Nuclear receptor subfamily 2, group F, member 2

Overview
NameNuclear receptor subfamily 2, group F, member 2
Smed IDSMED30003731
Length (bp)1797
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear receptor subfamily 2, group F, member 2 (SMED30003731) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear receptor subfamily 2, group F, member 2 (SMED30003731) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear receptor subfamily 2, group F, member 2 (SMED30003731) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear receptor subfamily 2, group F, member 2 (SMED30003731) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003731

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003731SMESG000056421.1 SmedASXL_007853SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003731SMESG000056421.1 SmedASXL_010909SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003731SMESG000056421.1 dd_Smed_v6_33286_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Human
Match: NR2F1 (nuclear receptor subfamily 2 group F member 1 [Source:HGNC Symbol;Acc:HGNC:7975])

HSP 1 Score: 392.119 bits (1006), Expect = 7.411e-132
Identity = 182/360 (50.56%), Postives = 251/360 (69.72%), Query Frame = 2
Query:  458 QDSEDNKLGNN-------------IECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +D +D+  G N             IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:    9 RDPQDDVAGGNPGGPNPAAQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 354          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Human
Match: NR2F1 (nuclear receptor subfamily 2 group F member 1 [Source:HGNC Symbol;Acc:HGNC:7975])

HSP 1 Score: 392.119 bits (1006), Expect = 1.550e-131
Identity = 178/337 (52.82%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   58 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 380          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Human
Match: NR2F1 (nuclear receptor subfamily 2 group F member 1 [Source:HGNC Symbol;Acc:HGNC:7975])

HSP 1 Score: 392.119 bits (1006), Expect = 3.570e-131
Identity = 178/337 (52.82%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   83 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 405          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Human
Match: NR2F2 (nuclear receptor subfamily 2 group F member 2 [Source:HGNC Symbol;Acc:HGNC:7976])

HSP 1 Score: 391.349 bits (1004), Expect = 5.069e-131
Identity = 182/346 (52.60%), Postives = 248/346 (71.68%), Query Frame = 2
Query:  464 SEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            S+  +   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNL+Y+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P     +GQ+ A T G      SY + +I ++++ +   +            S   + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   68 SDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQF-ALTNGDPLNCHSYLSGYISLLLRAEPYPT------------SRFGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 398          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Human
Match: NR2F6 (nuclear receptor subfamily 2 group F member 6 [Source:HGNC Symbol;Acc:HGNC:7977])

HSP 1 Score: 307.375 bits (786), Expect = 1.505e-98
Identity = 157/350 (44.86%), Postives = 227/350 (64.86%), Query Frame = 2
Query:  458 QDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHS-------NICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +  ++ + G  ++CVVCGDKSSGKHYG +TCEGCKSFFKRS+RRNL+Y+CR N +C ID HHRNQCQ CR +KC ++GMRKEAVQ+GRIP         +A++ GS   +    +    D +   Q     +  L                  +     GID++ ++A+++L   ++W++  PFFP+L + DQ+ LL+ SWSELF+L +A ++ PLH APLLA+ GL   P+ AE+ V  +D +R  Q+Q++KL + Q+DSAE+ CLKA+ LF  D  GLSDP +VE +QE  Q AL EY +  YP+Q  RFG+LLLR+P L+++ +S+I +L F RL+G   +  LI++
Sbjct:   43 EPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPH---SLPGAVAASSGSPPGSALAAVASGGD-LFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRD 388          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Celegans
Match: unc-55 (Nuclear hormone receptor unc-55 [Source:UniProtKB/Swiss-Prot;Acc:G5ECR9])

HSP 1 Score: 187.193 bits (474), Expect = 9.701e-54
Identity = 119/358 (33.24%), Postives = 190/358 (53.07%), Query Frame = 2
Query:  479 LGNN----IECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLL--------------ASVGLQVNPVGAEKV----VILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            LGN+     +CVVCGDKSSGKHYGQ++CEGCKSFFKRS+RR+L+Y+CR   NC ID+ HRNQCQ CR  KC++MGMRKE VQ+GR+P         + S +  + F R                   FM+  F    N   T    K    +SI++ A++ +   + W+++     +L   DQ+ LL+ SW+ +F+   A S+  L+L+  L              +S+G +       +     V      +  Q +I+K++ F +D  E S L+A++LF+ D   L +   +E I E +++A++EY K +  ++  R+ ++   +  LKS  +  I  L F+RL+G   +  ++ +
Sbjct:   11 LGNSSPDATDCVVCGDKSSGKHYGQFSCEGCKSFFKRSIRRSLSYTCRATKNCAIDVQHRNQCQYCRLTKCIRMGMRKE-VQRGRLP-------VTMPSLFPPNMFLR---------------SPFPFMSVPF----NPLMTAQFTKPSIKESIFEFAAQTIFATVNWARTS--MSNLVKGDQLILLRHSWTPIFIFALAQSNFALNLSTHLTAVTATAASTENGSSSLGSKSEDEEKSEEKPERVFDEPQFQGFQAKIDKIRDFHLDVVESSSLRAVLLFSCDEEALEEKGKIEEIVEKLKSAVDEYCKMNKRSE--RYHQICECLQLLKSTRNLPISRLFFSRLLGTTPLETILSD 337          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Celegans
Match: unc-55 (Nuclear hormone receptor unc-55 [Source:UniProtKB/Swiss-Prot;Acc:G5ECR9])

HSP 1 Score: 185.267 bits (469), Expect = 8.207e-53
Identity = 120/370 (32.43%), Postives = 191/370 (51.62%), Query Frame = 2
Query:  479 LGNN----IECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKE------------AVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLL--------------ASVGLQVNPVGAEKV----VILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            LGN+     +CVVCGDKSSGKHYGQ++CEGCKSFFKRS+RR+L+Y+CR   NC ID+ HRNQCQ CR  KC++MGMRKE            AVQ+GR+P         + S +  + F R                   FM+  F    N   T    K    +SI++ A++ +   + W+++     +L   DQ+ LL+ SW+ +F+   A S+  L+L+  L              +S+G +       +     V      +  Q +I+K++ F +D  E S L+A++LF+ D   L +   +E I E +++A++EY K +  ++  R+ ++   +  LKS  +  I  L F+RL+G   +  ++ +
Sbjct:   11 LGNSSPDATDCVVCGDKSSGKHYGQFSCEGCKSFFKRSIRRSLSYTCRATKNCAIDVQHRNQCQYCRLTKCIRMGMRKEGRRSNETQTAVSAVQRGRLP-------VTMPSLFPPNMFLR---------------SPFPFMSVPF----NPLMTAQFTKPSIKESIFEFAAQTIFATVNWARTS--MSNLVKGDQLILLRHSWTPIFIFALAQSNFALNLSTHLTAVTATAASTENGSSSLGSKSEDEEKSEEKPERVFDEPQFQGFQAKIDKIRDFHLDVVESSSLRAVLLFSCDEEALEEKGKIEEIVEKLKSAVDEYCKMNKRSE--RYHQICECLQLLKSTRNLPISRLFFSRLLGTTPLETILSD 350          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Celegans
Match: nhr-14 (Nuclear hormone receptor family member nhr-14 [Source:UniProtKB/Swiss-Prot;Acc:O02151])

HSP 1 Score: 159.458 bits (402), Expect = 8.265e-43
Identity = 110/343 (32.07%), Postives = 165/343 (48.10%), Query Frame = 2
Query:  497 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIAS-----------------TYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHI-RLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQIT-----RFGKLLLRIPQLKSINSSIIEELLFTRLIG 1456
            CVVCGDK+ GKHYG   C GCK FF+RSV +NL Y+CR N  C ID  HRN C+ CRFQKCL  GM+ EA+Q  R    S+   +   +                   G+S   + I M++  +  L+  +    MN L  + S + ++                 + ++ +I W+  +   P++ + D++ LLK   S   LL +   S  L   P       QV  + A     L + + R+I + +  L++ + D AEFSCLKAL+L N D+ G+S+    E I+E     L+    +    Q +     R   LL+ IP L S++SSI+E    + L G
Sbjct:   20 CVVCGDKAIGKHYGAVACNGCKGFFRRSVWQNLQYTCRFNKQCNIDKDHRNACRYCRFQKCLADGMKPEAIQNERDRIGSTKRRKRSGANSENNSDSEGTPSPKIEVMGNSVSRKLIEMLLDIEHRLASNQS---MNALLRDESEMKNSRQ---------------RAVNYLIGWTNMLHPLPEVPLADKVLLLKKFSSAFTLLGTLQRSMAL---PHFVLPNDQVLSISASHPPELFEALTRIIDELLTPLRRLRTDHAEFSCLKALLLLNPDVVGISNNTR-ERIREARDALLKTLFAYMSNTQNSIDASLRVSSLLMIIPSLISVSSSIMEFPALSDLFG 340          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Celegans
Match: nhr-14 (Nuclear hormone receptor family member nhr-14 [Source:UniProtKB/Swiss-Prot;Acc:O02151])

HSP 1 Score: 158.688 bits (400), Expect = 1.779e-42
Identity = 111/347 (31.99%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  497 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIAS-----------------TYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHI-RLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQIT-----RFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSV 1468
            CVVCGDK+ GKHYG   C GCK FF+RSV +NL Y+CR N  C ID  HRN C+ CRFQKCL  GM+ EA+Q  R    S+   +   +                   G+S   + I M++  +  L+  +    MN L  + S + ++                 + ++ +I W+  +   P++ + D++ LLK   S   LL +   S  L   P       QV  + A     L + + R+I + +  L++ + D AEFSCLKAL+L N D+ G+S+    E I+E     L+    +    Q +     R   LL+ IP L S++SSI+E    + L G   V
Sbjct:   20 CVVCGDKAIGKHYGAVACNGCKGFFRRSVWQNLQYTCRFNKQCNIDKDHRNACRYCRFQKCLADGMKPEAIQNERDRIGSTKRRKRSGANSENNSDSEGTPSPKIEVMGNSVSRKLIEMLLDIEHRLASNQS---MNALLRDESEMKNSRQ---------------RAVNYLIGWTNMLHPLPEVPLADKVLLLKKFSSAFTLLGTLQRSMAL---PHFVLPNDQVLSISASHPPELFEALTRIIDELLTPLRRLRTDHAEFSCLKALLLLNPDVVGISNNTR-ERIREARDALLKTLFAYMSNTQNSIDASLRVSSLLMIIPSLISVSSSIMEFPALSDLFGLGDV 344          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Celegans
Match: nhr-14 (Nuclear hormone receptor family member nhr-14 [Source:UniProtKB/Swiss-Prot;Acc:O02151])

HSP 1 Score: 158.688 bits (400), Expect = 1.779e-42
Identity = 111/347 (31.99%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  497 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIAS-----------------TYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHI-RLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQIT-----RFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSV 1468
            CVVCGDK+ GKHYG   C GCK FF+RSV +NL Y+CR N  C ID  HRN C+ CRFQKCL  GM+ EA+Q  R    S+   +   +                   G+S   + I M++  +  L+  +    MN L  + S + ++                 + ++ +I W+  +   P++ + D++ LLK   S   LL +   S  L   P       QV  + A     L + + R+I + +  L++ + D AEFSCLKAL+L N D+ G+S+    E I+E     L+    +    Q +     R   LL+ IP L S++SSI+E    + L G   V
Sbjct:   20 CVVCGDKAIGKHYGAVACNGCKGFFRRSVWQNLQYTCRFNKQCNIDKDHRNACRYCRFQKCLADGMKPEAIQNERDRIGSTKRRKRSGANSENNSDSEGTPSPKIEVMGNSVSRKLIEMLLDIEHRLASNQS---MNALLRDESEMKNSRQ---------------RAVNYLIGWTNMLHPLPEVPLADKVLLLKKFSSAFTLLGTLQRSMAL---PHFVLPNDQVLSISASHPPELFEALTRIIDELLTPLRRLRTDHAEFSCLKALLLLNPDVVGISNNTR-ERIREARDALLKTLFAYMSNTQNSIDASLRVSSLLMIIPSLISVSSSIMEFPALSDLFGLGDV 344          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0082564)

HSP 1 Score: 392.889 bits (1008), Expect = 3.755e-130
Identity = 181/346 (52.31%), Postives = 243/346 (70.23%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQ----FSSHYGQY---------IASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            NIECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTYSCRG+ NCPID HHRNQCQ CR +KCLKMGMR+EAVQ+GR+P      +  +GQY         IA   G SY + +I ++++ +   +               S            GID+I ++A+++L   ++W+K+IPFFP+L +TDQ+ LL+  WSELF+L ++  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  ++E +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++S +IE+L F RL+G   +  LI++
Sbjct:  197 NIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYISLLLRAEPYPT---------------SRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIETLIRD 527          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0331183)

HSP 1 Score: 393.275 bits (1009), Expect = 4.339e-130
Identity = 181/346 (52.31%), Postives = 243/346 (70.23%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQ----FSSHYGQY---------IASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            NIECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTYSCRG+ NCPID HHRNQCQ CR +KCLKMGMR+EAVQ+GR+P      +  +GQY         IA   G SY + +I ++++ +   +               S            GID+I ++A+++L   ++W+K+IPFFP+L +TDQ+ LL+  WSELF+L ++  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  ++E +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++S +IE+L F RL+G   +  LI++
Sbjct:  197 NIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYISLLLRAEPYPT---------------SRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIETLIRD 527          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0082563)

HSP 1 Score: 310.071 bits (793), Expect = 6.141e-96
Identity = 142/271 (52.40%), Postives = 189/271 (69.74%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQ----FSSHYGQY---------IASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNS 1261
            NIECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTYSCRG+ NCPID HHRNQCQ CR +KCLKMGMR+EAVQ+GR+P      +  +GQY         IA   G SY + +I ++++ +   +               S            GID+I ++A+++L   ++W+K+IPFFP+L +TDQ+ LL+  WSELF+L ++  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +
Sbjct:  197 NIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYISLLLRAEPYPT---------------SRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTT 452          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0082562)

HSP 1 Score: 255.373 bits (651), Expect = 1.736e-80
Identity = 122/280 (43.57%), Postives = 181/280 (64.64%), Query Frame = 2
Query:  686 MGMRKEAVQQGRIPQ----FSSHYGQY---------IASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            MGMR+EAVQ+GR+P      +  +GQY         IA   G SY + +I ++++ +   +               S            GID+I ++A+++L   ++W+K+IPFFP+L +TDQ+ LL+  WSELF+L ++  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  ++E +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++S +IE+L F RL+G   +  LI++
Sbjct:    1 MGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYISLLLRAEPYPT---------------SRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIETLIRD 265          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Fly
Match: Hnf4 (gene:FBgn0004914 transcript:FBtr0344784)

HSP 1 Score: 189.889 bits (481), Expect = 5.906e-52
Identity = 110/344 (31.98%), Postives = 178/344 (51.74%), Query Frame = 2
Query:  497 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPL--------------HLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            C +CGD+++GKHYG  +C+GCK FF+RSVR+N  Y+CR   NC +D   RNQC+ CR +KC K GM+KEAVQ  R             S       N    + +      S+Q K G      +   NI +  S +++  I+ + +   + L  +++W+K IP F +L + DQ+ LL++   E  LL  +  S  L              H    L S  L ++ +GA          R+I + +  +K   ID  EF+C+KALV F+ + +GL++P  ++ ++  + N LE+Y          RFG++LL +P L+SI   +IE++ F ++ G   + +L++E
Sbjct:  104 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNER-----DRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGA-----AMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHLKDVLLLSNNCVITRHCPDPLVSPNLDISRIGA----------RIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQE 427          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Zebrafish
Match: nr2f2 (nuclear receptor subfamily 2, group F, member 2 [Source:ZFIN;Acc:ZDB-GENE-990415-252])

HSP 1 Score: 398.282 bits (1022), Expect = 7.241e-134
Identity = 184/349 (52.72%), Postives = 250/349 (71.63%), Query Frame = 2
Query:  455 NQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
             Q   + +   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   73 TQSQSEKQQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 406          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Zebrafish
Match: nr2f1a (nuclear receptor subfamily 2, group F, member 1a [Source:NCBI gene;Acc:30418])

HSP 1 Score: 392.889 bits (1008), Expect = 8.134e-132
Identity = 177/337 (52.52%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SC+KA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   73 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCIKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 395          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Zebrafish
Match: nr2f2 (nuclear receptor subfamily 2, group F, member 2 [Source:ZFIN;Acc:ZDB-GENE-990415-252])

HSP 1 Score: 392.119 bits (1006), Expect = 2.354e-131
Identity = 184/355 (51.83%), Postives = 250/355 (70.42%), Query Frame = 2
Query:  455 NQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKE------AVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
             Q   + +   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+E      AVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   73 TQSQSEKQQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREVSLFTAAVQRGRMPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 412          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Zebrafish
Match: nr2f1b (nuclear receptor subfamily 2, group F, member 1b [Source:NCBI gene;Acc:393564])

HSP 1 Score: 386.341 bits (991), Expect = 1.275e-129
Identity = 176/337 (52.23%), Postives = 243/337 (72.11%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            ++ECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNL+Y+CR N NCP+D HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    +   Y  +      G  Y + +I ++++ +   +            S + N C  +      GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A SS PLH+APLLA+ GL  +P+ A++VV  +DHIR  Q+Q+EKLK  Q+DSAE+SC KA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L+ ++SS+IE+L F RL+G   +  LI++
Sbjct:   51 HVECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPVDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPNQPNPSHYALTNGDHLNGQCYLSGYISLLLRAEPYPA------------SRYGNQCMQSG--NIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQSSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRFFQEQVEKLKALQVDSAEYSCAKAIVLFTSDACGLSDIPHIEGLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPALRMVSSSVIEQLFFVRLVGKTPIETLIRD 373          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Zebrafish
Match: nr2f5 (nuclear receptor subfamily 2, group F, member 5 [Source:NCBI gene;Acc:30427])

HSP 1 Score: 367.081 bits (941), Expect = 8.075e-122
Identity = 176/337 (52.23%), Postives = 244/337 (72.40%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            N++C+VCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNL+Y+CRGN +CPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+    S  GQY+++      G  Y + FI ++++ +   + +     M    SN+             GI++I ++A+++L   ++W+K+IPFFPDL + DQ+ LL+ SWSELF+L +A  S PLH+APLLA+ GL  +P+ AE+VV  +DHIR+ Q+Q+EKLK  Q+D+AE+SCLK++VLF SD  GLSD  +VE IQE  Q ALEEY +  YPNQ  RFG+LLLR+P L+ ++S +IE+L F RL+G   +  L+++
Sbjct:   51 NVDCMVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMSNSQSSPGQYLSNGSDPYNGQPYLSGFISLLLRAEPYPTSRYGAQCMQ---SNN-----------LMGIENICELAARLLFSAVEWAKNIPFFPDLQLMDQVALLRMSWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDAMGLSDVAHVESIQEKSQCALEEYVRNQYPNQPNRFGRLLLRLPSLRIVSSPVIEQLFFVRLVGKTPIETLLRD 373          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Xenopus
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:Xenbase;Acc:XB-GENE-5786365])

HSP 1 Score: 391.734 bits (1005), Expect = 1.834e-131
Identity = 178/337 (52.82%), Postives = 244/337 (72.40%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   54 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 376          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Xenopus
Match: nr2f2 (nuclear receptor subfamily 2 group F member 2 [Source:NCBI gene;Acc:100038039])

HSP 1 Score: 392.119 bits (1006), Expect = 2.166e-131
Identity = 182/338 (53.85%), Postives = 245/338 (72.49%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P     +GQ+ A T G      SY + +I ++++ +   +            S   + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   70 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQF-ALTNGDPLNCHSYLSGYISLLLRAEPYPT------------SRFGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 392          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Xenopus
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:Xenbase;Acc:XB-GENE-5786365])

HSP 1 Score: 386.341 bits (991), Expect = 4.041e-129
Identity = 177/337 (52.52%), Postives = 243/337 (72.11%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+E VQ+GR+P    + GQY  +      G  Y + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   71 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRRE-VQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 392          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Xenopus
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:Xenbase;Acc:XB-GENE-5786365])

HSP 1 Score: 383.645 bits (984), Expect = 2.121e-128
Identity = 175/325 (53.85%), Postives = 237/325 (72.92%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRL 1450
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL
Sbjct:   71 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRL 381          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Xenopus
Match: uhrf2 (ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6054034])

HSP 1 Score: 360.918 bits (925), Expect = 1.962e-119
Identity = 174/337 (51.63%), Postives = 239/337 (70.92%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQY----IASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            N++C+VCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CRGN +CPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+    +  GQY    +    G SY   FI ++++ +   +            S +   C         GI++I ++A+++L   I+W+K+IPFFPD  ++DQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+ LF  D  GLSD  +VE IQE  Q ALEEY +  YPNQ TRFG+LLLR+P L+ +++ +IE+L F RL+G   +  LI++
Sbjct:   60 NVDCLVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMSHPQTSPGQYTLNNVDPYNGHSYLTGFISLLLRAEPYPT------------SRYGAQC--LQPNNIMGIENICELAARLLFSAIEWAKNIPFFPDFQLSDQVSLLRMTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRVFQEQVEKLKALHVDSAEYSCLKAIALFTPDAVGLSDIGHVESIQEKSQCALEEYVRNQYPNQPTRFGRLLLRLPSLRIVSAPVIEQLFFVRLVGKTPIETLIRD 382          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Mouse
Match: Nr2f1 (nuclear receptor subfamily 2, group F, member 1 [Source:MGI Symbol;Acc:MGI:1352451])

HSP 1 Score: 392.504 bits (1007), Expect = 1.787e-131
Identity = 178/337 (52.82%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   80 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 402          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Mouse
Match: Nr2f2 (nuclear receptor subfamily 2, group F, member 2 [Source:MGI Symbol;Acc:MGI:1352452])

HSP 1 Score: 391.349 bits (1004), Expect = 3.480e-131
Identity = 182/346 (52.60%), Postives = 248/346 (71.68%), Query Frame = 2
Query:  464 SEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            S+  +   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNL+Y+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P     +GQ+ A T G      SY + +I ++++ +   +            S   + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   68 SDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQF-ALTNGDPLNCHSYLSGYISLLLRAEPYPT------------SRFGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 398          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Mouse
Match: Nr2f6 (nuclear receptor subfamily 2, group F, member 6 [Source:MGI Symbol;Acc:MGI:1352453])

HSP 1 Score: 310.842 bits (795), Expect = 3.273e-100
Identity = 157/344 (45.64%), Postives = 226/344 (65.70%), Query Frame = 2
Query:  458 QDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQN-DSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +  ++ + G  ++CVVCGDKSSGKHYG +TCEGCKSFFKRS+RRNL+Y+CR N +C ID HHRNQCQ CR +KC ++GMRKEAVQ+GRIP   +  G    S  G++    F G  +    + L + E           +             GID++ ++A+++L   ++W++  PFFP+L   DQ+ LL+ SWSELF+L +A ++ PLH APLLA+ GL   P+ AE+ V  +D +R  Q+Q++KL + Q+D+AE+ CLKA+ LF  D  GLSDP +VE +QE  Q AL EY +  YP+Q  RFG+LLLR+P L+++ +S+I +L F RL+G   +  LI++
Sbjct:   44 EPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPH--ALPGPAACSPPGATGVEPFTGPPVSELIAQLLRAEP----------YPAAGRFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDAAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRD 375          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Mouse
Match: Rxrg (retinoid X receptor gamma [Source:MGI Symbol;Acc:MGI:98216])

HSP 1 Score: 256.529 bits (654), Expect = 5.961e-80
Identity = 134/331 (40.48%), Postives = 199/331 (60.12%), Query Frame = 2
Query:  497 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQND-SMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            C +CGD+SSGKHYG Y+CEGCK FFKR++R++L Y+CR N +C ID   RN+CQ CR+QKCL MGM++EAVQ+ R  Q S    +  A    SS+ +  +  +++ + ++  K E  G MN    N +N            + +I   A K L  +++W+K IP F DL++ DQ+ LL++ W+EL + + +H S  +    LLA+ GL V+   A    +     R++ + + K+K  Q+D +E  CL+A+VLFN D +GLS+P  VE ++E V   LE Y K  YP Q  RF KLLLR+P L+SI    +E L F +LIG+  + + + E
Sbjct:   16 CAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEER--QRSRERAESEAECASSSHEDMPVERILEAELAVEPKTESYGDMN--VENSTND----------PVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLAT-GLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLME 331          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Mouse
Match: Rxrg (retinoid X receptor gamma [Source:MGI Symbol;Acc:MGI:98216])

HSP 1 Score: 256.529 bits (654), Expect = 2.442e-78
Identity = 133/331 (40.18%), Postives = 202/331 (61.03%), Query Frame = 2
Query:  497 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQND-SMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            C +CGD+SSGKHYG Y+CEGCK FFKR++R++L Y+CR N +C ID   RN+CQ CR+QKCL MGM++EAVQ+ R  Q S    +  A    SS+ +  +  +++ + ++  K E  G M        N+ ++T++     + +I   A K L  +++W+K IP F DL++ DQ+ LL++ W+EL + + +H S  +    LLA+ GL V+   A    +     R++ + + K+K  Q+D +E  CL+A+VLFN D +GLS+P  VE ++E V   LE Y K  YP Q  RF KLLLR+P L+SI    +E L F +LIG+  + + + E
Sbjct:  139 CAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEER--QRSRERAESEAECASSSHEDMPVERILEAELAVEPKTESYGDM--------NVENSTNDP----VTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLAT-GLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLME 454          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. UniProt/SwissProt
Match: sp|Q06725|N2F1A_DANRE (Nuclear receptor subfamily 2 group F member 1-A OS=Danio rerio OX=7955 GN=nr2f1a PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 6.140e-131
Identity = 177/337 (52.52%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SC+KA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   73 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCIKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 395          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. UniProt/SwissProt
Match: sp|Q9TTR8|COT1_BOVIN (COUP transcription factor 1 OS=Bos taurus OX=9913 GN=NR2F1 PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.367e-130
Identity = 178/337 (52.82%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   84 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 406          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. UniProt/SwissProt
Match: sp|Q60632|COT1_MOUSE (COUP transcription factor 1 OS=Mus musculus OX=10090 GN=Nr2f1 PE=2 SV=2)

HSP 1 Score: 392.119 bits (1006), Expect = 1.441e-130
Identity = 178/337 (52.82%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   82 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 404          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. UniProt/SwissProt
Match: sp|P10589|COT1_HUMAN (COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.715e-130
Identity = 178/337 (52.82%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   83 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 405          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. UniProt/SwissProt
Match: sp|Q9TTR7|COT2_BOVIN (COUP transcription factor 2 OS=Bos taurus OX=9913 GN=NR2F2 PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.306e-130
Identity = 182/346 (52.60%), Postives = 248/346 (71.68%), Query Frame = 2
Query:  464 SEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            S+  +   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNL+Y+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P     +GQ+ A T G      SY + +I ++++ +   +            S   + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   68 SDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPSHGQF-ALTNGDPLNCHSYLSGYISLLLRAEPYPT------------SRFGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 398          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. TrEMBL
Match: A0A3B5L1Z7 (Nuclear receptor subfamily 2, group F, member 2 OS=Xiphophorus couchianus OX=32473 PE=3 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 1.194e-131
Identity = 185/348 (53.16%), Postives = 251/348 (72.13%), Query Frame = 2
Query:  458 QDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            Q   +NK   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   55 QGPPNNKQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRVPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 387          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. TrEMBL
Match: H2T3L6 (Nuclear receptor subfamily 2, group F, member 2 OS=Takifugu rubripes OX=31033 GN=nr2f2 PE=3 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 2.761e-131
Identity = 186/350 (53.14%), Postives = 254/350 (72.57%), Query Frame = 2
Query:  455 NQDSEDN-KLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            NQ S+ + K   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   67 NQTSQQSEKQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRVPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNAVMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 401          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. TrEMBL
Match: A0A5C6PC70 (COUP transcription factor 1 OS=Takifugu flavidus OX=433684 GN=D4764_13G0010200 PE=3 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 2.761e-131
Identity = 186/350 (53.14%), Postives = 254/350 (72.57%), Query Frame = 2
Query:  455 NQDSEDN-KLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            NQ S+ + K   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   67 NQTSQQSEKQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRVPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNAVMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 401          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. TrEMBL
Match: H3C2L3 (Nuclear receptor subfamily 2, group F, member 2 OS=Tetraodon nigroviridis OX=99883 PE=3 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 3.390e-131
Identity = 186/350 (53.14%), Postives = 254/350 (72.57%), Query Frame = 2
Query:  455 NQDSEDN-KLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            NQ S+ + K   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   56 NQTSQQSEKQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRVPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNAVMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 390          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. TrEMBL
Match: W5Q5F6 (Nuclear receptor subfamily 2 group F member 1 OS=Ovis aries OX=9940 GN=NR2F1 PE=3 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 4.875e-131
Identity = 181/337 (53.71%), Postives = 249/337 (73.89%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +   +   + G + H+  N  NI          GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   45 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSAAR-GALPHVAPN--NI---------MGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 369          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Cavefish
Match: nr2f2 (nuclear receptor subfamily 2 group F member 2 [Source:NCBI gene;Acc:103029842])

HSP 1 Score: 395.201 bits (1014), Expect = 1.012e-132
Identity = 181/338 (53.55%), Postives = 247/338 (73.08%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  ++E +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   83 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHIESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 405          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Cavefish
Match: nr2f1a (nuclear receptor subfamily 2 group F member 1 [Source:NCBI gene;Acc:103026790])

HSP 1 Score: 392.889 bits (1008), Expect = 7.356e-132
Identity = 177/337 (52.52%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SC+KA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   73 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCIKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 395          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Cavefish
Match: nr2f2 (nuclear receptor subfamily 2 group F member 2 [Source:NCBI gene;Acc:103029842])

HSP 1 Score: 385.956 bits (990), Expect = 1.603e-129
Identity = 178/326 (54.60%), Postives = 240/326 (73.62%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRL 1450
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  ++E +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL
Sbjct:   83 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHIESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRL 393          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Cavefish
Match: nr2f5 (nuclear receptor subfamily 2 group F member 5 [Source:NCBI gene;Acc:103038004])

HSP 1 Score: 366.696 bits (940), Expect = 9.669e-122
Identity = 176/337 (52.23%), Postives = 243/337 (72.11%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            N++C+VCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNL+Y+CRGN +CPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+    S  GQY+ +      G  Y + FI ++++ +   + +     M    SN+             GI++I ++A+++L   ++W+K+IPFFPDL + DQ+ LL+ SWSELF+L +A  S PLH+APLLA+ GL  +P+ AE+VV  +DHIR+ Q+Q+EKLK  Q+D+AE+SCLK++VLF SD  GLSD  +VE IQE  Q ALEEY +  YPNQ  RFG+LLLR+P L+ ++S +IE+L F RL+G   +  L+++
Sbjct:   51 NVDCMVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMSSSQSSPGQYLTNGNDPYNGQPYLSGFISLLLRAEPYPTSRYGAQCMQ---SNN-----------LMGIENICELAARLLFSAVEWAKNIPFFPDLQLMDQVALLRMSWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDAMGLSDVAHVESIQEKSQCALEEYVRNQYPNQPNRFGRLLLRLPSLRIVSSPVIEQLFFVRLVGKTPIETLLRD 373          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Cavefish
Match: nr2f6b (nuclear receptor subfamily 2 group F member 6 [Source:NCBI gene;Acc:103046533])

HSP 1 Score: 338.961 bits (868), Expect = 4.494e-111
Identity = 167/353 (47.31%), Postives = 235/353 (66.57%), Query Frame = 2
Query:  458 QDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLF-------SNHSNICD---TTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +  ED+K    ++CVVCGDKSSGKHYG +TCEGCKSFFKRS+RRNL+Y+CR N  C ID HHRNQCQ CR +KC ++GMRKEAVQ+GRIP   SH G  I+ T         +G         + Q     +  L        S +   C            GID+I ++A+++L   I+W+++IP+FPDL +++Q+ LL+ SWSELF+L +A S+ PLH+APLLA+ G   +P+ AE+VV  +D +R+ QDQ++KL + Q+DSAE+SCLKA+ LF+ D  GL+DP +VE +QE  Q AL EYE+  YP Q  RFG+LLLR+P L+++ +++I +L F RL+G   +  LI++
Sbjct:   41 EGGEDDK-ACVVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRECQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIP--PSHSG--ISPTSMVGAGGGGVGGQGMGGEYFNGQPAPELITQLLRAEPYPNSRYGAQCGQQLGGGNSAVMGIDNICELAARLLFSTIEWARNIPYFPDLPVSEQVALLRLSWSELFILNAAQSALPLHMAPLLAAAGFHASPMSAERVVSFMDQVRVFQDQVDKLTRLQVDSAEYSCLKAIALFSPDACGLTDPAHVESLQEKAQVALTEYERMQYPTQPQRFGRLLLRLPSLRAVPANLISQLFFMRLVGKTPIETLIRD 388          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Sea Lamprey
Match: nr2f1b (nuclear receptor subfamily 2, group F, member 1b [Source:NCBI gene;Acc:393564])

HSP 1 Score: 308.916 bits (790), Expect = 5.018e-101
Identity = 149/328 (45.43%), Postives = 214/328 (65.24%), Query Frame = 2
Query:  575 RSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKE------------------AVQQGRI-----PQFSSHYGQYIASTY-GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            RSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+E                  AVQ+GR+     P  +  Y         G SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+  WSELF+L +A  + PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF++D  GLSD  ++E++QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:    1 RSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREGACVKVHADQRVSLVPFPAVQRGRLAPTQHPNPALQYALVNGDPLNGHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLRLVWSELFVLNAAQCAMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFSTDACGLSDAAHIENLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 314          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Sea Lamprey
Match: nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:ZFIN;Acc:ZDB-GENE-041114-63])

HSP 1 Score: 189.504 bits (480), Expect = 2.223e-54
Identity = 127/380 (33.42%), Postives = 191/380 (50.26%), Query Frame = 2
Query:  491 IECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHN-CPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHY----GQYIASTYGSS------------------YFNRFIGMMMQN--DSMLSKQEKIGFMNH---LFSNHSNICDTTSEEKYFGIDS--IYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLH---------------LAPLLASVGLQVNPVGAEKVVILLDH-----IRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLI 1480
            + C+VCGD SSGKHYG Y C GC  FFKRSVRR L Y C+ +   C +D  HRNQCQ CR +KCL  GM K+AVQ  R P+ ++       +  A+T+  +                  +  R +   + +  D   S+   + F +    +  + S I    +  K   + S  + D    +L   I+W+K++P F  L   DQ+ LL+ +WSELFLL SA  +  LH                +P    +G   +P G+    +   H     +RL++D  E+ +   +D  EF+CLKA+VLF  +  GL D   VE +Q+  Q  L ++ +  YP+Q  RFGKLLL IP L+ I++  +E++ F R + +  +  LI
Sbjct:   49 LTCLVCGDVSSGKHYGIYACNGCSGFFKRSVRRKLIYRCQASTGLCTVDKAHRNQCQACRLRKCLHAGMNKDAVQNERQPRSTAQVRPGDPELGANTWAPAAVTPTALASAAPTPPPPSHVTRCLSRHLADLSDRRHSRASGVSFADEAVDVTESRSPI-RVRASPKCLPVASAEVSDTPMSLLFMAIKWAKNLPAFSALPFRDQVILLEEAWSELFLLCSAQWA--LHSDGSRAFQGAAAAAAASPCPCPLGAAGSPEGS--CPLQAAHGGAVDLRLLRDMTERFRDLTVDPTEFACLKAVVLFKPEASGLKDGDQVESLQDQSQVMLNQHCRALYPSQPARFGKLLLLIPALRLIHADRLEKIFFQRALHSAPMERLI 423          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Sea Lamprey
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 163.31 bits (412), Expect = 1.242e-44
Identity = 110/331 (33.23%), Postives = 178/331 (53.78%), Query Frame = 2
Query:  497 CVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVG-LQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            C +CGD+++GKHYG  +C+GCK FF+RS+R+N  YSCR +  C +D   RNQC+  R +KC + GM+KEAVQ  R    +    Q  A+   S   N F+    Q +S LS+Q    FM  +     ++    S ++   I  I +   + L  +++W+K +P F +L + DQ+ LL++   E  LL  A  S       LL + G   +      +  +     R++ + +   ++ QID  EF+CLKA+V F+ D +GL DP  + +++   Q +LE+Y          RFG+LLL +P L+S+   +IE++   RL+    V +L++E
Sbjct:   63 CAICGDRATGKHYGASSCDGCKGFFRRSIRKNHMYSCRYSRQCVVDKDKRNQCRY-RLKKCFRAGMKKEAVQNERDRISTRRNSQDDAT---SPSINTFV----QAES-LSRQ----FMPPMVGGSGDL----SLKQVASIQDICESIKQQLLVLVEWAKYLPVFCELLLDDQVALLRAHAGEHLLLGVAKRSMTYKDVLLLGAAGDGHILARSCPEADVGRVACRVLDELVVPFQELQIDDNEFACLKAVVFFDPDAKGLRDPERIRNVRFQAQLSLEDYVTDRQYESRGRFGQLLLLLPTLQSLAWQMIEQIQLARLLSVVRVDSLLQE 376          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Sea Lamprey
Match: thrb (thyroid hormone receptor beta [Source:NCBI gene;Acc:30607])

HSP 1 Score: 122.094 bits (305), Expect = 1.996e-30
Identity = 98/343 (28.57%), Postives = 158/343 (46.06%), Query Frame = 2
Query:  479 LGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNL--TYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGM-------------RKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYD---------IASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVN-PVGAEKVVILLDHIRLIQDQI----EKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRF-GKLLLRIPQLKSINS 1417
            L  N  CVVCGDK++G HY   TCEGCK FF+R++++NL  +Y+C+   +C ID   RNQCQ CR+QKC+ +GM             ++  +++ R  +      + +    G S     +  ++      +  +   +  H     SN     S       D   D         I +  +  V+ ++K +P F +L   DQI LLK    E+  L +A    P        S  L +N  V  +K  +    + L+ D I      L  F +D  E + L+A++L ++D  GL +   VE +Q+T   ALE Y   H  +++  F  KLL+++  L+ I +
Sbjct:   34 LDKNEPCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYACKYEGSCIIDRITRNQCQECRYQKCIAVGMASDLVLDDSKRLAKRRLIEENRQRRKQDEKRRNVIERPGPSDKEWELIQLVTAAHCTTNAQGSQWKEHRRFLVSNCLGPESVLSSLDGDDKVDLQAFTHFTAIITPSITRVVDFAKKLPMFTELPCEDQIVLLKGCCMEIMSLRAAVRYDP-------ESDTLTLNGEVAVKKEQLKNGGLGLVSDAIFDLGRSLAAFSLDDTEVALLQAVLLMSTDRPGLVNVDKVEKLQDTYLLALEHYIN-HREHRLNHFWPKLLMKVTDLRLIGA 368          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000201.1 (pep scaffold:Pmarinus_7.0:GL476657:122907:137950:1 gene:ENSPMAG00000000180.1 transcript:ENSPMAT00000000201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 3.074e-29
Identity = 99/365 (27.12%), Postives = 166/365 (45.48%), Query Frame = 2
Query:  455 NQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAV----------------------QQGRIPQFSSHYGQYIAS-------TYGSSY--FNRFIGMMMQNDSMLSKQEKIGF--------MNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLAS--VGLQVNPV--GAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITR--FGKLLLRIPQLKSIN 1414
            N   +D + G    C VCGDK++G H+   TCEGCK FF+RS++R+ +++C     C I   +R  CQ CR ++C  +GM KE +                      ++   PQ      + IA+       TY +SY  F++F      + S   +     F        M+ L    ++  +  + ++   +  + D+ S  +  VI ++K IP F +L   DQI+LLK+S  E+ +L S  S T    +    S     Q+  V     K+ +L     L++ Q+  +KK  +  AE   L A+ LF+ D  G+ D   VE +QE +   L  Y    +P       + K++ ++ +L+S+N
Sbjct:   13 NALEDDEEGGVPKVCGVCGDKATGYHFNAMTCEGCKGFFRRSMKRSASFTCPFEGKCNITKDNRRHCQACRLKRCRDIGMMKELIMTEEEVQRKKEIIMKRKLEDSAREVHTPQLLEEQERLIATLIEAHRKTYDASYSDFSQFRPPKRGDGSPECRNATNPFLMSLLNSDMDELPKASASGAEAAAGDELSMLPHLADLVSYSIQKVIGFAKMIPGFKELCTEDQISLLKASAIEIIILRSNESFTMEDNSWTCGSNEFKYQIGDVMQAGHKLELLEP---LVKFQV-NMKKLDLHEAEHVLLMAICLFSPDRPGVQDRCRVEEVQEHLTETLRAYIACRHPLSCKHMLYAKMVEKLTELRSLN 373          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Nematostella
Match: EDO37645 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF49])

HSP 1 Score: 355.14 bits (910), Expect = 2.814e-118
Identity = 170/351 (48.43%), Postives = 243/351 (69.23%), Query Frame = 2
Query:  455 NQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYI-------ASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
             +  ED++    +EC VCGDKSSGKHYG +TCEGCKSFFKRSVRRNLTY+CR + +CPID HHRNQCQ CR +KCLK+GMR+EAVQ+GRIP   +              ST G SY + FI ++++ +   + + + G         +  C         GI++I ++A+++L   ++W+++IPFFPDL++TDQ+ LL+  WSELF+L +A    PL +APLLA+ G+  N +  +++V  +D+IR+ Q+Q+EKL+   +D+AEF+CLKA+VLF SD  GL+DP Y+E +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L+SI+SS++E+L F RL+G   +  L+++
Sbjct:   14 TETPEDSEKNVQVECAVCGDKSSGKHYGVFTCEGCKSFFKRSVRRNLTYTCRASRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPAAQTPTQNAALPGINGDGSTNGHSYLSGFIALLLRAEPYPTTRFQQGL--------NMPCGI------MGIENICELAARLLFSAVEWARNIPFFPDLAVTDQVALLRLVWSELFVLNAAQCPMPLQVAPLLATAGIHSNHMSPDRMVSFMDNIRIFQEQVEKLRNLHVDAAEFACLKAIVLFTSDASGLTDPQYIESLQEKTQCALEEYTRNQYPNQPTRFGKLLLRLPSLRSISSSVVEQLFFVRLVGKTPIETLLRD 350          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Nematostella
Match: EDO42277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X4])

HSP 1 Score: 301.597 bits (771), Expect = 4.116e-97
Identity = 158/344 (45.93%), Postives = 226/344 (65.70%), Query Frame = 2
Query:  491 IECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYG----SSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLA--SVGLQVNPVGA--EKVVILLD----HIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            I+C VCGDKSSGKHYG YTCEGCKSFFKRS+RR+L+YSCRG  NCP+DI +RNQCQ CR +KCLK+GMRKEAVQ+GRIP      G    S        S+++ +I ++++ D++   Q+ +             C+        G+++  ++A+++L   ++W+K+IPF+ DL + DQ  LL+S WSELF L +A   +P H++P L   S G   N  G    +V+   D    +++L ++Q+EKLK   IDSAEF+CLKA+VLFN D +GLS+P  VE++Q+  Q+ALE+Y +  YPNQ TRFGKLLLR+P L+ +    +E L F+RL   N+V +L+ +
Sbjct:   30 IDCAVCGDKSSGKHYGVYTCEGCKSFFKRSIRRSLSYSCRGVRNCPVDIQNRNQCQYCRLKKCLKVGMRKEAVQKGRIPSTHPDVGPLSVSMVEMNGHQSFYSSYITLLLRADTIARYQQSLTL----------PCNIN------GLENTPELAARLLVSAVEWAKNIPFYSDLPLPDQAVLLRSCWSELFTLNAAQHCSPFHISPTLTSNSSGFAGNGGGYLNTRVMSAFDCQNNNMKLFEEQVEKLKNMHIDSAEFACLKAIVLFNPDSQGLSEPAQVENLQDRTQSALEDYIRTQYPNQTTRFGKLLLRLPALRLLRPVSVENLFFSRLSMGNTVDSLLND 357          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Nematostella
Match: EDO32715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB6])

HSP 1 Score: 258.84 bits (660), Expect = 1.648e-81
Identity = 130/336 (38.69%), Postives = 201/336 (59.82%), Query Frame = 2
Query:  503 VCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGI---DSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNS-------DIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLI 1480
            VCGD+SSGKHYG +TC+GC+ FFKRS+RRNLTY C+    C +D+  RNQCQ CR +KC ++ M K+AVQ  R P+      Q +     ++  +            L+K+++   +       +++C   +    +     DSIY+ A ++L+  + W+++IP F DL   DQ  LL+  WSELF+L+SA  S PL + PLL++ GLQV+    +++V  +  IRL+Q+ + + K+ QIDS E++CLKA+VLF         ++RGL  P  VE +Q+  Q+ L EY +  YP+Q  RFGKLLL +P LK+++  +IE+L F   + N  +  ++
Sbjct:    3 VCGDRSSGKHYGVFTCDGCRGFFKRSIRRNLTYHCKELGKCVVDVARRNQCQACRLKKCFEVQMNKDAVQHERAPR----SAQILPRATSTTTID------------LNKEDRPDGVPT--QRSTDMCPGWTFPTGYQTAPQDSIYESAVQLLYMSVTWARNIPTFLDLPFRDQAILLEEGWSELFVLSSAQFSLPLDMGPLLSAAGLQVDKAPTDRIVAGMADIRLLQNIVTRFKRLQIDSTEYACLKAIVLFKPVLPFFPVNLRGLRAPQLVERLQDQAQSMLGEYCRSQYPDQQVRFGKLLLMLPSLKTVSPKMIEDLFFRGTLDNVPIERML 320          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Nematostella
Match: EDO38323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD90])

HSP 1 Score: 250.751 bits (639), Expect = 5.676e-78
Identity = 135/356 (37.92%), Postives = 198/356 (55.62%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCR---GNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNI--------------------CDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +I C VCGD+SSGKHYG Y C+GC  FFKRS+RRN +Y+CR   G  NCP+D  HRNQC++CR +KC  + M K+AVQ  R P+ S+   Q +            +    Q  S        GF+N L +    +                     D +    Y   +S+ + A+K+L   ++W+++IP F  L   DQ+ LL+  W ELFLL ++  S PL +AP+LA+ G+ V+    EK+V ++  +R +Q+ + K K F +DS EF+CLKA+VLF     GL DP  +E  Q+  Q  L EY +  YP Q+ RFG+LLL +P L+ +++  IEEL F + IG   +  L+ +
Sbjct:    5 DIPCKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNRSYTCRATNGKGNCPVDKIHRNQCRSCRLKKCFDVSMNKDAVQHERGPRSSTLRKQKMLKEAQERLELVSVAHAPQGPS--------GFINTLLAAEPRMDGCGMAVNDFDLEYKPIRLQSDMSVPMYYSSPESVCEAAAKLLFMSVKWARNIPSFMSLPFRDQVILLEEGWRELFLLGASQWSMPLEIAPILAASGMHVDNTPPEKIVDVMATVRTLQEAVNKFKAFGVDSTEFACLKAIVLFKPAACGLKDPEQIETTQDQAQLMLGEYIRSTYPTQVARFGRLLLLLPALRRVSALAIEELFFKKTIGTVPIERLLSD 352          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Nematostella
Match: EDO42315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X5])

HSP 1 Score: 245.743 bits (626), Expect = 3.009e-76
Identity = 127/342 (37.13%), Postives = 203/342 (59.36%), Query Frame = 2
Query:  473 NKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSS----HYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +K    + C VCGDKS+GKHYG  TCEGCKSFFKR+VR N  Y+CRG + C ID + R++C +CRFQKCL  GM+KEAVQ  ++P F +     YG  + + Y  + F      + Q+         +G M  L  N +++               Y++A+ +L  V+ W++ +  F +L  +DQITLLK +W++LFLL ++ S   L++  + A++  Q   +  E +V  +++ RL Q+Q E+++   +D  E   LK +VLF +D   ++ P  VE +Q+T Q++LE+Y +  YP+Q TRFGKLLL +  L+ + S++IE+L F  ++   S+  ++K+
Sbjct:    4 HKTDERVACAVCGDKSTGKHYGVSTCEGCKSFFKRTVRNNTNYTCRGQNTCAIDRNSRSRCPSCRFQKCLSTGMKKEAVQTTKLPPFPALQFPFYGD-VNTMYAQTMFPL---TLFQSPFNAPLTFPMG-MVPLNQNRTDVA--------------YELAANVLFAVVDWARKLTTFNNLMDSDQITLLKMAWTDLFLLEASRSPLQLYVQQMYATINAQTKQLSMEVIVKRMEYARLFQEQAERIRNLGMDMTEHFHLKCIVLFRADGSLINQPRQVEVLQDTSQSSLEQYIRSQYPSQPTRFGKLLLMLSSLRKVESTVIEQLFFADVLRGASMGEVLKK 326          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Medaka
Match: nr2f2 (COUP transcription factor 2 [Source:NCBI gene;Acc:101172490])

HSP 1 Score: 399.053 bits (1024), Expect = 1.869e-134
Identity = 184/348 (52.87%), Postives = 250/348 (71.84%), Query Frame = 2
Query:  458 QDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            Q  +  K   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   51 QTPQSEKQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRVPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 383          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Medaka
Match: nr2f2 (COUP transcription factor 2 [Source:NCBI gene;Acc:101172490])

HSP 1 Score: 396.356 bits (1017), Expect = 2.982e-133
Identity = 183/342 (53.51%), Postives = 248/342 (72.51%), Query Frame = 2
Query:  476 KLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            K   +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    H+GQ+ A T G      SY + +I ++++ +   +            S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ+ LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  +VE +QE  Q ALEEY +  YPNQ TRFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   75 KQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRVPPTQPHHGQF-ALTNGDPLHCHSYLSGYISLLLRAEPYPT------------SRYGSQC--MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 401          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Medaka
Match: nr2f1a (nuclear receptor subfamily 2 group F member 1 [Source:NCBI gene;Acc:101167372])

HSP 1 Score: 394.43 bits (1012), Expect = 1.589e-132
Identity = 179/337 (53.12%), Postives = 245/337 (72.70%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            +IECVVCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTYSCR N NCPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P    + GQY  +      G  Y + +I ++++ +             +  S + + C         GI++I ++A+++L   ++W+++IPFFPDL ITDQ++LL+ +WSELF+L +A  S PLH+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF SD  GLSD  ++E +QE  Q ALEEY +  YPNQ +RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   73 HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEP------------YPTSRYGSQC--MQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKTLHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 395          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Medaka
Match: ENSORLT00000041644.1 (COUP transcription factor 2-like [Source:NCBI gene;Acc:101164791])

HSP 1 Score: 385.571 bits (989), Expect = 9.571e-129
Identity = 178/344 (51.74%), Postives = 251/344 (72.97%), Query Frame = 2
Query:  470 DNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGS-----SYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            D +    IEC+VCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CR N NCP+D HHRNQCQ CR +KCLK+GMR+EAVQ+GR+P   +++GQ+ A T G      SY + +I ++++ +   + +    F +    N+ NI          GI++I ++A+++L   ++W+++IPFFPDL ++DQ+ LL+ +WSELF+L +A  S P+H+APLLA+ GL  +P+ A++VV  +DHIR+ Q+Q+EKLK   +DSAE+SCLKA+VLF +D  GLSD  +VE +QE  Q ALEEY +  YPNQ  RFGKLLLR+P L++++SS+IE+L F RL+G   +  LI++
Sbjct:   92 DKQQSQQIECIVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPVDQHHRNQCQYCRLKKCLKVGMRREAVQRGRVPT-QAYHGQF-ALTNGDPLQCHSYLSGYISLLLRAEPYPTSR----FGSQCLQNN-NI---------MGIENICELAARMLFSAVEWARNIPFFPDLQVSDQVALLRLTWSELFVLNAAQCSMPVHVAPLLAAAGLHASPMSADRVVAFMDHIRVFQEQVEKLKVLHVDSAEYSCLKAVVLFTTDACGLSDMAHVESLQEKSQCALEEYVRSQYPNQPNRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRD 419          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Medaka
Match: nr2f5 (nuclear receptor subfamily 2 group F member 5 [Source:NCBI gene;Acc:101174296])

HSP 1 Score: 364.77 bits (935), Expect = 4.362e-121
Identity = 174/337 (51.63%), Postives = 239/337 (70.92%), Query Frame = 2
Query:  488 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTY----GSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            N++C+VCGDKSSGKHYGQ+TCEGCKSFFKRSVRRNLTY+CRGN +CPID HHRNQCQ CR +KCLK+GMR+EAVQ+GR     S  GQY+ +      G  Y + FI ++++ +   + +     M                    GI++I ++A+++L   ++W+K+IPFFPDL + DQ+ LL+ SWSELF+L +A  S PLH+APLLA+ GL  +P+ AE+VV  +DHIR+ Q+Q+EKLK  Q+D+AE+SCLK++VLF SD  GLSD  +VE IQE  Q ALEEY +  YP+Q  RFG+LLLR+P L+ ++S +IE+L F RL+G   +  L+++
Sbjct:   51 NVDCMVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRTSNSQSSPGQYLTNGTDPYNGQPYLSGFISLLLRAEPYPTSRYGAQCMQG--------------NNLMGIENICELAARLLFSAVEWAKNIPFFPDLQLMDQVALLRMSWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDAMGLSDVAHVESIQEKSQCALEEYVRNQYPSQPNRFGRLLLRLPSLRIVSSPVIEQLFFVRLVGKTPIETLLRD 373          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Planmine SMEST
Match: SMESG000056421.1 (SMESG000056421.1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 489/489 (100.00%), Postives = 489/489 (100.00%), Query Frame = 2
Query:  206 ICGENNLKSKFKDNNNISPFNDGVNCLESKLFSLDQANENFRQPQNLFLQTTKRHSGSLSNKQYXXXXXXXXXXXXXXXXXXXNQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKEXXXXXXXXXXXXGLSEDXXXXXXXXXXXXXXXXXXXXFPSSLWPTNSWFFKNFGKSSVPSQD 1672
            ICGENNLKSKFKDNNNISPFNDGVNCLESKLFSLDQANENFRQPQNLFLQTTKRHSGSLSNKQYEEPTTTTTSAEGSSPSSPSNQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKEYIINTYSYNSSSGLSEDSKKLLSPNPNSLLNISSTNNFPSSLWPTNSWFFKNFGKSSVPSQD
Sbjct:   15 ICGENNLKSKFKDNNNISPFNDGVNCLESKLFSLDQANENFRQPQNLFLQTTKRHSGSLSNKQYEEPTTTTTSAEGSSPSSPSNQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKEYIINTYSYNSSSGLSEDSKKLLSPNPNSLLNISSTNNFPSSLWPTNSWFFKNFGKSSVPSQD 503          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Planmine SMEST
Match: SMESG000023925.1 (SMESG000023925.1)

HSP 1 Score: 166.392 bits (420), Expect = 1.997e-45
Identity = 113/328 (34.45%), Postives = 167/328 (50.91%), Query Frame = 2
Query:  494 ECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVI-------QWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQET-VQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLI 1453
            +C VCGDKSSG+HYGQYTCEGCKSFFKRSVR   +Y C  + +C IDI  RN CQ CRFQKC   GMRKEAVQ GR             ST GS        ++ + D +  +  K   +N L  N S + D  S  +     S Y ++  +L   +       +  KS      LS++DQ  L+KS+W  +  L +  +   L     + S  +  N  G   ++  + H+  I++ + K++  + +  +++ L  ++L+N D  GLS P  V  IQ+T + + + +  K      +    KLLL +P L   N  +IEE+LF  +I
Sbjct:   41 DCKVCGDKSSGRHYGQYTCEGCKSFFKRSVRNQSSYQCYASGDCVIDIQRRNNCQFCRFQKCFASGMRKEAVQTGR-----------CLSTTGS--------IIYKTDKLAMQNSKNIPINSLDYNQSRLMDYLSAPEI----SQYGLSWSLLMSTLDCIGQDFRLKKS-----GLSMSDQFLLIKSNWHIILALIACQNQIQLPFNSWI-SEKMSYNNNG---LIHTIPHLNFIENHLRKIQNLKPNFKQYNWLFNVILYNPDTYGLSAPHLVGTIQQTLLDSVITDLTK----ENVLIHSKLLLNVPSLVIFNQPLIEEILFREMI 332          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Planmine SMEST
Match: SMESG000023925.1 (SMESG000023925.1)

HSP 1 Score: 166.392 bits (420), Expect = 2.496e-45
Identity = 113/328 (34.45%), Postives = 167/328 (50.91%), Query Frame = 2
Query:  494 ECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVI-------QWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQET-VQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLI 1453
            +C VCGDKSSG+HYGQYTCEGCKSFFKRSVR   +Y C  + +C IDI  RN CQ CRFQKC   GMRKEAVQ GR             ST GS        ++ + D +  +  K   +N L  N S + D  S  +     S Y ++  +L   +       +  KS      LS++DQ  L+KS+W  +  L +  +   L     + S  +  N  G   ++  + H+  I++ + K++  + +  +++ L  ++L+N D  GLS P  V  IQ+T + + + +  K      +    KLLL +P L   N  +IEE+LF  +I
Sbjct:   56 DCKVCGDKSSGRHYGQYTCEGCKSFFKRSVRNQSSYQCYASGDCVIDIQRRNNCQFCRFQKCFASGMRKEAVQTGR-----------CLSTTGS--------IIYKTDKLAMQNSKNIPINSLDYNQSRLMDYLSAPEI----SQYGLSWSLLMSTLDCIGQDFRLKKS-----GLSMSDQFLLIKSNWHIILALIACQNQIQLPFNSWI-SEKMSYNNNG---LIHTIPHLNFIENHLRKIQNLKPNFKQYNWLFNVILYNPDTYGLSAPHLVGTIQQTLLDSVITDLTK----ENVLIHSKLLLNVPSLVIFNQPLIEEILFREMI 347          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Planmine SMEST
Match: SMESG000023916.1 (SMESG000023916.1)

HSP 1 Score: 166.392 bits (420), Expect = 2.496e-45
Identity = 113/328 (34.45%), Postives = 167/328 (50.91%), Query Frame = 2
Query:  494 ECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVI-------QWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQET-VQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLI 1453
            +C VCGDKSSG+HYGQYTCEGCKSFFKRSVR   +Y C  + +C IDI  RN CQ CRFQKC   GMRKEAVQ GR             ST GS        ++ + D +  +  K   +N L  N S + D  S  +     S Y ++  +L   +       +  KS      LS++DQ  L+KS+W  +  L +  +   L     + S  +  N  G   ++  + H+  I++ + K++  + +  +++ L  ++L+N D  GLS P  V  IQ+T + + + +  K      +    KLLL +P L   N  +IEE+LF  +I
Sbjct:   56 DCKVCGDKSSGRHYGQYTCEGCKSFFKRSVRNQSSYQCYASGDCVIDIQRRNNCQFCRFQKCFASGMRKEAVQTGR-----------CLSTTGS--------IIYKTDKLAMQNSKNIPINSLDYNQSRLMDYLSAPEI----SQYGLSWSLLMSTLDCIGQDFRLKKS-----GLSMSDQFLLIKSNWHIILALIACQNQIQLPFNSWI-SEKMSYNNNG---LIHTIPHLNFIENHLRKIQNLKPNFKQYNWLFNVILYNPDTYGLSAPHLVGTIQQTLLDSVITDLTK----ENVLIHSKLLLNVPSLVIFNQPLIEEILFREMI 347          
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Planmine SMEST
Match: SMESG000014588.1 (SMESG000014588.1)

HSP 1 Score: 167.548 bits (423), Expect = 2.949e-44
Identity = 105/346 (30.35%), Postives = 186/346 (53.76%), Query Frame = 2
Query:  479 LGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQ--QGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIG---FMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAP-LLASVGLQVNPVGAEK-VVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEY---EKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKE 1486
            + NN  C++C DK++GKHYG ++C+GCK FF+RSVR+   Y+C+ N NC +D   RNQC+ CR +KC+ +GM++ AVQ  + RI    S +     +   S      I  +MQ +  ++ Q+      +MN  +++  ++C++   + +                ++ W+KS+P F  L+++DQI+LLK+   E+ +L     S  L     LL    L ++   ++K    +  HI  + D    L++ Q+D AEF+CLKA+V F+  +   S   +V   +  +Q  L  +   +++H P    RFG+LLL IP L+ +   +++++ F ++ G   + +L+ E
Sbjct:   60 MENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILS------ISQLMQAEQRVAIQKPPNPQEYMNR-YADVPDVCESMKNQLFL---------------LVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHI--LDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPG---RFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSE 377          
The following BLAST results are available for this feature:
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NR2F17.411e-13250.56nuclear receptor subfamily 2 group F member 1 [Sou... [more]
NR2F11.550e-13152.82nuclear receptor subfamily 2 group F member 1 [Sou... [more]
NR2F13.570e-13152.82nuclear receptor subfamily 2 group F member 1 [Sou... [more]
NR2F25.069e-13152.60nuclear receptor subfamily 2 group F member 2 [Sou... [more]
NR2F61.505e-9844.86nuclear receptor subfamily 2 group F member 6 [Sou... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-559.701e-5433.24Nuclear hormone receptor unc-55 [Source:UniProtKB... [more]
unc-558.207e-5332.43Nuclear hormone receptor unc-55 [Source:UniProtKB... [more]
nhr-148.265e-4332.07Nuclear hormone receptor family member nhr-14 [So... [more]
nhr-141.779e-4231.99Nuclear hormone receptor family member nhr-14 [So... [more]
nhr-141.779e-4231.99Nuclear hormone receptor family member nhr-14 [So... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svp3.755e-13052.31gene:FBgn0003651 transcript:FBtr0082564[more]
svp4.339e-13052.31gene:FBgn0003651 transcript:FBtr0331183[more]
svp6.141e-9652.40gene:FBgn0003651 transcript:FBtr0082563[more]
svp1.736e-8043.57gene:FBgn0003651 transcript:FBtr0082562[more]
Hnf45.906e-5231.98gene:FBgn0004914 transcript:FBtr0344784[more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2f27.241e-13452.72nuclear receptor subfamily 2, group F, member 2 [S... [more]
nr2f1a8.134e-13252.52nuclear receptor subfamily 2, group F, member 1a [... [more]
nr2f22.354e-13151.83nuclear receptor subfamily 2, group F, member 2 [S... [more]
nr2f1b1.275e-12952.23nuclear receptor subfamily 2, group F, member 1b [... [more]
nr2f58.075e-12252.23nuclear receptor subfamily 2, group F, member 5 [S... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uevld1.834e-13152.82UEV and lactate/malate dehyrogenase domains [Sourc... [more]
nr2f22.166e-13153.85nuclear receptor subfamily 2 group F member 2 [Sou... [more]
uevld4.041e-12952.52UEV and lactate/malate dehyrogenase domains [Sourc... [more]
uevld2.121e-12853.85UEV and lactate/malate dehyrogenase domains [Sourc... [more]
uhrf21.962e-11951.63ubiquitin-like with PHD and ring finger domains 2,... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nr2f11.787e-13152.82nuclear receptor subfamily 2, group F, member 1 [S... [more]
Nr2f23.480e-13152.60nuclear receptor subfamily 2, group F, member 2 [S... [more]
Nr2f63.273e-10045.64nuclear receptor subfamily 2, group F, member 6 [S... [more]
Rxrg5.961e-8040.48retinoid X receptor gamma [Source:MGI Symbol;Acc:M... [more]
Rxrg2.442e-7840.18retinoid X receptor gamma [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06725|N2F1A_DANRE6.140e-13152.52Nuclear receptor subfamily 2 group F member 1-A OS... [more]
sp|Q9TTR8|COT1_BOVIN1.367e-13052.82COUP transcription factor 1 OS=Bos taurus OX=9913 ... [more]
sp|Q60632|COT1_MOUSE1.441e-13052.82COUP transcription factor 1 OS=Mus musculus OX=100... [more]
sp|P10589|COT1_HUMAN1.715e-13052.82COUP transcription factor 1 OS=Homo sapiens OX=960... [more]
sp|Q9TTR7|COT2_BOVIN2.306e-13052.60COUP transcription factor 2 OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B5L1Z71.194e-13153.16Nuclear receptor subfamily 2, group F, member 2 OS... [more]
H2T3L62.761e-13153.14Nuclear receptor subfamily 2, group F, member 2 OS... [more]
A0A5C6PC702.761e-13153.14COUP transcription factor 1 OS=Takifugu flavidus O... [more]
H3C2L33.390e-13153.14Nuclear receptor subfamily 2, group F, member 2 OS... [more]
W5Q5F64.875e-13153.71Nuclear receptor subfamily 2 group F member 1 OS=O... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2f21.012e-13253.55nuclear receptor subfamily 2 group F member 2 [Sou... [more]
nr2f1a7.356e-13252.52nuclear receptor subfamily 2 group F member 1 [Sou... [more]
nr2f21.603e-12954.60nuclear receptor subfamily 2 group F member 2 [Sou... [more]
nr2f59.669e-12252.23nuclear receptor subfamily 2 group F member 5 [Sou... [more]
nr2f6b4.494e-11147.31nuclear receptor subfamily 2 group F member 6 [Sou... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2f1b5.018e-10145.43nuclear receptor subfamily 2, group F, member 1b [... [more]
nr2e32.223e-5433.42nuclear receptor subfamily 2, group E, member 3 [S... [more]
hnf4g1.242e-4433.23hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
thrb1.996e-3028.57thyroid hormone receptor beta [Source:NCBI gene;Ac... [more]
ENSPMAT00000000201.13.074e-2927.12pep scaffold:Pmarinus_7.0:GL476657:122907:137950:1... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO376452.814e-11848.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422774.116e-9745.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327151.648e-8138.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383235.676e-7837.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423153.009e-7637.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2f21.869e-13452.87COUP transcription factor 2 [Source:NCBI gene;Acc:... [more]
nr2f22.982e-13353.51COUP transcription factor 2 [Source:NCBI gene;Acc:... [more]
nr2f1a1.589e-13253.12nuclear receptor subfamily 2 group F member 1 [Sou... [more]
ENSORLT00000041644.19.571e-12951.74COUP transcription factor 2-like [Source:NCBI gene... [more]
nr2f54.362e-12151.63nuclear receptor subfamily 2 group F member 5 [Sou... [more]
back to top
BLAST of Nuclear receptor subfamily 2, group F, member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056421.10.000e+0100.00SMESG000056421.1[more]
SMESG000023925.11.997e-4534.45SMESG000023925.1[more]
SMESG000023925.12.496e-4534.45SMESG000023925.1[more]
SMESG000023916.12.496e-4534.45SMESG000023916.1[more]
SMESG000014588.12.949e-4430.35SMESG000014588.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003731 ID=SMED30003731|Name=Nuclear receptor subfamily 2, group F, member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1797bp
CAAATTTAAAGGAGTACAAAATACCGATTTATTCATAATTGTAAAATAAA
AATATATTTAAAAATAATTCTTGGAGAAAAAAAAATCTACAAAAATTTAA
TTTATTTTTATTCTCATCATCTGAGCGAATTTGTGTGAGAAAATAAAATA
AAAACAAATACGGATGTCTGCGACGAGTACCACTACTTTTCATTCAATCA
GTTCAATTTGCGGTGAAAATAATCTCAAATCCAAATTTAAAGACAACAAC
AATATTTCCCCGTTCAATGATGGAGTGAATTGTTTGGAATCGAAATTGTT
CTCTTTGGATCAAGCGAATGAAAATTTTCGACAACCGCAAAATCTTTTTC
TTCAAACAACAAAACGACATTCGGGCTCATTGTCGAACAAACAGTACGAA
GAACCAACAACAACGACAACATCTGCTGAAGGTTCTTCGCCGAGTTCACC
GTCAAACCAAGACTCGGAAGATAACAAATTGGGTAACAATATCGAATGCG
TTGTTTGTGGCGATAAGAGCAGTGGAAAGCATTACGGACAATACACTTGT
GAAGGTTGCAAGAGTTTTTTCAAGCGCTCAGTTCGTCGAAACCTAACATA
TTCTTGTAGAGGAAATCACAATTGTCCAATTGATATTCATCACAGAAATC
AATGTCAAAACTGTCGATTTCAGAAATGCCTTAAAATGGGCATGAGGAAA
GAAGCGGTTCAACAAGGAAGAATTCCTCAATTCAGTTCTCATTATGGTCA
ATATATAGCATCCACCTATGGATCATCTTATTTCAACAGATTCATTGGAA
TGATGATGCAAAATGATTCCATGTTGTCGAAACAGGAAAAAATCGGTTTC
ATGAATCATTTGTTCAGTAATCATTCTAATATTTGCGACACAACATCCGA
GGAGAAATATTTCGGAATTGATAGCATATATGACATTGCGTCTAAAATTT
TGCACGGAGTAATTCAATGGTCAAAAAGCATTCCTTTCTTTCCTGATTTA
TCGATTACAGATCAAATCACTCTTTTGAAATCTTCATGGAGTGAATTATT
TTTATTAACCTCGGCTCACAGCTCAACTCCTTTGCATTTGGCACCGCTGC
TCGCTTCAGTTGGGCTGCAAGTGAATCCGGTTGGAGCGGAAAAAGTCGTG
ATTCTGCTCGATCATATTAGACTTATTCAGGATCAAATAGAAAAACTGAA
AAAGTTTCAAATAGATTCGGCGGAATTCTCGTGTTTGAAAGCGTTGGTAC
TTTTCAACTCAGATATTCGTGGTCTATCGGATCCAGTTTATGTAGAACAT
ATTCAAGAAACTGTTCAAAATGCACTAGAAGAATATGAAAAATTTCATTA
TCCTAATCAAATAACTAGATTTGGAAAACTGTTGTTGAGAATTCCCCAGC
TGAAGTCAATTAATTCTTCAATTATTGAAGAACTTCTTTTTACTAGACTG
ATTGGAAATAATTCCGTGACAAATCTCATAAAAGAATATATAATTAATAC
ATATTCCTACAATTCATCATCGGGTCTATCAGAAGATTCAAAAAAACTTC
TTTCTCCAAATCCAAATTCCTTACTGAACATATCTTCCACAAACAATTTC
CCATCTTCTCTCTGGCCAACAAATTCTTGGTTTTTTAAAAATTTCGGAAA
GTCCTCTGTCCCGTCTCAAGATTCAAACAATTCCCTTTTTACCAGTTCAA
AGTAGAAATAATTTTCCATAAACCAAAAAAATGATAAATTACACATAAAT
TGTGATAAATATATATTTATAAATAAATTTAAATATCTAAAGCTCTG
back to top

protein sequence of SMED30003731-orf-1

>SMED30003731-orf-1 ID=SMED30003731-orf-1|Name=SMED30003731-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
MSATSTTTFHSISSICGENNLKSKFKDNNNISPFNDGVNCLESKLFSLDQ
ANENFRQPQNLFLQTTKRHSGSLSNKQYEEPTTTTTSAEGSSPSSPSNQD
SEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRG
NHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIAS
TYGSSYFNRFIGMMMQNDSMLSKQEKIGFMNHLFSNHSNICDTTSEEKYF
GIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTS
AHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQI
DSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQI
TRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKEYIINTYSYN
SSSGLSEDSKKLLSPNPNSLLNISSTNNFPSSLWPTNSWFFKNFGKSSVP
SQDSNNSLFTSSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035500NHR-like_dom_sf
IPR001723Nuclear_hrmn_rcpt
IPR003068COUP_TF
IPR001628Znf_hrmn_rcpt
IPR000536Nucl_hrmn_rcpt_lig-bd
IPR013088Znf_NHR/GATA
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0043401steroid hormone mediated signaling pathway
GO:0001935endothelial cell proliferation
GO:0001944vasculature development
GO:0006351transcription, DNA-templated
GO:0030522intracellular receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003707steroid hormone receptor activity
GO:0004879RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001723Nuclear hormone receptorPRINTSPR00398STRDHORMONERcoord: 348..363
score: 38.72
coord: 258..279
score: 31.21
coord: 173..183
score: 49.45
coord: 405..422
score: 34.42
coord: 279..295
score: 50.17
NoneNo IPR availablePRINTSPR01282COUPTNFACTORcoord: 305..323
score: 55.79
coord: 364..376
score: 52.82
coord: 411..424
score: 45.24
coord: 180..192
score: 53.33
coord: 251..267
score: 30.2
coord: 431..442
score: 24.44
coord: 325..339
score: 51.11
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 68..103
NoneNo IPR availablePANTHERPTHR24083:SF46COUP TRANSCRIPTION FACTOR 1coord: 71..445
NoneNo IPR availablePANTHERPTHR24083NUCLEAR HORMONE RECEPTORcoord: 71..445
NoneNo IPR availableCDDcd06958NR_DBD_COUP_TFcoord: 112..183
e-value: 6.35608E-51
score: 166.173
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 110..193
IPR001628Zinc finger, nuclear hormone receptor-typePRINTSPR00047STROIDFINGERcoord: 169..177
score: 58.39
coord: 112..128
score: 56.6
coord: 161..169
score: 59.97
coord: 128..143
score: 59.03
IPR001628Zinc finger, nuclear hormone receptor-typeSMARTSM00399c4goldcoord: 109..180
e-value: 1.1E-35
score: 134.6
IPR001628Zinc finger, nuclear hormone receptor-typePFAMPF00105zf-C4coord: 111..179
e-value: 2.2E-29
score: 101.7
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS00031NUCLEAR_REC_DBD_1coord: 112..138
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS51030NUCLEAR_REC_DBD_2coord: 109..184
score: 20.454
IPR000536Nuclear hormone receptor, ligand-binding domainSMARTSM00430holicoord: 257..417
e-value: 5.0E-41
score: 152.3
IPR000536Nuclear hormone receptor, ligand-binding domainPFAMPF00104Hormone_recepcoord: 245..430
e-value: 2.7E-31
score: 108.8
IPR000536Nuclear hormone receptor, ligand-binding domainPROSITEPS51843NR_LBDcoord: 225..446
score: 49.322
IPR035500Nuclear hormone receptor-like domain superfamilyGENE3DG3DSA:1.10.565.10coord: 224..452
e-value: 2.2E-75
score: 254.9
IPR035500Nuclear hormone receptor-like domain superfamilySUPERFAMILYSSF48508Nuclear receptor ligand-binding domaincoord: 178..443
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 101..223
e-value: 5.5E-34
score: 118.4