16 kDa calcium-binding protein

Overview
Name16 kDa calcium-binding protein
Smed IDSMED30003724
Length (bp)848
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003724

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003724SMESG000016862.1 SmedASXL_003816SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30003724SMESG000016862.1 dd_Smed_v4_7830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003724SMESG000016862.1 dd_Smed_v6_7830_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30003724SMESG000016862.1 OX_Smed_1.0.09410ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
glial cellSMED30003724SMESG000016862.1 dd_Smed_v6_7830_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 16 kDa calcium-binding protein vs. Ensembl Human
Match: CALML5 (calmodulin like 5 [Source:HGNC Symbol;Acc:HGNC:18180])

HSP 1 Score: 57.7658 bits (138), Expect = 7.777e-10
Identity = 34/132 (25.76%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  307 FTEMDLDQNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            F+ +D D NG +   E+   L+  GK  S+  + ++I E D + DG+I+  E+   L          E  +  F +FD D  G + ++E+++ +A  G+G        +  + + D+++DG+++Y EF + +
Sbjct:   17 FSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEF---LTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMA--GLGQPLPQEELDAMIREADVDQDGRVNYEEFARML 143          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: cal-8 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:Q09980])

HSP 1 Score: 49.2914 bits (116), Expect = 3.154e-7
Identity = 41/144 (28.47%), Postives = 77/144 (53.47%), Query Frame = 1
Query:  280 SLNERLI-EKFTEMDLDQNGELTPNEVKYILQQDG-KFSKESVEEIIKEFDINSDGKITLDEYKEKL--NIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            SL E  I E F E D + +G +T  E++  L Q G K S   +E +I++ D++ +G I +DE+   L   I DP  +R    ++VF+ FD +  G + ++++  ++    +G     +  +  + + D++ DG +D+ EF+  I
Sbjct:    3 SLKEAEIREVFREFDKNGDGRITRQELEVALLQLGEKASNSKIETMIEQADLDGNGCIDIDEFLNVLRRQICDPKEERE--LRDVFNVFDKNGDGVISIDDLIFVMCQ--LGEKLTETEAKEMIKQGDLDHDGMIDFQEFVNII 142          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: B0563.7 (Uncharacterized calcium-binding protein B0563.7 [Source:UniProtKB/Swiss-Prot;Acc:Q11083])

HSP 1 Score: 49.6766 bits (117), Expect = 5.864e-7
Identity = 26/67 (38.81%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  265 QLLIMSLNERLI-EKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEY 462
            Q ++ S NE LI E F   D D+NG +T NE KYI ++ G F  E  E++ +E D++++G ++ D++
Sbjct:  117 QNIVKSTNEELIRECFEIFDQDRNGIITENEFKYIAKEFGDFDDELAEKVFRELDVSANGHLSADQF 183          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: M04F3.4 (pep chromosome:WBcel235:I:4771348:4773070:-1 gene:WBGene00019770.1 transcript:M04F3.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.4)

HSP 1 Score: 46.595 bits (109), Expect = 3.327e-6
Identity = 35/139 (25.18%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  295 LIEKFTEMDLDQNGELTPNEVKYILQQD--GKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVST-FENWL-SKRDMNRDGKLDYNEFLKFI 699
            L + F+ +D D++G+++ +E++  L       F+ E+   +I  FD N DG I   E++     ++        W N F  FD D SG ++  E+   +       GY +S  F N L  K D +   ++++++F++  
Sbjct:    8 LQQIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYIND-------WTNCFRGFDTDGSGNIDKSELTNALTQ----FGYRLSPQFYNILMHKFDRSHSNRINFDDFIQLC 135          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: M04F3.4 (pep chromosome:WBcel235:I:4771348:4773673:-1 gene:WBGene00019770.1 transcript:M04F3.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.4)

HSP 1 Score: 46.595 bits (109), Expect = 3.327e-6
Identity = 35/139 (25.18%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  295 LIEKFTEMDLDQNGELTPNEVKYILQQD--GKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVST-FENWL-SKRDMNRDGKLDYNEFLKFI 699
            L + F+ +D D++G+++ +E++  L       F+ E+   +I  FD N DG I   E++     ++        W N F  FD D SG ++  E+   +       GY +S  F N L  K D +   ++++++F++  
Sbjct:    8 LQQIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYIND-------WTNCFRGFDTDGSGNIDKSELTNALTQ----FGYRLSPQFYNILMHKFDRSHSNRINFDDFIQLC 135          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: M04F3.4 (pep chromosome:WBcel235:I:4771600:4773026:-1 gene:WBGene00019770.1 transcript:M04F3.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.4)

HSP 1 Score: 46.595 bits (109), Expect = 3.327e-6
Identity = 35/139 (25.18%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  295 LIEKFTEMDLDQNGELTPNEVKYILQQD--GKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVST-FENWL-SKRDMNRDGKLDYNEFLKFI 699
            L + F+ +D D++G+++ +E++  L       F+ E+   +I  FD N DG I   E++     ++        W N F  FD D SG ++  E+   +       GY +S  F N L  K D +   ++++++F++  
Sbjct:    8 LQQIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYIND-------WTNCFRGFDTDGSGNIDKSELTNALTQ----FGYRLSPQFYNILMHKFDRSHSNRINFDDFIQLC 135          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: CR749762.5 (si:rp71-17i16.4 [Source:NCBI gene;Acc:100002038])

HSP 1 Score: 48.1358 bits (113), Expect = 1.706e-6
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 1
Query:  283 LNERLIEKFTEM----DLDQNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEY----KEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            L+E +I +F       D D  G+++  E+  +++  G+  S+E ++ II+E D +  G I  +E+     ++L   D  GK  E     F  FD +  G ++ EE   I+     G        +  ++  D N+DGK+D++EFLK +
Sbjct:   12 LSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLK-EDQAGKSEEELSECFRIFDKNQDGFIDREEFGDILH--ATGEPVAEEDIDELMADADTNKDGKIDFDEFLKMM 156          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: si:rp71-17i16.4 (si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-215])

HSP 1 Score: 47.7506 bits (112), Expect = 1.980e-6
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 1
Query:  283 LNERLIEKFTEM----DLDQNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEY----KEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            L+E +I +F       D D  G+++  E+  +++  G+  S+E ++ II+E D +  G I  +E+     ++L   D  GK  E     F  FD +  G ++ EE   I+     G        +  ++  D N+DGK+D++EFLK +
Sbjct:   13 LSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLK-EDQAGKSEEELSECFRIFDKNQDGFIDREEFGDILH--ATGEPVAEEDIDELMADADTNKDGKIDFDEFLKMM 157          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 48.9062 bits (115), Expect = 2.888e-6
Identity = 42/149 (28.19%), Postives = 72/149 (48.32%), Query Frame = 1
Query:  292 RLIEKFTEMDLDQNGELTPNEVKYILQQ-DGKFSKESVEEIIKEFDINSDGKITLDEYKEKLN-----------IVDPVGKRFEIW----KNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFL 690
            RL+E   ++D + +  LTP E+   +Q+   K++ +  EE   EFD N+DG ++ DEY   ++           + DP  +         K  FD  ++D S GL L E         V +  D +  E+ LS+ D+++DG +  +EF+
Sbjct:   77 RLVEIVKKIDTNSDKYLTPEEITVWIQRVYRKYALDDAEERFPEFDSNNDGLVSWDEYNMVMHGHTVEVDGDAVLEDPEEESLRFLHAKEKRRFDFANMDGSAGLNLTEFLAFTHPSEVDHMADFA-IEDVLSEYDLDKDGFISLSEFI 224          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: zgc:92027 (zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3])

HSP 1 Score: 48.1358 bits (113), Expect = 3.060e-6
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = 1
Query:  328 QNGELTPNEVKYILQQDG------KFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVST-FENWLSKRDMNRDGKLDYNEFLK 693
            Q+GE+   E++  L Q G       FS E+   +I   D +  GK+  +E+KE   +++        WK  F   D DHSG +E  E+ + IAN     GY VS    + + KR  +R GK+ +++++ 
Sbjct:   50 QDGEVDAEELQRCLTQTGISGSYTPFSLETCRIMIALLDRDYTGKMGFNEFKELFGVLNG-------WKQNFMMVDRDHSGTVEPYEMSQSIAN----MGYRVSPRVLDAIVKR-YSRSGKIYFDDYVA 166          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: GCA (zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3])

HSP 1 Score: 47.7506 bits (112), Expect = 3.238e-6
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = 1
Query:  328 QNGELTPNEVKYILQQDG------KFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVST-FENWLSKRDMNRDGKLDYNEFLK 693
            Q+GE+   E++  L Q G       FS E+   +I   D +  GK+  +E+KE   +++        WK  F   D DHSG +E  E+ + IAN     GY VS    + + KR  +R GK+ +++++ 
Sbjct:   52 QDGEVDAEELQRCLTQTGISGSYTPFSLETCRIMIALLDRDYTGKMGFNEFKELFGVLNG-------WKQNFMMVDRDHSGTVEPYEMSQSIAN----MGYRVSPRVLDAIVKR-YSRSGKIYFDDYVA 168          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q07167|SM16_SCHMA (16 kDa calcium-binding protein OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.839e-23
Identity = 53/144 (36.81%), Postives = 85/144 (59.03%), Query Frame = 1
Query:  277 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFINPS 708
            MS  ++  E F  +D D+NG LT  E+   L++ G       ++IIKE D+NSDGKI+L+EY   L  + P  K    W+ VF S D D SG + ++E+ + +   G+    D ++  NW+++ D N+DG+LDY+EFL ++  +
Sbjct:    1 MSEEKQWTEVFHAIDKDKNGFLTREEIAQCLKEVG-VCPNVADKIIKETDMNSDGKISLEEYLNALRKLPPREKCVARWREVFQSIDKDGSGKVSIKELDEFLKTSGM--DIDQNSLRNWMTQNDKNKDGELDYDEFLAYVRQT 141          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q5VQQ5|CDPK2_ORYSJ (Calcium-dependent protein kinase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK2 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.373e-9
Identity = 47/154 (30.52%), Postives = 83/154 (53.90%), Query Frame = 1
Query:  295 LIEKFTEMDLDQNGELTPNEVKYILQQDG-KFSKESVEEIIKEFDINSDGKITLDEY---KEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI---NPSIE*EKNPIK 735
            L E F  MD D +G +T +E++  L + G K ++  V+++++  D + +G I  DE+      +N +D    R E     F  FD D+SG +  EE+++ +   G+ +G D+   ++ +S+ D + DG++DY+EF   +   NP    E NP K
Sbjct:  367 LKEMFKSMDSDNSGTITVDELRKGLSKQGTKLTEAEVQQLMEAADADGNGTIDYDEFITATMHMNRMD----REEHLYTAFQYFDKDNSGCISKEELEQALREKGLLDGRDI---KDIISEVDADNDGRIDYSEFAAMMRKGNP----EANPKK 509          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q9NZT1|CALL5_HUMAN (Calmodulin-like protein 5 OS=Homo sapiens OX=9606 GN=CALML5 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 3.735e-9
Identity = 34/132 (25.76%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  307 FTEMDLDQNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            F+ +D D NG +   E+   L+  GK  S+  + ++I E D + DG+I+  E+   L          E  +  F +FD D  G + ++E+++ +A  G+G        +  + + D+++DG+++Y EF + +
Sbjct:   17 FSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEF---LTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMA--GLGQPLPQEELDAMIREADVDQDGRVNYEEFARML 143          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q9C8Y1|CML23_ARATH (Probable calcium-binding protein CML23 OS=Arabidopsis thaliana OX=3702 GN=CML23 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 5.090e-8
Identity = 37/134 (27.61%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  307 FTEMDLDQNGELTPNEVKYILQQ-DGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEI--WKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            F   D + +G+++ +E+K ++       S+E  + ++KEFD++ +G I LDE+     I D       I   K  FD +DLD +G +   E+  ++ N  +G    +   +  ++K D + DG +D+ EF K +
Sbjct:   20 FQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFDLDGNGFIDLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKN--LGEKCSIQDCQRMINKVDSDGDGCVDFEEFKKMM 151          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q2RAV0|CDPKP_ORYSJ (Calcium-dependent protein kinase 25 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK25 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.410e-8
Identity = 42/139 (30.22%), Postives = 75/139 (53.96%), Query Frame = 1
Query:  295 LIEKFTEMDLDQNGELTPNEVKYILQQDG-KFSKESVEEIIKEFDINSDGKITLDEYKEK---LNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            L E F  +D D +G +T  E+K  L + G KFS   +E++++  D + +G I  +E+      +N +D    R E     F  FD D+SG +  EE+++ +   G+   YD +  ++ ++  D N DG++DY+EF+  +
Sbjct:  389 LKEMFKNIDKDNSGTITLEELKNGLAKQGTKFSDNEIEQLMEAADADGNGIIDYEEFVTATVHMNKMD----REEHLYTAFQYFDKDNSGYITKEELEQALKEQGL---YDANEIKDVITDADSNNDGRIDYSEFVAMM 520          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A504YW13 (16 kDa calcium-binding protein OS=Fasciola gigantica OX=46835 GN=FGIG_02568 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 8.621e-26
Identity = 56/137 (40.88%), Postives = 84/137 (61.31%), Query Frame = 1
Query:  292 RLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFIN 702
            R +EKF EMD D +G L+  EVK  ++  G F +  ++E IK FD++ DG ITL EY+  LNIV P  K   +W++VF   D D SG +   E++ ++    +G  Y  S  + W+S +DM++DG+L+ NEF+ FI 
Sbjct:    8 RFLEKFREMDKDGSGSLSRREVKRCMKSCG-FDERLIDEFIKTFDLDGDGNITLAEYQRVLNIVPPHEKELAMWRSVFREVDTDKSGKISASELEALMRE--MGYDYHASDLKCWMSSQDMDKDGELNLNEFVAFIT 141          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A183A6I0 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2565 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.013e-24
Identity = 58/140 (41.43%), Postives = 86/140 (61.43%), Query Frame = 1
Query:  289 ERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDV--STFENWLSKRDMNRDGKLDYNEFLKFIN 702
            +RL+EKF +MD D +G L+  EVK  ++  G F    + + IK FD++ DG ITL EY+  LNIV    K   +W+NVF   D DHSG + + E++ ++ +     GYD   S  + WLS +D+++DG+L  NEFL FI+
Sbjct:    7 KRLLEKFKQMDKDGSGSLSRKEVKRCMRACG-FDDCFINDFIKTFDLDGDGNITLAEYERVLNIVPAHEKELAMWRNVFHEVDTDHSGKISVSELEVLMKD----MGYDCHASDLKCWLSAQDLDKDGELSLNEFLSFIS 141          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A1I8FZX3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032719g1 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.155e-23
Identity = 53/141 (37.59%), Postives = 83/141 (58.87%), Query Frame = 1
Query:  277 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            MS  E +   F  MD + +G L+  E+   L +   F+ + V+  +  FD N+DGK+TL+E  EKL ++ P    +  WK VFDSFD D SG +E +E+ K++   G    Y+ S FENW+ + D + DG++ Y+EFL ++
Sbjct:    1 MSTIEEMESIFRAMDANGDGVLSEQELTDYLVKKKGFNADFVQTFLANFDSNNDGKVTLNECLEKLGLIPPQEVEYSAWKTVFDSFDKDGSGFIEADELPKVLEEIGSTTKYNRSNFENWIREHDSDADGRVSYSEFLNWV 141          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A2H1CW46 (EF hand OS=Fasciola hepatica OX=6192 GN=D915_00659 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 9.969e-23
Identity = 56/150 (37.33%), Postives = 87/150 (58.00%), Query Frame = 1
Query:  262 FQLLIMSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSK----ESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            F  ++     R +EKF EMD D +G L+  EVK  ++  G   +    ++ +E IK FD++ DG ITL EY+  LNIV P  K   +W++VF   D D SG +   E++ ++    +G  Y  S  + W+S +DM++DG+L+ NEF+ FI
Sbjct:  968 FIKMLQEEERRFLEKFREMDKDGSGSLSRREVKRCMKSCGFDERLIDLKNAQEFIKTFDLDGDGNITLAEYQRVLNIVPPHEKELAMWRSVFREVDTDKSGKISAAELEALMRE--MGYDYHASDLKCWMSSQDMDKDGELNLNEFVAFI 1115          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A0X3NYG9 (Calcium-binding protein OS=Schistocephalus solidus OX=70667 GN=SM16 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.655e-22
Identity = 54/145 (37.24%), Postives = 87/145 (60.00%), Query Frame = 1
Query:  274 IMSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFINPS 708
            + ++ ER I+ F   D D +G LT +E+  +L+++G  S   V++++ + D+N DG ITL EYK  LNI     +  + W+ +FD  D+D SG ++ EE+ + +   G  NG  V+  +NW+ + D N DGKL Y EFLKF+  +
Sbjct:    1 MTTMAERYIDAFIAADKDGSGTLTRDELTAVLKENG-VSAAKVDKLMSKLDLNGDGIITLGEYKVALNIS---SQPMDAWRELFDLIDVDKSGAIDAEELIRFLNESG--NGQLVAAVKNWIKEFDENCDGKLQYKEFLKFVAST 139          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Match: tnnc2 (troponin C type 2 (fast) [Source:ZFIN;Acc:ZDB-GENE-000322-2])

HSP 1 Score: 50.8322 bits (120), Expect = 1.932e-7
Identity = 43/147 (29.25%), Postives = 72/147 (48.98%), Query Frame = 1
Query:  283 LNERLIEKFTEM----DLDQNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEY---KEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            L+E ++ +F       D D  G+++ NE+  +++  G+  ++E + EII+E D +  G I  +E+     +L   D  GK  E     F  FD +  G ++ EE  +II +   G        +  L   D N DG LD++EFLK +
Sbjct:   25 LSEEMLAEFKAAFDMFDTDGGGDISTNELGTVMRMLGQNPTREELAEIIEEVDEDGSGSIDFEEFLVMMVRLLKEDQAGKSEEELAECFRVFDKNADGYIDREEFAEIIRS--TGESITEDEIDELLKDGDKNADGMLDFDEFLKMM 169          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Match: slc25a23b (calcium-binding mitochondrial carrier protein SCaMC-3-like [Source:NCBI gene;Acc:103039361])

HSP 1 Score: 50.8322 bits (120), Expect = 6.753e-7
Identity = 39/136 (28.68%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  286 NERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKL--DYNEF 687
            ++R  E F ++DL+++G +  +E++  L   G  ++  V+EI++  D N DG++   E+ + L   +   K  ++   +F S D ++ G +++ EIQ+ + + GV    +VST + +   R M+RDG +  D+NE+
Sbjct:   25 DKRWAELFQQLDLNKDGRIDVHELRSGLAAWG-VARTDVDEIVRVSDTNHDGQLDFQEFTQYLRTHE---KELKL---MFRSLDRNNDGQIDVGEIQQSLHSLGV----EVSTEQAYRILRSMDRDGTMTIDWNEW 149          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000025429.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:22005497:22012905:-1 gene:ENSAMXG00000024706.2 transcript:ENSAMXT00000025429.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 2.278e-6
Identity = 35/128 (27.34%), Postives = 67/128 (52.34%), Query Frame = 1
Query:  328 QNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEYKEKLNIV---DPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            ++G ++  E+  +++  G+  + E ++EII E D +  G +  DE+   +      D   K  E   ++F  FD +  G +++EE++ ++ + G     D    E  +   D N DGK+DY+EFL+F+
Sbjct:   28 EDGCISTKELGKVMRMLGQNPTPEELQEIIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKAKSEEELADLFRMFDKNKDGYIDMEELRAMLTSTGESISED--DVEELMKDGDKNNDGKIDYDEFLEFM 153          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Match: slc25a23a (calcium-binding mitochondrial carrier protein SCaMC-3 [Source:NCBI gene;Acc:103026535])

HSP 1 Score: 48.9062 bits (115), Expect = 3.202e-6
Identity = 42/131 (32.06%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  286 NERL-IEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEE-IIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKL 672
             ERL  E F E+DL+++G +  NE+K  L   G   + SVEE I++  D N DG++  +E+ + L   +   KR  +   +F S D ++ G +++ EIQ  + + GV    DV+  E     + M++DG +
Sbjct:   26 RERLWAELFDELDLNKDGRIDINELKIGLAARGLLPQTSVEEQIVRAGDTNQDGQLDFEEFTQYLRSHE---KRLRL---MFSSLDRNNDGQIDVGEIQLSLQSVGV----DVTYEEASKILQSMDKDGTM 146          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Match: si:rp71-17i16.4 (troponin C, skeletal muscle [Source:NCBI gene;Acc:103044939])

HSP 1 Score: 46.595 bits (109), Expect = 3.903e-6
Identity = 41/148 (27.70%), Postives = 74/148 (50.00%), Query Frame = 1
Query:  283 LNERLIEKFTEM----DLDQNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEY----KEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            L+E +I +F       D D  G+++  E+  +++  G+  S+E ++ II+E D +  G I  +E+     ++L   D  GK  E     F  FD +  G ++ EE   I+ +   G        +  ++  D N+DGK+D++EFLK +
Sbjct:   13 LSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLK-EDQAGKSEEELSECFRVFDKNGDGFIDREEFGDIMRS--TGEPITEDEIDELMTDGDTNKDGKIDFDEFLKMM 157          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO44845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUF3])

HSP 1 Score: 48.1358 bits (113), Expect = 5.122e-7
Identity = 37/135 (27.41%), Postives = 69/135 (51.11%), Query Frame = 1
Query:  307 FTEMDLDQNGELTPNEVKYILQQDGKF--SKESVEEIIKEFDINSDGKITLDEYKEKLN-IVDPVGKRFEI-WKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            F   D D +G++   +   +  +D  F  S E ++ ++ +FD ++D +I   E+ + +  I D  G+ FE   +  F  FD D SG +  EE++ ++ + G     D +     +   D N+DG+L + EF++FI
Sbjct:   26 FKRADSDASGKIQGEQF-CLAAKDAGFDTSTEDLQRVLSKFDKDTDSEINFGEFVDMMKYIEDSSGQDFEANLREAFRKFDRDGSGYISPEELRYVVCHSGEKLSEDEA--RELIDMFDKNKDGQLSWEEFVEFI 157          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO46008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRG8])

HSP 1 Score: 46.2098 bits (108), Expect = 2.446e-6
Identity = 35/149 (23.49%), Postives = 75/149 (50.34%), Query Frame = 1
Query:  277 MSLNERLIEK------FTEMDLDQNGELTPNEVKYILQQD--GKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVS--TFENWLSKRDMNRDGKLDYNEFLK 693
            M+ N+  I++      FT +D D+NG +T +E++  L       F+ E+V   +  FD ++ G I  +E+      V         W+  F S+D D+SG ++++E++  + +     G+ +S   +   ++K D   +G + +++F++
Sbjct:    1 MAYNQVPIDRNWLYGIFTRIDADKNGAITGDELQKALSNGSWAPFNPETVRLFMGMFDRDNSGTIEFNEFYSLWQYVTD-------WQKAFRSYDTDNSGTIDIDELKTALRS----FGFRLSDRIYSMLITKFDRTGNGAIRFDDFIQ 138          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO38075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE04])

HSP 1 Score: 45.0542 bits (105), Expect = 5.554e-6
Identity = 27/96 (28.12%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  316 MDLDQNGELTPNEVKYILQQD--GKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDG 597
            +D D+ G++T +E++  L      +F++E+   +I  FD +  G I + E+         + +  + WKN FDSFD D SG ++  E+    +  G
Sbjct:    2 VDQDRTGKITASELRAALVNSNWSQFNEETCRMMIGMFDKDGSGTIDIYEFA-------ALWQYIQQWKNCFDSFDRDRSGTIDAGELNTAFSTFG 90          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO45935 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRE8])

HSP 1 Score: 44.2838 bits (103), Expect = 9.011e-6
Identity = 34/141 (24.11%), Postives = 72/141 (51.06%), Query Frame = 1
Query:  307 FTEMDLDQNGELTPNEVKYILQQDGKF-SKESVEEIIKEFDINSDGKITLDEYKE----KLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIA---NDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFINP 705
            F   D + +G+++  E+   +++ G+  S E ++++I+  D++ +GK+   E+ +    +L    PV    E  K  FD FD D +G ++ +E++ ++    ++  G+          +   D N DGK+ + EF+K +N 
Sbjct:   17 FKMYDTNGDGQISAEELGQAMREAGQLVSDEELKDMIRAVDLDGNGKVEFKEFVQMMANQLGQPAPV----EEMKAYFDRFDQDGNGFIDSDEMKCLVRAFYSNLTGDALK-QQVRAMIEAADTNSDGKISFEEFVKVLNA 152          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Match: tnnc2 (troponin C, skeletal muscle [Source:NCBI gene;Acc:101171829])

HSP 1 Score: 48.1358 bits (113), Expect = 1.423e-6
Identity = 42/147 (28.57%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  283 LNERLIEKFTEM----DLDQNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEY---KEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            L+E ++ +F       D D  G+++  E+  +++  G+  ++E ++EII+E D +  G I  +E+     +L   D  GK  E     F  FD +  G ++ EE  +II + G     D    +  +   D N DG LD++EFLK +
Sbjct:   12 LSEEMLAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTREELDEIIEEVDEDGSGTIDFEEFLVMMVRLLKEDQAGKSEEELAECFRVFDKNGDGVIDREEFAQIIRSSGEPISED--EIDELMKDGDKNNDGMLDFDEFLKMM 156          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Match: ENSORLT00000041617.1 (sorcin-like [Source:NCBI gene;Acc:101157587])

HSP 1 Score: 48.1358 bits (113), Expect = 1.839e-6
Identity = 36/129 (27.91%), Postives = 64/129 (49.61%), Query Frame = 1
Query:  328 QNGELTPNEVKYILQQDG------KFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVST-FENWLSKRDMNRDGKLDYNEFLK 693
            Q+G++T +E++  L Q G       FS E+   +I   D +  G +  +E+++    ++        WK  F SFD D SG +E +E+Q+ I       GY++S    N +  R  N  GK+ +++F+ 
Sbjct:   32 QDGQITADELQACLTQSGISGTYKPFSLETCRLMINMLDRDMSGTMGFNEFRDLWQALNG-------WKGTFVSFDRDQSGTIEGQELQQAIRT----LGYNLSPQAMNCIMMRYSNH-GKIPFDDFVS 148          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Match: ENSORLT00000030172.1 (troponin C, slow skeletal and cardiac muscles [Source:NCBI gene;Acc:101174831])

HSP 1 Score: 47.3654 bits (111), Expect = 2.224e-6
Identity = 35/128 (27.34%), Postives = 66/128 (51.56%), Query Frame = 1
Query:  328 QNGELTPNEVKYILQQDGK-FSKESVEEIIKEFDINSDGKITLDEYKEKLNIV---DPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            ++G ++  E+  +++  G+  + E ++E+I E D +  G +  DE+   +      D  GK  E    +F  FD +  G ++LEE++ ++  +  G        E  +   D N DGK+DY+EFL+F+
Sbjct:   32 EDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELAELFRMFDKNADGYIDLEELKMML--ESTGEAITEDDIEELMKDGDKNNDGKIDYDEFLEFM 157          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000016862.1 (SMESG000016862.1)

HSP 1 Score: 208.764 bits (530), Expect = 1.044e-68
Identity = 104/111 (93.69%), Postives = 104/111 (93.69%), Query Frame = 1
Query:  277 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNG 609
            MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIA       
Sbjct:    1 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIATTASATA 111          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000000553.1 (SMESG000000553.1)

HSP 1 Score: 117.087 bits (292), Expect = 1.582e-32
Identity = 64/141 (45.39%), Postives = 90/141 (63.83%), Query Frame = 1
Query:  277 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            M  NE+LI KF EMD + + EL+  E+   L++ G F K  ++  +K FD N DGKITL+EYK KLN+     +R+ +W++VF+SFD D SG L  EE+  I+      N +D  T +NWL  RD N DG++DY+EFL F+
Sbjct:    1 MVSNEQLIAKFKEMDRNGDNELSVEEISSSLEKSG-FDKTFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILK----SNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 136          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000066843.1 (SMESG000066843.1)

HSP 1 Score: 108.227 bits (269), Expect = 3.617e-29
Identity = 54/142 (38.03%), Postives = 89/142 (62.68%), Query Frame = 1
Query:  277 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFIN 702
            M+ NE+L+E+F +MD D N EL+  EV   L ++G F+ E +++ ++ FD N DGKI+  E+ +++    P  ++ E+W+ VF SFD D SG L  +E+Q ++     GN YD  T E ++   D + DG+L+Y EF +F++
Sbjct:    1 MATNEQLLEQFAKMDTDHNNELSTEEVTCFLSKNG-FAAEYIKKFMETFDANKDGKISKSEFTKRICNQTPHERKIEMWEAVFKSFDTDCSGKLSAKELQAVLK----GNNYDKETLEKFIKSHDKDGDGELNYKEFFEFLH 137          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000057759.1 (SMESG000057759.1)

HSP 1 Score: 71.633 bits (174), Expect = 2.444e-15
Identity = 45/141 (31.91%), Postives = 75/141 (53.19%), Query Frame = 1
Query:  277 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFI 699
            M   E  ++ F ++D D++G +  NEV+  L++ G F  E ++  I  FD+N DGKIT  E+   L  +    + +  W ++F   D D +G + + E+  II      +        +++ K D++ DG L+YNEFLKFI
Sbjct:    1 METEEEFLQIFYDIDKDKSGAIELNEVEIYLRKHG-FQSEFIKLFIDTFDLNKDGKITFKEFINSLKKMPLKHRNYTEWFSLFKRLDEDSNGYITIGELFNIIQESDNKHSIKKKQLSDFVQKNDLDNDGLLNYNEFLKFI 140          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000068256.1 (SMESG000068256.1)

HSP 1 Score: 50.8322 bits (120), Expect = 1.473e-7
Identity = 36/137 (26.28%), Postives = 70/137 (51.09%), Query Frame = 1
Query:  295 LIEKFTEMDLDQNGELTPNEVKYILQQDG--KFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKIIANDGVGNGYDVS--TFENWLSKRDMNRDGKLDYNEFLK 693
            L E F ++D D+NG+++  E++  L       F+ E+V  +I  FD +++G+I  DE++     +         W+  F  FDLD+SG ++  E++  + +     GY +S   F   + K D    G + +++F++
Sbjct:   11 LREMFNKVDRDKNGQISQQELQSALSNGTWTPFNPETVRLMIGMFDRDNNGQIGFDEFESLWTYIIH-------WQQTFQRFDLDNSGSIDFHELKNALTS----FGYRLSDNFFRLLIRKFDRQAHGTVAFDDFIQ 136          
The following BLAST results are available for this feature:
BLAST of 16 kDa calcium-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CALML57.777e-1025.76calmodulin like 5 [Source:HGNC Symbol;Acc:HGNC:181... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cal-83.154e-728.47CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
B0563.75.864e-738.81Uncharacterized calcium-binding protein B0563.7 [... [more]
M04F3.43.327e-625.18pep chromosome:WBcel235:I:4771348:4773070:-1 gene:... [more]
M04F3.43.327e-625.18pep chromosome:WBcel235:I:4771348:4773673:-1 gene:... [more]
M04F3.43.327e-625.18pep chromosome:WBcel235:I:4771600:4773026:-1 gene:... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR749762.51.706e-627.70si:rp71-17i16.4 [Source:NCBI gene;Acc:100002038][more]
si:rp71-17i16.41.980e-627.70si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-2... [more]
rcn22.888e-628.19reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
zgc:920273.060e-630.23zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3][more]
GCA3.238e-630.23zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3][more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07167|SM16_SCHMA5.839e-2336.8116 kDa calcium-binding protein OS=Schistosoma mans... [more]
sp|Q5VQQ5|CDPK2_ORYSJ2.373e-930.52Calcium-dependent protein kinase 2 OS=Oryza sativa... [more]
sp|Q9NZT1|CALL5_HUMAN3.735e-925.76Calmodulin-like protein 5 OS=Homo sapiens OX=9606 ... [more]
sp|Q9C8Y1|CML23_ARATH5.090e-827.61Probable calcium-binding protein CML23 OS=Arabidop... [more]
sp|Q2RAV0|CDPKP_ORYSJ7.410e-830.22Calcium-dependent protein kinase 25 OS=Oryza sativ... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YW138.621e-2640.8816 kDa calcium-binding protein OS=Fasciola giganti... [more]
A0A183A6I01.013e-2441.43Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A1I8FZX39.155e-2337.59Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2H1CW469.969e-2337.33EF hand OS=Fasciola hepatica OX=6192 GN=D915_00659... [more]
A0A0X3NYG93.655e-2237.24Calcium-binding protein OS=Schistocephalus solidus... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnnc21.932e-729.25troponin C type 2 (fast) [Source:ZFIN;Acc:ZDB-GENE... [more]
slc25a23b6.753e-728.68calcium-binding mitochondrial carrier protein SCaM... [more]
ENSAMXT00000025429.22.278e-627.34pep primary_assembly:Astyanax_mexicanus-2.0:22:220... [more]
slc25a23a3.202e-632.06calcium-binding mitochondrial carrier protein SCaM... [more]
si:rp71-17i16.43.903e-627.70troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO448455.122e-727.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460082.446e-623.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380755.554e-628.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459359.011e-624.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tnnc21.423e-628.57troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
ENSORLT00000041617.11.839e-627.91sorcin-like [Source:NCBI gene;Acc:101157587][more]
ENSORLT00000030172.12.224e-627.34troponin C, slow skeletal and cardiac muscles [Sou... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016862.11.044e-6893.69SMESG000016862.1[more]
SMESG000000553.11.582e-3245.39SMESG000000553.1[more]
SMESG000066843.13.617e-2938.03SMESG000066843.1[more]
SMESG000057759.12.444e-1531.91SMESG000057759.1[more]
SMESG000068256.11.473e-726.28SMESG000068256.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003724 ID=SMED30003724|Name=16 kDa calcium-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=848bp
AGACAACCCCCCAGATATTAACGAGCCATTAAGATAGAAAAATGACAATC
CATCAATTTCCATTATCTACATCAGTAAATTACATGTTTGATAACAATCG
AATATTTTGTTTTAATTTACACACCATTAAATTTATTGTGATTTTTTCAC
TGTAAAACTTTATTTATTTATTTCAATTGGAATTTTCCTTTTCTTTTCGA
ATTTTGTCAATCAAATTTATAATAAAAGCTTGATTTAATCAACTAATTTA
CCGTTTGAAATTTTCAACTCTTGATAATGAGTCTCAATGAAAGATTAATT
GAAAAGTTTACCGAAATGGATCTCGATCAAAATGGAGAATTGACACCAAA
TGAAGTTAAATATATATTACAACAAGATGGGAAATTTTCTAAGGAAAGTG
TTGAGGAAATCATCAAAGAATTCGACATTAATTCCGACGGAAAAATAACT
CTGGACGAGTACAAAGAAAAACTAAATATTGTTGATCCGGTAGGCAAAAG
ATTTGAAATTTGGAAAAACGTTTTCGACAGCTTTGATCTCGATCATTCAG
GTGGACTGGAGTTAGAGGAAATCCAGAAAATTATTGCCAACGACGGCGTC
GGCAACGGCTACGATGTGAGCACTTTTGAAAATTGGTTGTCAAAACGAGA
CATGAATCGAGATGGGAAATTAGATTATAATGAGTTTCTCAAATTTATCA
ACCCGAGCATCGAGTGAGAAAAAAACCCTATTAAATTCATTTGATCTTGG
TTTGATTTGATTTCTTTTAAAAAACTTTTTTAAAATCAAAATTATAATTG
ATTCGATGATTTTATTAATGCATTAAATTTGTGTTTTTTTGAAAAAAA
back to top

protein sequence of SMED30003724-orf-1

>SMED30003724-orf-1 ID=SMED30003724-orf-1|Name=SMED30003724-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFD
INSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQ
KIIANDGVGNGYDVSTFENWLSKRDMNRDGKLDYNEFLKFINPSIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding