Single-stranded DNA-binding protein 3

Overview
NameSingle-stranded DNA-binding protein 3
Smed IDSMED30003736
Length (bp)1578
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Single-stranded DNA-binding protein 3 (SMED30003736) t-SNE clustered cells

Violin plots show distribution of expression levels for Single-stranded DNA-binding protein 3 (SMED30003736) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Single-stranded DNA-binding protein 3 (SMED30003736) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Single-stranded DNA-binding protein 3 (SMED30003736) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003736

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30003736SMESG000052079.1 SmedASXL_006581SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30003736SMESG000072113.1 Contig5097GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003736SMESG000052079.1 Contig5097GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30003736SMESG000052079.1 dd_Smed_v4_3876_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Human
Match: SSBP3 (single stranded DNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:15674])

HSP 1 Score: 152.91 bits (385), Expect = 4.462e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Human
Match: SSBP3 (single stranded DNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:15674])

HSP 1 Score: 152.91 bits (385), Expect = 4.995e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Human
Match: SSBP2 (single stranded DNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:15831])

HSP 1 Score: 150.599 bits (379), Expect = 6.820e-41
Identity = 69/98 (70.41%), Postives = 82/98 (83.67%), Query Frame = 1
Query:   91 MFPKGKAPS--VPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVN 378
            M+ KGK+ S  VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY F++
Sbjct:    1 MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYPFMS 98          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Human
Match: SSBP3 (single stranded DNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:15674])

HSP 1 Score: 153.295 bits (386), Expect = 7.113e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Human
Match: SSBP2 (single stranded DNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:15831])

HSP 1 Score: 151.369 bits (381), Expect = 8.645e-41
Identity = 69/97 (71.13%), Postives = 81/97 (83.51%), Query Frame = 1
Query:   91 MFPKGKAPS--VPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFV 375
            M+ KGK+ S  VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY F+
Sbjct:    1 MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYPFM 97          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Celegans
Match: sam-10 (Single-stranded DNA-binding protein homolog sam-10 [Source:UniProtKB/Swiss-Prot;Acc:B7FAS6])

HSP 1 Score: 75.8702 bits (185), Expect = 1.729e-14
Identity = 38/94 (40.43%), Postives = 58/94 (61.70%), Query Frame = 1
Query:  115 SVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKP---------WQIGESPGFLNQWWCVFYDLYSAAPERRETFEH--SSEAKAFHD 363
            S+ S+  A+++L S++YEYL   GA+K A+TF +E+    P          ++ +   FL +WW +F+DLYSAAPERR+      S+EAK FH+
Sbjct:   12 SLASEMTARDRLTSYIYEYLQQTGASKTAETFKEEVLSTNPAAGLAAANSTKLSDK-SFLLEWWLLFWDLYSAAPERRDAGGDPFSAEAKYFHE 104          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Celegans
Match: sam-10 (Single-stranded DNA-binding protein homolog sam-10 [Source:UniProtKB/Swiss-Prot;Acc:B7FAS6])

HSP 1 Score: 75.8702 bits (185), Expect = 1.729e-14
Identity = 38/94 (40.43%), Postives = 58/94 (61.70%), Query Frame = 1
Query:  115 SVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKP---------WQIGESPGFLNQWWCVFYDLYSAAPERRETFEH--SSEAKAFHD 363
            S+ S+  A+++L S++YEYL   GA+K A+TF +E+    P          ++ +   FL +WW +F+DLYSAAPERR+      S+EAK FH+
Sbjct:   12 SLASEMTARDRLTSYIYEYLQQTGASKTAETFKEEVLSTNPAAGLAAANSTKLSDK-SFLLEWWLLFWDLYSAAPERRDAGGDPFSAEAKYFHE 104          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Fly
Match: Ssdp (gene:FBgn0011481 transcript:FBtr0083612)

HSP 1 Score: 157.918 bits (398), Expect = 1.741e-42
Identity = 69/99 (69.70%), Postives = 83/99 (83.84%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGY 387
            M+ K K  +VPSD+QA+EKLA +VYEYL+H+GA KAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+  +HSSEAKAFHDYGFV+SGY
Sbjct:    1 MYGKSKTSAVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHTWWCVFWDLYCAAPERRDQCDHSSEAKAFHDYGFVSSGY 99          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Fly
Match: Ssdp (gene:FBgn0011481 transcript:FBtr0083611)

HSP 1 Score: 157.918 bits (398), Expect = 1.741e-42
Identity = 69/99 (69.70%), Postives = 83/99 (83.84%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGY 387
            M+ K K  +VPSD+QA+EKLA +VYEYL+H+GA KAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+  +HSSEAKAFHDYGFV+SGY
Sbjct:    1 MYGKSKTSAVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHTWWCVFWDLYCAAPERRDQCDHSSEAKAFHDYGFVSSGY 99          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Fly
Match: Ssdp (gene:FBgn0011481 transcript:FBtr0083613)

HSP 1 Score: 157.918 bits (398), Expect = 1.741e-42
Identity = 69/99 (69.70%), Postives = 83/99 (83.84%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGY 387
            M+ K K  +VPSD+QA+EKLA +VYEYL+H+GA KAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+  +HSSEAKAFHDYGFV+SGY
Sbjct:    1 MYGKSKTSAVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHTWWCVFWDLYCAAPERRDQCDHSSEAKAFHDYGFVSSGY 99          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Fly
Match: Ssdp (gene:FBgn0011481 transcript:FBtr0330051)

HSP 1 Score: 157.918 bits (398), Expect = 5.195e-42
Identity = 69/99 (69.70%), Postives = 83/99 (83.84%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGY 387
            M+ K K  +VPSD+QA+EKLA +VYEYL+H+GA KAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+  +HSSEAKAFHDYGFV+SGY
Sbjct:    1 MYGKSKTSAVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHTWWCVFWDLYCAAPERRDQCDHSSEAKAFHDYGFVSSGY 99          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Zebrafish
Match: ssbp3b (single stranded DNA binding protein 3b [Source:ZFIN;Acc:ZDB-GENE-040426-2801])

HSP 1 Score: 152.14 bits (383), Expect = 4.009e-42
Identity = 67/92 (72.83%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MFPKGK+  VPSD QA+EKLA +VYEYL+HIGA K+AQTFL E+ WEK   +G+ PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFPKGKSSVVPSDGQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGDPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Zebrafish
Match: ssbp3b (single stranded DNA binding protein 3b [Source:ZFIN;Acc:ZDB-GENE-040426-2801])

HSP 1 Score: 154.066 bits (388), Expect = 7.443e-42
Identity = 67/92 (72.83%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MFPKGK+  VPSD QA+EKLA +VYEYL+HIGA K+AQTFL E+ WEK   +G+ PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFPKGKSSVVPSDGQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGDPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Zebrafish
Match: ssbp3b (single stranded DNA binding protein 3b [Source:ZFIN;Acc:ZDB-GENE-040426-2801])

HSP 1 Score: 154.451 bits (389), Expect = 1.147e-41
Identity = 67/92 (72.83%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MFPKGK+  VPSD QA+EKLA +VYEYL+HIGA K+AQTFL E+ WEK   +G+ PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFPKGKSSVVPSDGQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGDPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Zebrafish
Match: si:ch211-130m23.3 (si:ch211-130m23.3 [Source:ZFIN;Acc:ZDB-GENE-060531-14])

HSP 1 Score: 152.14 bits (383), Expect = 4.047e-41
Identity = 68/92 (73.91%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ SVPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKS-SVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDY 91          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Zebrafish
Match: zgc:110158 (zgc:110158 [Source:ZFIN;Acc:ZDB-GENE-050522-195])

HSP 1 Score: 152.14 bits (383), Expect = 4.781e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK   VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAP+RRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKGAVVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPDRRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Xenopus
Match: ssbp2 (single-stranded DNA binding protein 2 [Source:NCBI gene;Acc:100216109])

HSP 1 Score: 156.762 bits (395), Expect = 6.644e-43
Identity = 69/95 (72.63%), Postives = 81/95 (85.26%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFV 375
            M+ KGK+ SVPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY F+
Sbjct:    1 MYAKGKSNSVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYPFM 95          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Xenopus
Match: ssbp2 (single-stranded DNA binding protein 2 [Source:NCBI gene;Acc:100216109])

HSP 1 Score: 155.221 bits (391), Expect = 1.943e-42
Identity = 68/92 (73.91%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ SVPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKSNSVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Xenopus
Match: ssbp2 (single-stranded DNA binding protein 2 [Source:NCBI gene;Acc:100216109])

HSP 1 Score: 155.221 bits (391), Expect = 2.844e-42
Identity = 68/92 (73.91%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ SVPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKSNSVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Xenopus
Match: ssbp2 (single-stranded DNA binding protein 2 [Source:NCBI gene;Acc:100216109])

HSP 1 Score: 155.606 bits (392), Expect = 4.204e-42
Identity = 68/92 (73.91%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ SVPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKSNSVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Xenopus
Match: ssbp2 (single-stranded DNA binding protein 2 [Source:NCBI gene;Acc:100216109])

HSP 1 Score: 156.377 bits (394), Expect = 4.433e-42
Identity = 68/92 (73.91%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ SVPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKSNSVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Mouse
Match: Ssbp3 (single-stranded DNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1919725])

HSP 1 Score: 150.984 bits (380), Expect = 4.637e-42
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Mouse
Match: Ssbp3 (single-stranded DNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1919725])

HSP 1 Score: 152.91 bits (385), Expect = 3.063e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Mouse
Match: Ssbp3 (single-stranded DNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1919725])

HSP 1 Score: 152.91 bits (385), Expect = 3.429e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Mouse
Match: Ssbp3 (single-stranded DNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1919725])

HSP 1 Score: 153.295 bits (386), Expect = 4.884e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Mouse
Match: Ssbp2 (single-stranded DNA binding protein 2 [Source:MGI Symbol;Acc:MGI:1914220])

HSP 1 Score: 151.369 bits (381), Expect = 5.935e-41
Identity = 69/97 (71.13%), Postives = 81/97 (83.51%), Query Frame = 1
Query:   91 MFPKGKAPS--VPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFV 375
            M+ KGK+ S  VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY F+
Sbjct:    1 MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYPFM 97          
BLAST of Single-stranded DNA-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q9R050|SSBP3_RAT (Single-stranded DNA-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ssbp3 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.916e-40
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q98948|SSBP3_CHICK (Single-stranded DNA-binding protein 3 OS=Gallus gallus OX=9031 GN=SSBP3 PE=2 SV=3)

HSP 1 Score: 152.91 bits (385), Expect = 2.682e-40
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q9D032|SSBP3_MOUSE (Single-stranded DNA-binding protein 3 OS=Mus musculus OX=10090 GN=Ssbp3 PE=1 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 3.416e-40
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q9BWW4|SSBP3_HUMAN (Single-stranded DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=SSBP3 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 3.416e-40
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MF KGK  +VPSD QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q9CYZ8|SSBP2_MOUSE (Single-stranded DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Ssbp2 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.320e-39
Identity = 68/94 (72.34%), Postives = 79/94 (84.04%), Query Frame = 1
Query:   91 MFPKGKAPS--VPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ S  VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDY
Sbjct:    1 MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDY 94          
BLAST of Single-stranded DNA-binding protein 3 vs. TrEMBL
Match: A0A0B6VMT0 (LisH domain-containing protein (Fragment) OS=Ostrinia furnacalis OX=93504 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.700e-46
Identity = 77/107 (71.96%), Postives = 90/107 (84.11%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGY-PNGLPRN 408
            M+ KGK  +VPSD+QA+EKLA +VYEYL+H+GATKAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDYGFVNSGY  NG+  N
Sbjct:    1 MYAKGKGSTVPSDAQAREKLALYVYEYLLHVGATKAAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYGFVNSGYGVNGIGHN 107          
BLAST of Single-stranded DNA-binding protein 3 vs. TrEMBL
Match: A0A2H1CP50 (LisH domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_03355 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 3.661e-46
Identity = 76/105 (72.38%), Postives = 89/105 (84.76%), Query Frame = 1
Query:   88 TMFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGLP 402
             M+ KGK  SVPSD+Q+KEKLA +VYEYL+HIGA K A +FLQE+ W+K   +GE PGFL+ WW VF+DLYSAAPERR+T EHS+EAKAFHDYGFVNSGYPNGLP
Sbjct:   51 IMYTKGKGSSVPSDAQSKEKLAVYVYEYLVHIGAQKTAHSFLQEIRWDKSISVGEPPGFLHSWWNVFWDLYSAAPERRDTHEHSNEAKAFHDYGFVNSGYPNGLP 155          
BLAST of Single-stranded DNA-binding protein 3 vs. TrEMBL
Match: A0A1B6ECV9 (LisH domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.22354 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.288e-45
Identity = 75/105 (71.43%), Postives = 88/105 (83.81%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGY-PNGLP 402
            M+ KGK  +VPSD+QA+EKLA +VYEYL+H+GA KAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDYGFVNSGY  NG+ 
Sbjct:    2 MYAKGKGSTVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYGFVNSGYGVNGIA 106          
BLAST of Single-stranded DNA-binding protein 3 vs. TrEMBL
Match: A0A1E1WU43 (LisH domain-containing protein (Fragment) OS=Pectinophora gossypiella OX=13191 GN=g.18674 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.605e-45
Identity = 76/107 (71.03%), Postives = 89/107 (83.18%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGY-PNGLPRN 408
            M+ KGK  +VPSD+QA+EKLA +VYEYL+H+GA KAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDYGFVNSGY  NG+  N
Sbjct:    1 MYAKGKGSTVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYGFVNSGYGVNGIGHN 107          
BLAST of Single-stranded DNA-binding protein 3 vs. TrEMBL
Match: A0A4Y2F4E4 (Single-stranded DNA-binding protein 3 OS=Araneus ventricosus OX=182803 GN=Ssbp3_0 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.290e-45
Identity = 77/107 (71.96%), Postives = 89/107 (83.18%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYP-NGLPRN 408
            M+ KGK  +VPSD+QA+EKLA +VYEYL+H+GA KAAQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET EHSSEAKAFHDYGFVNSGY  NG+  N
Sbjct:    1 MYAKGKGSTVPSDAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYGFVNSGYAVNGIAHN 107          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Cavefish
Match: ssbp3b (single-stranded DNA-binding protein 3-like [Source:NCBI gene;Acc:103027247])

HSP 1 Score: 152.14 bits (383), Expect = 2.077e-41
Identity = 66/92 (71.74%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MFPKGK+  VPSD QA+EKLA +VYEYL+HIGA K+AQTFL E+ WEK   +G+ PGFL+ WWCVF+DLY AAPERR++ EHSSEAKAFHDY
Sbjct:    1 MFPKGKSSVVPSDGQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGDPPGFLHSWWCVFWDLYCAAPERRDSCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Cavefish
Match: ssbp4 (single-stranded DNA-binding protein 3 [Source:NCBI gene;Acc:103024563])

HSP 1 Score: 152.525 bits (384), Expect = 3.079e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK   VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAP+RRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKGAVVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPDRRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Cavefish
Match: ssbp3b (single-stranded DNA-binding protein 3-like [Source:NCBI gene;Acc:103027247])

HSP 1 Score: 152.91 bits (385), Expect = 3.350e-41
Identity = 66/92 (71.74%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MFPKGK+  VPSD QA+EKLA +VYEYL+HIGA K+AQTFL E+ WEK   +G+ PGFL+ WWCVF+DLY AAPERR++ EHSSEAKAFHDY
Sbjct:    1 MFPKGKSSVVPSDGQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGDPPGFLHSWWCVFWDLYCAAPERRDSCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Cavefish
Match: ssbp4 (single-stranded DNA-binding protein 3 [Source:NCBI gene;Acc:103024563])

HSP 1 Score: 152.525 bits (384), Expect = 5.799e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK   VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAP+RRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKGAVVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPDRRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Cavefish
Match: zgc:110158 (single-stranded DNA-binding protein 3-like [Source:NCBI gene;Acc:103041273])

HSP 1 Score: 152.525 bits (384), Expect = 6.353e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK   VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAP+RRET EHSSEAKAFHDY
Sbjct:    1 MYAKGKGAVVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPDRRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Nematostella
Match: EDO39027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB60])

HSP 1 Score: 145.976 bits (367), Expect = 2.043e-42
Identity = 64/92 (69.57%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGKA +VPSD+QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR++ +HSSEAKAFHDY
Sbjct:    1 MYSKGKANTVPSDAQAREKLALYVYEYLLHVGAQKSAQTFLNEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDSCDHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Nematostella
Match: EDO27837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T857])

HSP 1 Score: 94.7449 bits (234), Expect = 5.368e-24
Identity = 41/63 (65.08%), Postives = 52/63 (82.54%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWW 279
            M+ KGKA +VPSD+QA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WW
Sbjct:    1 MYSKGKANTVPSDAQAREKLALYVYEYLLHVGAQKSAQTFLNEIRWEKNITLGEPPGFLHSWW 63          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Medaka
Match: ssbp3b (single-stranded DNA-binding protein 3 [Source:NCBI gene;Acc:101165795])

HSP 1 Score: 155.992 bits (393), Expect = 1.548e-42
Identity = 69/92 (75.00%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MFPKGK   VPSDSQA+EKLA +VYEYL+HIGA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET +HSSEAKAFHDY
Sbjct:    1 MFPKGKGTPVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCDHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Medaka
Match: ssbp3b (single-stranded DNA-binding protein 3 [Source:NCBI gene;Acc:101165795])

HSP 1 Score: 156.377 bits (394), Expect = 2.236e-42
Identity = 69/92 (75.00%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            MFPKGK   VPSDSQA+EKLA +VYEYL+HIGA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERRET +HSSEAKAFHDY
Sbjct:    1 MFPKGKGTPVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCDHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Medaka
Match: si:ch211-130m23.3 (single stranded DNA binding protein 2 [Source:NCBI gene;Acc:101158283])

HSP 1 Score: 153.295 bits (386), Expect = 1.100e-41
Identity = 66/92 (71.74%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ +VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MYAKGKSSNVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Medaka
Match: si:ch211-130m23.3 (single stranded DNA binding protein 2 [Source:NCBI gene;Acc:101158283])

HSP 1 Score: 152.91 bits (385), Expect = 2.083e-41
Identity = 66/92 (71.74%), Postives = 79/92 (85.87%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK+ +VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAPERR+T EHSSEAKAFHDY
Sbjct:    1 MYAKGKSSNVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Medaka
Match: ENSORLT00000017476.2 (single-stranded DNA-binding protein 3 [Source:NCBI gene;Acc:101158985])

HSP 1 Score: 152.525 bits (384), Expect = 2.754e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDY 366
            M+ KGK   VPSDSQA+EKLA +VYEYL+H+GA K+AQTFL E+ WEK   +GE PGFL+ WWCVF+DLY AAP+RRET EHSSEAKAFHDY
Sbjct:    1 MYGKGKGAVVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPDRRETCEHSSEAKAFHDY 92          
BLAST of Single-stranded DNA-binding protein 3 vs. Planmine SMEST
Match: SMESG000052079.1 (SMESG000052079.1)

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 438/439 (99.77%), Postives = 439/439 (100.00%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGLPRNXXXXXXXXXXXXXXXXRPPSSQGIIPPDNNIHTPVSIQGGPMLVPGSSFFPPGHPMPNISGQPIDLMRNRSVPYSIRFPQGTLMPSYHPAGAMPRHRFMGNPASSLGIVHSPGPSGTPQAGPQIMASPNDSLQNELQQNNPGQDPFGPNGSSRSPSHVISQXXXXXXXXXXSESNSDXXXXXXXXXXXXXXXXXXXFSQHQSHTMEYMPSSGMNFEPPVSMKHSPQLHNPNMEVIATMGNNIADYCNPMPPNGPSFSDHAMRVSQSSVSMGVQPISQLHMMHQGIGSHHGSLNMQSMPGGPSNSAQFISHQGGSINASPQFPDYGFTSMSQAI 1407
            MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGLPRNPSIPSPISGGMPPTGGRPPSSQGIIPPDNNIHTPVSIQGGPMLVPGSSFFPPGHPMPNISGQPIDLMRNRSVPYSIRFPQGT+MPSYHPAGAMPRHRFMGNPASSLGIVHSPGPSGTPQAGPQIMASPNDSLQNELQQNNPGQDPFGPNGSSRSPSHVISQPAPAFPPPPASESNSDQQNSSGMMNGGNGGPQMPQFSQHQSHTMEYMPSSGMNFEPPVSMKHSPQLHNPNMEVIATMGNNIADYCNPMPPNGPSFSDHAMRVSQSSVSMGVQPISQLHMMHQGIGSHHGSLNMQSMPGGPSNSAQFISHQGGSINASPQFPDYGFTSMSQAI
Sbjct:    1 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGLPRNPSIPSPISGGMPPTGGRPPSSQGIIPPDNNIHTPVSIQGGPMLVPGSSFFPPGHPMPNISGQPIDLMRNRSVPYSIRFPQGTVMPSYHPAGAMPRHRFMGNPASSLGIVHSPGPSGTPQAGPQIMASPNDSLQNELQQNNPGQDPFGPNGSSRSPSHVISQPAPAFPPPPASESNSDQQNSSGMMNGGNGGPQMPQFSQHQSHTMEYMPSSGMNFEPPVSMKHSPQLHNPNMEVIATMGNNIADYCNPMPPNGPSFSDHAMRVSQSSVSMGVQPISQLHMMHQGIGSHHGSLNMQSMPGGPSNSAQFISHQGGSINASPQFPDYGFTSMSQAI 439          
BLAST of Single-stranded DNA-binding protein 3 vs. Planmine SMEST
Match: SMESG000052079.1 (SMESG000052079.1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 422/439 (96.13%), Postives = 423/439 (96.36%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGLPRNXXXXXXXXXXXXXXXXRPPSSQGIIPPDNNIHTPVSIQGGPMLVPGSSFFPPGHPMPNISGQPIDLMRNRSVPYSIRFPQGTLMPSYHPAGAMPRHRFMGNPASSLGIVHSPGPSGTPQAGPQIMASPNDSLQNELQQNNPGQDPFGPNGSSRSPSHVISQXXXXXXXXXXSESNSDXXXXXXXXXXXXXXXXXXXFSQHQSHTMEYMPSSGMNFEPPVSMKHSPQLHNPNMEVIATMGNNIADYCNPMPPNGPSFSDHAMRVSQSSVSMGVQPISQLHMMHQGIGSHHGSLNMQSMPGGPSNSAQFISHQGGSINASPQFPDYGFTSMSQAI 1407
            MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGLPRNPSIPSPISGGMPPTGGRPPSSQG                GPMLVPGSSFFPPGHPMPNISGQPIDLMRNRSVPYSIRFPQGT+MPSYHPAGAMPRHRFMGNPASSLGIVHSPGPSGTPQAGPQIMASPNDSLQNELQQNNPGQDPFGPNGSSRSPSHVISQPAPAFPPPPASESNSDQQNSSGMMNGGNGGPQMPQFSQHQSHTMEYMPSSGMNFEPPVSMKHSPQLHNPNMEVIATMGNNIADYCNPMPPNGPSFSDHAMRVSQSSVSMGVQPISQLHMMHQGIGSHHGSLNMQSMPGGPSNSAQFISHQGGSINASPQFPDYGFTSMSQAI
Sbjct:    1 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGLPRNPSIPSPISGGMPPTGGRPPSSQG----------------GPMLVPGSSFFPPGHPMPNISGQPIDLMRNRSVPYSIRFPQGTVMPSYHPAGAMPRHRFMGNPASSLGIVHSPGPSGTPQAGPQIMASPNDSLQNELQQNNPGQDPFGPNGSSRSPSHVISQPAPAFPPPPASESNSDQQNSSGMMNGGNGGPQMPQFSQHQSHTMEYMPSSGMNFEPPVSMKHSPQLHNPNMEVIATMGNNIADYCNPMPPNGPSFSDHAMRVSQSSVSMGVQPISQLHMMHQGIGSHHGSLNMQSMPGGPSNSAQFISHQGGSINASPQFPDYGFTSMSQAI 423          
BLAST of Single-stranded DNA-binding protein 3 vs. Planmine SMEST
Match: SMESG000044349.1 (SMESG000044349.1)

HSP 1 Score: 155.221 bits (391), Expect = 1.768e-41
Identity = 69/103 (66.99%), Postives = 81/103 (78.64%), Query Frame = 1
Query:   91 MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPWQIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYPNGL 399
            MF K K   VPSD+QAKEKLA +VYEYL H+GA KAAQTF +E+ W++  Q+ E PGFL  WW VF+DLY AAPERR+T EHS+EAKAFHDYGF+NSG  NG 
Sbjct:    1 MFHKSKNIGVPSDAQAKEKLALYVYEYLTHVGAPKAAQTFFKEIQWDRAVQLSEPPGFLFSWWSVFWDLYCAAPERRDTTEHSNEAKAFHDYGFINSGQCNGF 103          
The following BLAST results are available for this feature:
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SSBP34.462e-4171.74single stranded DNA binding protein 3 [Source:HGNC... [more]
SSBP34.995e-4171.74single stranded DNA binding protein 3 [Source:HGNC... [more]
SSBP26.820e-4170.41single stranded DNA binding protein 2 [Source:HGNC... [more]
SSBP37.113e-4171.74single stranded DNA binding protein 3 [Source:HGNC... [more]
SSBP28.645e-4171.13single stranded DNA binding protein 2 [Source:HGNC... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sam-101.729e-1440.43Single-stranded DNA-binding protein homolog sam-10... [more]
sam-101.729e-1440.43Single-stranded DNA-binding protein homolog sam-10... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ssdp1.741e-4269.70gene:FBgn0011481 transcript:FBtr0083612[more]
Ssdp1.741e-4269.70gene:FBgn0011481 transcript:FBtr0083611[more]
Ssdp1.741e-4269.70gene:FBgn0011481 transcript:FBtr0083613[more]
Ssdp5.195e-4269.70gene:FBgn0011481 transcript:FBtr0330051[more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssbp3b4.009e-4272.83single stranded DNA binding protein 3b [Source:ZFI... [more]
ssbp3b7.443e-4272.83single stranded DNA binding protein 3b [Source:ZFI... [more]
ssbp3b1.147e-4172.83single stranded DNA binding protein 3b [Source:ZFI... [more]
si:ch211-130m23.34.047e-4173.91si:ch211-130m23.3 [Source:ZFIN;Acc:ZDB-GENE-060531... [more]
zgc:1101584.781e-4171.74zgc:110158 [Source:ZFIN;Acc:ZDB-GENE-050522-195][more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssbp26.644e-4372.63single-stranded DNA binding protein 2 [Source:NCBI... [more]
ssbp21.943e-4273.91single-stranded DNA binding protein 2 [Source:NCBI... [more]
ssbp22.844e-4273.91single-stranded DNA binding protein 2 [Source:NCBI... [more]
ssbp24.204e-4273.91single-stranded DNA binding protein 2 [Source:NCBI... [more]
ssbp24.433e-4273.91single-stranded DNA binding protein 2 [Source:NCBI... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ssbp34.637e-4271.74single-stranded DNA binding protein 3 [Source:MGI ... [more]
Ssbp33.063e-4171.74single-stranded DNA binding protein 3 [Source:MGI ... [more]
Ssbp33.429e-4171.74single-stranded DNA binding protein 3 [Source:MGI ... [more]
Ssbp34.884e-4171.74single-stranded DNA binding protein 3 [Source:MGI ... [more]
Ssbp25.935e-4171.13single-stranded DNA binding protein 2 [Source:MGI ... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R050|SSBP3_RAT1.916e-4071.74Single-stranded DNA-binding protein 3 OS=Rattus no... [more]
sp|Q98948|SSBP3_CHICK2.682e-4071.74Single-stranded DNA-binding protein 3 OS=Gallus ga... [more]
sp|Q9D032|SSBP3_MOUSE3.416e-4071.74Single-stranded DNA-binding protein 3 OS=Mus muscu... [more]
sp|Q9BWW4|SSBP3_HUMAN3.416e-4071.74Single-stranded DNA-binding protein 3 OS=Homo sapi... [more]
sp|Q9CYZ8|SSBP2_MOUSE3.320e-3972.34Single-stranded DNA-binding protein 2 OS=Mus muscu... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6VMT01.700e-4671.96LisH domain-containing protein (Fragment) OS=Ostri... [more]
A0A2H1CP503.661e-4672.38LisH domain-containing protein OS=Fasciola hepatic... [more]
A0A1B6ECV91.288e-4571.43LisH domain-containing protein OS=Clastoptera ariz... [more]
A0A1E1WU431.605e-4571.03LisH domain-containing protein (Fragment) OS=Pecti... [more]
A0A4Y2F4E42.290e-4571.96Single-stranded DNA-binding protein 3 OS=Araneus v... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssbp3b2.077e-4171.74single-stranded DNA-binding protein 3-like [Source... [more]
ssbp43.079e-4171.74single-stranded DNA-binding protein 3 [Source:NCBI... [more]
ssbp3b3.350e-4171.74single-stranded DNA-binding protein 3-like [Source... [more]
ssbp45.799e-4171.74single-stranded DNA-binding protein 3 [Source:NCBI... [more]
zgc:1101586.353e-4171.74single-stranded DNA-binding protein 3-like [Source... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO390272.043e-4269.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278375.368e-2465.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssbp3b1.548e-4275.00single-stranded DNA-binding protein 3 [Source:NCBI... [more]
ssbp3b2.236e-4275.00single-stranded DNA-binding protein 3 [Source:NCBI... [more]
si:ch211-130m23.31.100e-4171.74single stranded DNA binding protein 2 [Source:NCBI... [more]
si:ch211-130m23.32.083e-4171.74single stranded DNA binding protein 2 [Source:NCBI... [more]
ENSORLT00000017476.22.754e-4171.74single-stranded DNA-binding protein 3 [Source:NCBI... [more]
back to top
BLAST of Single-stranded DNA-binding protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052079.10.000e+099.77SMESG000052079.1[more]
SMESG000052079.10.000e+096.13SMESG000052079.1[more]
SMESG000044349.11.768e-4166.99SMESG000044349.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003736 ID=SMED30003736|Name=Single-stranded DNA-binding protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1578bp
ATATATTCCAAATATGGTGTTTTAATATTTTGAATTATTTATCAACATTT
ATTTCTATAAGTTTTTAAAAAAATTAAATTTAATCGTACAATGTTTCCAA
AAGGTAAAGCCCCATCAGTGCCATCCGATTCACAAGCAAAAGAAAAGTTA
GCAAGTCATGTTTATGAATATCTAATTCACATTGGAGCAACTAAAGCCGC
ACAAACGTTTTTACAAGAAATGCATTGGGAAAAACCATGGCAAATTGGTG
AATCTCCTGGATTTTTAAATCAATGGTGGTGTGTTTTTTATGATTTATAC
AGTGCCGCCCCAGAAAGACGAGAAACATTTGAGCATTCAAGCGAAGCTAA
AGCATTTCACGATTACGGTTTTGTTAATTCTGGCTATCCAAATGGATTAC
CAAGAAATCCATCAATACCCAGTCCTATTAGCGGTGGAATGCCACCTACA
GGAGGAAGACCTCCATCATCACAAGGTATTATACCACCAGATAATAATAT
TCATACTCCAGTCTCTATCCAAGGTGGTCCGATGCTAGTTCCAGGAAGCT
CATTCTTCCCTCCTGGACATCCTATGCCTAACATCAGTGGACAGCCTATA
GATCTTATGAGAAACAGAAGTGTTCCTTACTCTATTCGATTTCCACAAGG
TACGTTAATGCCTAGTTATCATCCAGCAGGGGCAATGCCTAGACACAGGT
TTATGGGAAATCCAGCTTCTTCACTTGGTATAGTTCATAGTCCAGGTCCT
TCCGGAACTCCTCAAGCAGGTCCTCAGATAATGGCAAGCCCCAATGATAG
TTTACAAAATGAGTTACAACAAAACAATCCCGGTCAAGATCCATTTGGAC
CAAATGGTTCGTCTAGGAGTCCATCTCATGTTATTTCTCAACCAGCTCCA
GCGTTTCCTCCACCGCCCGCCTCTGAAAGCAATTCAGATCAACAAAATTC
ATCTGGTATGATGAATGGTGGAAACGGTGGACCACAAATGCCTCAGTTCT
CACAACATCAGTCTCATACTATGGAATATATGCCGTCTTCAGGAATGAAT
TTTGAGCCGCCAGTCTCAATGAAACATTCACCCCAGTTGCACAATCCAAA
TATGGAAGTAATTGCAACTATGGGAAATAATATCGCCGATTATTGCAACC
CAATGCCTCCAAACGGTCCTTCATTTTCAGATCATGCAATGAGAGTCAGT
CAATCATCAGTATCAATGGGTGTTCAGCCTATTTCACAGCTCCATATGAT
GCATCAAGGTATTGGGTCTCATCATGGATCGCTTAATATGCAATCCATGC
CCGGAGGACCGTCCAATTCTGCACAATTTATATCTCATCAAGGAGGTTCT
ATCAACGCCAGTCCTCAATTTCCAGATTACGGATTCACATCTATGTCACA
AGCTATCTGACAAAATGACGTATGAGTAGATGCGCGCGCACGCCAGTTGA
GGCCGGCGTCAAACTGTATAGTGTTACATAAAATATAAATTGTATATAAG
CATGCAGTACAGTTGGATCAATAAATTTTAATAATGAATTTGAATTTATA
CAGATGCACTTCATTTTTATGTAGACTT
back to top

protein sequence of SMED30003736-orf-1

>SMED30003736-orf-1 ID=SMED30003736-orf-1|Name=SMED30003736-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=440bp
MFPKGKAPSVPSDSQAKEKLASHVYEYLIHIGATKAAQTFLQEMHWEKPW
QIGESPGFLNQWWCVFYDLYSAAPERRETFEHSSEAKAFHDYGFVNSGYP
NGLPRNPSIPSPISGGMPPTGGRPPSSQGIIPPDNNIHTPVSIQGGPMLV
PGSSFFPPGHPMPNISGQPIDLMRNRSVPYSIRFPQGTLMPSYHPAGAMP
RHRFMGNPASSLGIVHSPGPSGTPQAGPQIMASPNDSLQNELQQNNPGQD
PFGPNGSSRSPSHVISQPAPAFPPPPASESNSDQQNSSGMMNGGNGGPQM
PQFSQHQSHTMEYMPSSGMNFEPPVSMKHSPQLHNPNMEVIATMGNNIAD
YCNPMPPNGPSFSDHAMRVSQSSVSMGVQPISQLHMMHQGIGSHHGSLNM
QSMPGGPSNSAQFISHQGGSINASPQFPDYGFTSMSQAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR008116SSDP_DNA-bd
IPR006594LisH
Vocabulary: molecular function
TermDefinition
GO:0003697single-stranded DNA binding
GO:0005515protein binding
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008116Sequence-specific single-strand DNA-binding proteinPRINTSPR01743SSDNABINDINGcoord: 77..92
score: 87.15
coord: 8..27
score: 72.22
coord: 45..62
score: 55.56
coord: 63..76
score: 84.52
coord: 29..44
score: 63.54
IPR006594LIS1 homology motifSMARTSM00667Lishcoord: 16..48
e-value: 0.0025
score: 27.0
IPR006594LIS1 homology motifPROSITEPS50896LISHcoord: 16..48
score: 9.325
NoneNo IPR availablePFAMPF04503SSDPcoord: 81..203
e-value: 2.4E-6
score: 28.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 253..287
NoneNo IPR availablePANTHERPTHR12610SINGLE STRANDED DNA BINDING PROTEINcoord: 5..416