIA-QFAVSLVDSQLFVHYLAVVLLELRHLQ-PCYSVCVIRSTDGETRHYNMGQLSIQRAALSILEYYYRDFPLHNPSI 304          
BLAST of Vang-3 vs. Planmine SMEST
Match: SMESG000046194.1 (SMESG000046194.1)

HSP 1 Score: 1177.54 bits (3045), Expect = 0.000e+0
Identity = 655/655 (100.00%), Postives = 655/655 (100.00%), Query Frame = 3
Query:  810 MAPNLKSDWMPSEYNNSAILYSNNSYHQSLTGPGSEAXXXXXXXXXXYLGVVGPTGWNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHXXXXXXXXXXXXXXXXXXXXXXXXXXXYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPXXXXXXXXXXXXXXXXXXXXXXXLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDXXXXXXXXXXXXXXXXXXLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            MAPNLKSDWMPSEYNNSAILYSNNSYHQSLTGPGSEATGTTTLLGDDYLGVVGPTGWNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHTTLPRLTFLRSFLLFLIFIITIVFWLFYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPRRRAGSRGGQSSRVSSQTGGVSSLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDRYYEEVEYEKRVAKRRVRLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV
Sbjct:    1 MAPNLKSDWMPSEYNNSAILYSNNSYHQSLTGPGSEATGTTTLLGDDYLGVVGPTGWNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHTTLPRLTFLRSFLLFLIFIITIVFWLFYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPRRRAGSRGGQSSRVSSQTGGVSSLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDRYYEEVEYEKRVAKRRVRLMLASEDAFRNLFRYDENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 655          
BLAST of Vang-3 vs. Planmine SMEST
Match: SMESG000046198.1 (SMESG000046198.1)

HSP 1 Score: 344.354 bits (882), Expect = 3.215e-111
Identity = 243/249 (97.59%), Postives = 246/249 (98.80%), Query Frame = 3
Query:   66 MDVASEKSVKSGIXXXXXXXXXXXXXXXXXTFANRQXXXXXXXXXXXXXXXXYTDYSPQLLPMNNSNDFQMTYTNPTTMNHDQVNLLTKTTIDTNIGSYAFYKMSHNSNINVPNSMKSNWSPYNLMATSSYPILPSQMPPLPALPQINGAXXXXXXXXXXXXXXXXXXXXDENHSHPLYSSKPQHLIHTNDNFQMIQGGQYFTDISQIQXXXXXXXXXXXXXXMDHQSSIINVTNTLVPFQPSPFINQM 812
            MDVASEKSVKSGIS+KSLLSNRSLDSSRQSTFANRQKSTNKSSTTNSSLLNSYTDYSPQLLPMNNSNDFQMTYTNPTTMNHDQVNLLTKTTIDTNIGSYAFYKMSHNSNIN PN MKSNWSPYNLMATSSYP LPSQMPPLPALPQINGASSPTVGGNSSSSTYANTTASDENHSHPLYSSKPQHLIHTNDNFQMIQGGQYFTDISQIQNNFNTIPNPNYNN+MDHQSSIINVTNTLVPFQPSPFINQ+
Sbjct:    1 MDVASEKSVKSGISHKSLLSNRSLDSSRQSTFANRQKSTNKSSTTNSSLLNSYTDYSPQLLPMNNSNDFQMTYTNPTTMNHDQVNLLTKTTIDTNIGSYAFYKMSHNSNINAPNPMKSNWSPYNLMATSSYPNLPSQMPPLPALPQINGASSPTVGGNSSSSTYANTTASDENHSHPLYSSKPQHLIHTNDNFQMIQGGQYFTDISQIQNNFNTIPNPNYNNMMDHQSSIINVTNTLVPFQPSPFINQV 249          
BLAST of Vang-3 vs. Planmine SMEST
Match: SMESG000053210.1 (SMESG000053210.1)

HSP 1 Score: 100.523 bits (249), Expect = 3.825e-22
Identity = 65/235 (27.66%), Postives = 111/235 (47.23%), Query Frame = 3
Query: 1110 FDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHXXXXXXXXXXXXXXXXXXXXXXXXXXXYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPF 1814
            FDC     T I ICL +++F SP  M+ LP  ++  W  I C+  CES                YL F+   LC  C                        I + + +   + Y+   +     +   LLF+I     +F++   + +++N   + + + V  ++ +TD L+  HYL LV++ +R +  +   +KV+R PDGE++ Y+    S+Q AAIKIL+ Y++DF +YN +
Sbjct:  169 FDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCES----------------YLVFICCKLCILC------------------------IASLVLFCRRKTYAFPRVLVFKLVLIMLLFIIIFGLWLFYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETK-FCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVY 362          
BLAST of Vang-3 vs. Planmine SMEST
Match: SMESG000029281.1 (SMESG000029281.1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.876e-18
Identity = 71/234 (30.34%), Postives = 107/234 (45.73%), Query Frame = 3
Query: 1107 RFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHXXXXXXXXXXXXXXXXXXXXXXXXXXXYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYN 1808
            +FDC    G  I I L +I+  SP AM+ LP  +L+EW    CN  CE QLISL  KLI++    +  F R       RK+ S   +S            + I   I + +   YS                              +R+L+    + +   V+ +  + D LL VHYL LV++ + +M      +KV R PDG ++ Y+  + S+Q AAI +L+NY++DF  YN
Sbjct:  174 KFDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFR-------RKQHSVTRVSLF------RAFILFIAFVIVFAYWLFYS------------------------------VRILD-KKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQM-QMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYN 362          

HSP 2 Score: 88.1965 bits (217), Expect = 1.388e-17
Identity = 56/184 (30.43%), Postives = 98/184 (53.26%), Query Frame = 3
Query: 2262 LMLASEDAFRNLFRYD--ENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPF-----LSQGPVLEDPGYQQQLYID-DEVVTSWILYSDRLVSRNIGDGTVFHL----CQ-GDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 2774
            L++A E+AF ++  Y+  +  R  +  + +G  EAA+ I   ++KPLQK LR +R+   +S   V+ H+  CL+Y L  +  ++ F     +    +L +    ++L     ++  SWIL  ++L+S+ + +   F L    C   D+ L CTV  +P F+L E++F E   +F    +SETSV
Sbjct:  460 LLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 643          
The following BLAST results are available for this feature:
BLAST of Vang-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VANGL21.530e-2838.10VANGL planar cell polarity protein 2 [Source:HGNC ... [more]
VANGL18.227e-2639.18VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL18.755e-2639.18VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL18.755e-2639.18VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL18.755e-2639.18VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
back to top
BLAST of Vang-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vang-12.117e-1523.58Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
vang-12.209e-1523.58Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
back to top
BLAST of Vang-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vang4.440e-3544.77gene:FBgn0015838 transcript:FBtr0330624[more]
Vang5.362e-3544.77gene:FBgn0015838 transcript:FBtr0088566[more]
back to top
BLAST of Vang-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vangl21.227e-2639.07VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
vangl11.196e-2436.26VANGL planar cell polarity protein 1 [Source:ZFIN;... [more]
back to top
BLAST of Vang-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
krt12.23.370e-2938.68keratin 12, gene 2 [Source:Xenbase;Acc:XB-GENE-649... [more]
back to top
BLAST of Vang-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vangl23.698e-3630.82VANGL planar cell polarity 2 [Source:MGI Symbol;Ac... [more]
Vangl15.130e-2939.77VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
Vangl21.013e-2838.10VANGL planar cell polarity 2 [Source:MGI Symbol;Ac... [more]
Vangl21.013e-2838.10VANGL planar cell polarity 2 [Source:MGI Symbol;Ac... [more]
Vangl11.210e-2639.77VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Vang-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90Z05|VNG2B_XENLA1.093e-2839.44Vang-like protein 2-B OS=Xenopus laevis OX=8355 GN... [more]
sp|Q90X64|VNG2A_XENLA1.769e-2838.68Vang-like protein 2-A OS=Xenopus laevis OX=8355 GN... [more]
sp|Q4VBG5|VANG2_XENTR1.785e-2838.68Vang-like protein 2 OS=Xenopus tropicalis OX=8364 ... [more]
sp|P84889|VANG2_RAT7.088e-2838.10Vang-like protein 2 OS=Rattus norvegicus OX=10116 ... [more]
sp|Q91ZD4|VANG2_MOUSE7.088e-2838.10Vang-like protein 2 OS=Mus musculus OX=10090 GN=Va... [more]
back to top
BLAST of Vang-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481MTM90.000e+099.89Vang-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A443R7P68.333e-5939.09Vang-like protein 2 OS=Dinothrombium tinctorium OX... [more]
A0A0F6N0Q31.264e-5531.57Vang-like protein OS=Terebratalia transversa OX=34... [more]
A0A444TN225.550e-5531.64Vang-like protein 2 OS=Armadillidium vulgare OX=13... [more]
A0A2H8TVI41.841e-5429.79Vang-like protein OS=Melanaphis sacchari OX=742174... [more]
back to top
BLAST of Vang-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
vangl21.057e-2840.00VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
VANGL12.572e-2739.18VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
vangl13.061e-2436.90vang-like protein 1 [Source:NCBI gene;Acc:10303657... [more]
vangl14.105e-2436.90vang-like protein 1 [Source:NCBI gene;Acc:10303657... [more]
back to top
BLAST of Vang-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010728.12.255e-3439.18pep scaffold:Pmarinus_7.0:GL486594:2920:5521:1 gen... [more]
back to top
BLAST of Vang-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vang-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383577.753e-3027.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270762.784e-2437.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vang-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VANGL13.390e-3930.34VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
VANGL11.243e-3830.34VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
VANGL23.870e-2539.07VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
vangl11.460e-2336.55vang-like protein 1 [Source:NCBI gene;Acc:10117063... [more]
vangl11.460e-2336.55vang-like protein 1 [Source:NCBI gene;Acc:10117063... [more]
back to top
BLAST of Vang-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000046194.10.000e+0100.00SMESG000046194.1[more]
SMESG000046198.13.215e-11197.59SMESG000046198.1[more]
SMESG000053210.13.825e-2227.66SMESG000053210.1[more]
SMESG000029281.12.876e-1830.34SMESG000029281.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003750 ID=SMED30003750|Name=Vang-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3017bp
TTAAAATTCATTTAAATGCTAATTTATTAGGCATAATTGATATTAATTTA
TAAATTTTAAATTATATGGATGTTGCTAGTGAAAAAAGCGTTAAAAGTGG
AATAAGCAACAAATCTCTTCTTTCTAATAGATCCTTAGATTCATCTCGCC
AATCAACCTTTGCAAACCGTCAAAAATCAACCAATAAAAGCTCCACAACT
AATTCTTCGTTATTGAATAGTTATACCGACTATTCACCACAATTGTTACC
GATGAATAACTCAAATGATTTTCAAATGACTTACACAAATCCGACAACTA
TGAACCACGATCAAGTGAATTTGCTAACGAAAACGACAATCGATACGAAT
ATTGGATCTTATGCCTTTTATAAAATGTCGCACAATTCAAATATCAACGT
CCCAAACTCGATGAAATCCAATTGGTCGCCTTATAATTTAATGGCAACAT
CGAGCTATCCAATTTTGCCATCCCAGATGCCTCCACTGCCAGCATTACCA
CAGATTAATGGAGCATCATCTCCAACAGTCGGCGGCAATTCTTCGTCGTC
AACGTACGCTAATACAACAGCCAGTGATGAAAATCATTCTCATCCTCTAT
ACTCATCGAAACCTCAGCATCTAATCCACACAAATGATAACTTTCAAATG
ATTCAGGGAGGCCAATACTTTACCGACATCTCACAGATTCAGAACAATTT
CAACACAATTCCTAATCCCAACTACAATAACATAATGGACCATCAATCAT
CTATCATTAATGTGACTAACACTTTAGTTCCATTTCAACCTAGTCCATTT
ATAAATCAAATGGCGCCTAATCTGAAATCTGACTGGATGCCATCTGAATA
TAACAATAGTGCAATATTGTACTCAAACAACTCCTATCATCAGTCCCTTA
CAGGACCCGGCAGTGAGGCTACTGGAACCACAACTCTTCTCGGCGATGAC
TACTTGGGCGTTGTTGGACCAACAGGATGGAACAATAACTATTTGTCGAG
TCAGTATTCAAACAAAATTCAATCCTTAACGAAATCGAAGCGAACCGGTT
TTACCCCCCTGATCACCGCGCAAGCTCCCCAGCATCCATTCGATCATATT
TCCCATCGGTTCGATTGTGCTCTAACAACAGGTACTGGAATTGCGATCTG
TCTCAGCTTGATTGCATTTTTCTCTCCCGCTGCCATGGTAACGCTGCCAG
TGACGAGACTAATTGAATGGCCAAATATCAAATGCAATGTTGATTGCGAA
TCTCAACTGATTTCACTCACAATCAAACTGATTCTCATCGGGGCAGCCGC
ATATTTGACATTTTTACGCAATCATTTATGCACTTTCTGCCGAAAGAAAT
CCAGCTACGATCCATTATCCGGACTGGCTATATCGCAAAGTGGCACTCCG
TCAAATATCGGCATTGAAGCTGGAATCCACTACAGACATCATCGGAATTA
TTCTCATACCACTTTACCAAGATTAACATTTTTGAGATCGTTTTTGTTGT
TTCTTATTTTCATCATTACAATCGTATTTTGGTTGTTTTACGGAATTCGG
ATGTTAGAAAACTCCAATCAAAGGCAGTATAGCAGTAGTGTCATGTTGGC
CAGTCGCATGACTGATTGTTTACTGTTGGTTCATTATTTGGGCCTAGTTA
TTATTTTTCTAAGAGAAATGAATAATGAAACCCTGGCTGTAAAAGTACTT
CGATGTCCTGATGGAGAGACGAAAATATATAAATTCAAAAAGACTTCCGT
GCAATTAGCAGCAATCAAAATTCTTAAAAATTATTTAGTTGATTTTAAGG
TTTATAATCCGTTTATTGAAGCACCGCCTAGAAGGAGAGCAGGATCTAGA
GGAGGTCAAAGCAGCCGTGTTAGTAGTCAAACTGGTGGTGTTTCTTCATT
GCCTCCAGGTAATGGTATTGGACCCTATCAACCACCGCCTGGAGCTTTAG
GAGGCTTAGCCAAATATAAATTTTACGATGTCGATGGACCAGCTCCAATG
AGTAACCTCGCGCCTTTATCAAAACGAAGTTTAGGCTCTCCTTCTTCTTT
GACAAAATGTACATCACATATCCGCAGAAAAACAGCATCGCTTAAGTCAG
CTGGTACGAGATCCCAACGCTCATGTCCGATTATGAAGAGTACAACCGGA
CGAAATTCAAATCAGCATAACAGGAAAGCAAACAGTCATACAAACAGCAA
CAACGATCGCTATTATGAAGAGGTTGAATACGAAAAACGGGTTGCTAAAC
GCAGAGTCAGGCTTATGTTAGCCAGTGAAGACGCATTCAGGAACTTGTTT
AGATATGATGAAAATTGCAGAAATAATTCAAATGCCAAACTCTTAGGAGC
TTACGAAGCTGCTCAAGCTATATTTTCAACTTTACTTAAACCTCTTCAAA
AGTTTTTAAGAACGACTAGACAGCAACCAAGATTTTCAATGGAATGGGTA
ATCGGTCATTTAAGAAATTGTTTGAATTATGATTTGGGTTATCGAGCATT
TCTCGAACCATTTCTCTCTCAAGGTCCAGTGCTCGAAGATCCTGGATATC
AACAGCAGCTGTATATTGATGATGAAGTAGTGACATCTTGGATTTTATAT
AGTGATCGTTTAGTTTCAAGAAATATTGGTGATGGAACCGTTTTCCATTT
ATGCCAAGGAGACATTTCTTTGTTTTGTACAGTTAAAAGTCTTCCTAATT
TTAATTTGACGGAAGAGATTTTCCCTGAAAAATGCAACAAGTTTATTTTC
AAACTGGATTCTGAAACGTCCGTGTGAAAGAAGATTTATCATTTTAAAAA
GATTAGAAATAATTTAATTTCAAAGACAGAAACATTAATTTCATTTTCAA
AAGATAAATTATTTATTGTTGATTGGTTTATATGTTTGTAGATTTGTGCG
TGTTGCGGATTATTTTAATTGGCTTTTGCATTTCTCTTTTAAAATCAGGT
TGGCTAATTACTGGTGATAAAGGATATGAATGAAGATTATTGCTTGTCTT
AATATCTATTATTTCTG
back to top

protein sequence of SMED30003750-orf-1

>SMED30003750-orf-1 ID=SMED30003750-orf-1|Name=SMED30003750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=904bp
MDVASEKSVKSGISNKSLLSNRSLDSSRQSTFANRQKSTNKSSTTNSSLL
NSYTDYSPQLLPMNNSNDFQMTYTNPTTMNHDQVNLLTKTTIDTNIGSYA
FYKMSHNSNINVPNSMKSNWSPYNLMATSSYPILPSQMPPLPALPQINGA
SSPTVGGNSSSSTYANTTASDENHSHPLYSSKPQHLIHTNDNFQMIQGGQ
YFTDISQIQNNFNTIPNPNYNNIMDHQSSIINVTNTLVPFQPSPFINQMA
PNLKSDWMPSEYNNSAILYSNNSYHQSLTGPGSEATGTTTLLGDDYLGVV
GPTGWNNNYLSSQYSNKIQSLTKSKRTGFTPLITAQAPQHPFDHISHRFD
CALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLIS
LTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGI
EAGIHYRHHRNYSHTTLPRLTFLRSFLLFLIFIITIVFWLFYGIRMLENS
NQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDG
ETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPRRRAGSRGGQSS
RVSSQTGGVSSLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAP
LSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQ
HNRKANSHTNSNNDRYYEEVEYEKRVAKRRVRLMLASEDAFRNLFRYDEN
CRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLR
NCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLV
SRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSE
TSV*
back to top
Aliases
The feature 'Vang-3' has the following synonyms
Synonym
Smed_34076
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000017photoreceptor neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR009539VANGL
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009539Vang-like proteinPFAMPF06638Strabismuscoord: 348..424
e-value: 6.0E-11
score: 41.7
coord: 691..903
e-value: 7.7E-60
score: 203.0
coord: 463..592
e-value: 2.1E-36
score: 125.6
IPR009539Vang-like proteinPANTHERPTHR20886FAMILY NOT NAMEDcoord: 633..903
coord: 347..426
IPR009539Vang-like proteinPANTHERPTHR20886FAMILY NOT NAMEDcoord: 463..598
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 596..612
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 670..714
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 670..713
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 589..617
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 10..50
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..50
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 152..174
NoneNo IPR availablePANTHERPTHR20886:SF11VANG-LIKE PROTEIN-RELATEDcoord: 347..426
NoneNo IPR availablePANTHERPTHR20886:SF11VANG-LIKE PROTEIN-RELATEDcoord: 633..903
coord: 463..598
NoneNo IPR availableTMHMMTMhelixcoord: 398..417
NoneNo IPR availableTMHMMTMhelixcoord: 361..383
NoneNo IPR availableTMHMMTMhelixcoord: 470..492