Glucose-6-phosphate isomerase

Overview
NameGlucose-6-phosphate isomerase
Smed IDSMED30003716
Length (bp)1815
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glucose-6-phosphate isomerase (SMED30003716) t-SNE clustered cells

Violin plots show distribution of expression levels for Glucose-6-phosphate isomerase (SMED30003716) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glucose-6-phosphate isomerase (SMED30003716) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glucose-6-phosphate isomerase (SMED30003716) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003716

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003716SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003716SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003716SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003716SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003716SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003716SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003716SMESG000067583.1 OX_Smed_1.0.03830ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 366/533 (68.67%), Postives = 435/533 (81.61%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +N+   FD+N +RF+ FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITDV+NIGIGGSDLGP+MVTEALKP+++   RV +VSNIDGTH+A+TLA+LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  S+   +TSHD+STNGLI FIK Q+
Sbjct:   63 LNLRRLFDANKDRFNHFSLTLN-TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQ--VTSHDASTNGLINFIKQQR 592          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 366/533 (68.67%), Postives = 435/533 (81.61%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +N+   FD+N +RF+ FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITDV+NIGIGGSDLGP+MVTEALKP+++   RV +VSNIDGTH+A+TLA+LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  S+   +TSHD+STNGLI FIK Q+
Sbjct:   24 LNLRRLFDANKDRFNHFSLTLN-TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQ--VTSHDASTNGLINFIKQQR 553          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 347/533 (65.10%), Postives = 413/533 (77.49%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +N+   FD+N +RF+ FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F +                            GP+MVTEALKP+++   RV +VSNIDGTH+A+TLA+LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  S+   +TSHD+STNGLI FIK Q+
Sbjct:   63 LNLRRLFDANKDRFNHFSLTLN-TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQ----------------------------GPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQ--VTSHDASTNGLINFIKQQR 564          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 274/419 (65.39%), Postives = 331/419 (79.00%), Query Frame = 2
Query:  161 FSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLS------NFLAQTEALMRGKGAEKVREELEA 1399
            FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITDV+NIGIGGSDLGP+MVTEALKP+++   RV +VSNIDGTH+A+TLA+LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+I +       N   Q    +  + A+K+  EL+ 
Sbjct:    3 FSLTLN-TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDG 420          

HSP 2 Score: 87.8113 bits (216), Expect = 1.033e-17
Identity = 42/60 (70.00%), Postives = 49/60 (81.67%), Query Frame = 2
Query: 1532 HKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            HKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  S+   +TSHD+STNGLI FIK Q+
Sbjct:  385 HKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQ--VTSHDASTNGLINFIKQQR 442          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 324.324 bits (830), Expect = 1.068e-106
Identity = 157/247 (63.56%), Postives = 194/247 (78.54%), Query Frame = 2
Query:  110 HINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWD 850
             +N+   FD+N +RF+ FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITDV+NIGIGGSDLGP+MVTEALKP+++   RV +VSNIDGTH+A+TLA+LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWD
Sbjct:   38 ELNLRRLFDANKDRFNHFSLTLN-TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWD 283          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 351/534 (65.73%), Postives = 412/534 (77.15%), Query Frame = 2
Query:  104 EKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            EK   +   F+ +  RF +F+R     + G  LFDFSKN I+ + F+ L++LAK   VE  RN MFS EKINFTENR+VLH+ALRNR+N+ I VD  DVMP VN VL HM+EF   +  G + G+TGKKITDVVNIGIGGSDLGP+MVTE+LK +      VHFVSN+DGTH+AE   KLN ET LFIIASKTFTT ET+TNA+TAK+WFL     A AV+KHFVALSTN+ K  EFGIDEKNMFEFWDWVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVE GK LAK IQ EL  +S   +TSHD+STNGLI FIK+
Sbjct:   55 EKDAQLLELFEKDPARFEKFTRLFATPD-GDFLFDFSKNRITDESFQLLMRLAKSRGVEESRNAMFSAEKINFTENRAVLHVALRNRANRPILVDGKDVMPDVNRVLAHMKEFCNEIISGSWTGYTGKKITDVVNIGIGGSDLGPLMVTESLKNY-QIGPNVHFVSNVDGTHVAEVTKKLNAETTLFIIASKTFTTQETITNAETAKEWFLAKAGDAGAVAKHFVALSTNVTKAVEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPEL--ASADTVTSHDASTNGLIAFIKN 584          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 351/534 (65.73%), Postives = 412/534 (77.15%), Query Frame = 2
Query:  104 EKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            EK   +   F+ +  RF +F+R     + G  LFDFSKN I+ + F+ L++LAK   VE  RN MFS EKINFTENR+VLH+ALRNR+N+ I VD  DVMP VN VL HM+EF   +  G + G+TGKKITDVVNIGIGGSDLGP+MVTE+LK +      VHFVSN+DGTH+AE   KLN ET LFIIASKTFTT ET+TNA+TAK+WFL     A AV+KHFVALSTN+ K  EFGIDEKNMFEFWDWVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVE GK LAK IQ EL  +S   +TSHD+STNGLI FIK+
Sbjct:   20 EKDAQLLELFEKDPARFEKFTRLFATPD-GDFLFDFSKNRITDESFQLLMRLAKSRGVEESRNAMFSAEKINFTENRAVLHVALRNRANRPILVDGKDVMPDVNRVLAHMKEFCNEIISGSWTGYTGKKITDVVNIGIGGSDLGPLMVTESLKNY-QIGPNVHFVSNVDGTHVAEVTKKLNAETTLFIIASKTFTTQETITNAETAKEWFLAKAGDAGAVAKHFVALSTNVTKAVEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPEL--ASADTVTSHDASTNGLIAFIKN 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 351/534 (65.73%), Postives = 412/534 (77.15%), Query Frame = 2
Query:  104 EKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            EK   +   F+ +  RF +F+R     + G  LFDFSKN I+ + F+ L++LAK   VE  RN MFS EKINFTENR+VLH+ALRNR+N+ I VD  DVMP VN VL HM+EF   +  G + G+TGKKITDVVNIGIGGSDLGP+MVTE+LK +      VHFVSN+DGTH+AE   KLN ET LFIIASKTFTT ET+TNA+TAK+WFL     A AV+KHFVALSTN+ K  EFGIDEKNMFEFWDWVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVE GK LAK IQ EL  +S   +TSHD+STNGLI FIK+
Sbjct:   20 EKDAQLLELFEKDPARFEKFTRLFATPD-GDFLFDFSKNRITDESFQLLMRLAKSRGVEESRNAMFSAEKINFTENRAVLHVALRNRANRPILVDGKDVMPDVNRVLAHMKEFCNEIISGSWTGYTGKKITDVVNIGIGGSDLGPLMVTESLKNY-QIGPNVHFVSNVDGTHVAEVTKKLNAETTLFIIASKTFTTQETITNAETAKEWFLAKAGDAGAVAKHFVALSTNVTKAVEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPEL--ASADTVTSHDASTNGLIAFIKN 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 351/534 (65.73%), Postives = 412/534 (77.15%), Query Frame = 2
Query:  104 EKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            EK   +   F+ +  RF +F+R     + G  LFDFSKN I+ + F+ L++LAK   VE  RN MFS EKINFTENR+VLH+ALRNR+N+ I VD  DVMP VN VL HM+EF   +  G + G+TGKKITDVVNIGIGGSDLGP+MVTE+LK +      VHFVSN+DGTH+AE   KLN ET LFIIASKTFTT ET+TNA+TAK+WFL     A AV+KHFVALSTN+ K  EFGIDEKNMFEFWDWVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVE GK LAK IQ EL  +S   +TSHD+STNGLI FIK+
Sbjct:   20 EKDAQLLELFEKDPARFEKFTRLFATPD-GDFLFDFSKNRITDESFQLLMRLAKSRGVEESRNAMFSAEKINFTENRAVLHVALRNRANRPILVDGKDVMPDVNRVLAHMKEFCNEIISGSWTGYTGKKITDVVNIGIGGSDLGPLMVTESLKNY-QIGPNVHFVSNVDGTHVAEVTKKLNAETTLFIIASKTFTTQETITNAETAKEWFLAKAGDAGAVAKHFVALSTNVTKAVEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPEL--ASADTVTSHDASTNGLIAFIKN 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Match: Pgi (gene:FBgn0003074 transcript:FBtr0088680)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 348/547 (63.62%), Postives = 417/547 (76.23%), Query Frame = 2
Query:   77 ASLQK----FTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            A+ QK    +  K K +N+ + F  +S RFS++S  L  +  G++L D+SKN I+ +++  L+ LAK   V   R+ MFSG+ IN TENR+VLH ALRNR    + VD  DVMP V A L HM+EFT  V  G++ G TGK+ITDVVNIGIGGSDLGP+MVTEALKP+  K +  HFVSNIDGTH+AE L K+N ET LFI+ASKTFTT ET+TNA +AK W L++ K   +V+KHFVALSTN  KV EFGID  NMF FWDWVGGRYSLWSAIGLSI L IG +NFE+LL G H MDNHFK TP E+N PVI+A+LG+ Y + +KAETHA+LPYDQY+HRFAAYFQQGDMESNGKF++  GK V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIP DF+ P+QTHNPI  G HH+ILLSNFLAQTEALM GK  ++ R EL   G+ G +L+ L  HK F GNRPTNS V  K++PF LG LIA+YEHKIFVQG IW+INS+DQWGVE GK LAK I+ EL   +   +++HDSSTNGLI FIK+
Sbjct:   12 AAFQKLQEYYDSKGKDLNIKDLFVKDSKRFSKYSLRLHTQNDGEILLDYSKNRINDEVWDLLLTLAKVRRVNAARDAMFSGQHINITENRAVLHTALRNRGTDPVLVDDKDVMPDVRAELAHMKEFTNMVISGVWRGCTGKQITDVVNIGIGGSDLGPLMVTEALKPYG-KGLHSHFVSNIDGTHLAEVLKKVNYETTLFIVASKTFTTQETITNATSAKTWLLEHSKEPESVAKHFVALSTNKEKVTEFGIDSTNMFGFWDWVGGRYSLWSAIGLSICLSIGFENFEQLLDGAHFMDNHFKTTPFEKNAPVILALLGVWYSNFFKAETHALLPYDQYLHRFAAYFQQGDMESNGKFVSKSGKPVKYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPCDFIAPAQTHNPIAGGKHHKILLSNFLAQTEALMAGKTVDEARTELSKAGLCGNELDNLLPHKVFVGNRPTNSIVVKKVSPFTLGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKAIEPELDHCNE--VSTHDSSTNGLINFIKA 555          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Match: Pgi (gene:FBgn0003074 transcript:FBtr0088681)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 348/547 (63.62%), Postives = 417/547 (76.23%), Query Frame = 2
Query:   77 ASLQK----FTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            A+ QK    +  K K +N+ + F  +S RFS++S  L  +  G++L D+SKN I+ +++  L+ LAK   V   R+ MFSG+ IN TENR+VLH ALRNR    + VD  DVMP V A L HM+EFT  V  G++ G TGK+ITDVVNIGIGGSDLGP+MVTEALKP+  K +  HFVSNIDGTH+AE L K+N ET LFI+ASKTFTT ET+TNA +AK W L++ K   +V+KHFVALSTN  KV EFGID  NMF FWDWVGGRYSLWSAIGLSI L IG +NFE+LL G H MDNHFK TP E+N PVI+A+LG+ Y + +KAETHA+LPYDQY+HRFAAYFQQGDMESNGKF++  GK V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIP DF+ P+QTHNPI  G HH+ILLSNFLAQTEALM GK  ++ R EL   G+ G +L+ L  HK F GNRPTNS V  K++PF LG LIA+YEHKIFVQG IW+INS+DQWGVE GK LAK I+ EL   +   +++HDSSTNGLI FIK+
Sbjct:   12 AAFQKLQEYYDSKGKDLNIKDLFVKDSKRFSKYSLRLHTQNDGEILLDYSKNRINDEVWDLLLTLAKVRRVNAARDAMFSGQHINITENRAVLHTALRNRGTDPVLVDDKDVMPDVRAELAHMKEFTNMVISGVWRGCTGKQITDVVNIGIGGSDLGPLMVTEALKPYG-KGLHSHFVSNIDGTHLAEVLKKVNYETTLFIVASKTFTTQETITNATSAKTWLLEHSKEPESVAKHFVALSTNKEKVTEFGIDSTNMFGFWDWVGGRYSLWSAIGLSICLSIGFENFEQLLDGAHFMDNHFKTTPFEKNAPVILALLGVWYSNFFKAETHALLPYDQYLHRFAAYFQQGDMESNGKFVSKSGKPVKYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPCDFIAPAQTHNPIAGGKHHKILLSNFLAQTEALMAGKTVDEARTELSKAGLCGNELDNLLPHKVFVGNRPTNSIVVKKVSPFTLGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKAIEPELDHCNE--VSTHDSSTNGLINFIKA 555          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Match: Pgi (gene:FBgn0003074 transcript:FBtr0088679)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 348/547 (63.62%), Postives = 417/547 (76.23%), Query Frame = 2
Query:   77 ASLQK----FTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            A+ QK    +  K K +N+ + F  +S RFS++S  L  +  G++L D+SKN I+ +++  L+ LAK   V   R+ MFSG+ IN TENR+VLH ALRNR    + VD  DVMP V A L HM+EFT  V  G++ G TGK+ITDVVNIGIGGSDLGP+MVTEALKP+  K +  HFVSNIDGTH+AE L K+N ET LFI+ASKTFTT ET+TNA +AK W L++ K   +V+KHFVALSTN  KV EFGID  NMF FWDWVGGRYSLWSAIGLSI L IG +NFE+LL G H MDNHFK TP E+N PVI+A+LG+ Y + +KAETHA+LPYDQY+HRFAAYFQQGDMESNGKF++  GK V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIP DF+ P+QTHNPI  G HH+ILLSNFLAQTEALM GK  ++ R EL   G+ G +L+ L  HK F GNRPTNS V  K++PF LG LIA+YEHKIFVQG IW+INS+DQWGVE GK LAK I+ EL   +   +++HDSSTNGLI FIK+
Sbjct:   12 AAFQKLQEYYDSKGKDLNIKDLFVKDSKRFSKYSLRLHTQNDGEILLDYSKNRINDEVWDLLLTLAKVRRVNAARDAMFSGQHINITENRAVLHTALRNRGTDPVLVDDKDVMPDVRAELAHMKEFTNMVISGVWRGCTGKQITDVVNIGIGGSDLGPLMVTEALKPYG-KGLHSHFVSNIDGTHLAEVLKKVNYETTLFIVASKTFTTQETITNATSAKTWLLEHSKEPESVAKHFVALSTNKEKVTEFGIDSTNMFGFWDWVGGRYSLWSAIGLSICLSIGFENFEQLLDGAHFMDNHFKTTPFEKNAPVILALLGVWYSNFFKAETHALLPYDQYLHRFAAYFQQGDMESNGKFVSKSGKPVKYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPCDFIAPAQTHNPIAGGKHHKILLSNFLAQTEALMAGKTVDEARTELSKAGLCGNELDNLLPHKVFVGNRPTNSIVVKKVSPFTLGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKAIEPELDHCNE--VSTHDSSTNGLINFIKA 555          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Zebrafish
Match: gpib (glucose-6-phosphate isomerase b [Source:ZFIN;Acc:ZDB-GENE-020513-3])

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 361/532 (67.86%), Postives = 439/532 (82.52%), Query Frame = 2
Query:  110 HINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKS 1705
            ++NM   F+ +  RF +FS TL   E G +L D+SKNLI+ ++ + L++LAK   VE  R+KMFSGEKINFTE R+VLH+ALRNRSN  I+VD  DVMP VN VL+ M+ F   V  G + G TGK ITDVVN+GIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LN ET LFIIASKTFTT ET+TNA++AK+WFL+  K ASAV+KHFVALSTN PKVK+FGID +NMFEFWDWVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MD HF+  P++QN P+++A+LGI YI+ ++AETH +LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR++PADFLIP+QT +PI N LHH+ILL+NFLAQTEALM+GK  E+ ++ELEA G+SG +LE +  HK F GN+PTNS VF K++PF LGVLIAMYEHKIF+QG +WEINS+DQWGVE GK LAKKI+ EL+ S+   ++SHDSSTNGLI F+K+
Sbjct:   22 NLNMRQMFEEDKTRFQKFSLTLKTDE-GDILLDYSKNLINEEVKKMLVELAKSRGVEASRDKMFSGEKINFTEGRAVLHVALRNRSNTPIHVDGKDVMPEVNKVLEKMKGFCHKVRSGEWKGFTGKSITDVVNVGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLAELNAETTLFIIASKTFTTQETITNAESAKEWFLQAAKDASAVAKHFVALSTNGPKVKDFGIDPENMFEFWDWVGGRYSLWSAIGLSIALHIGYENFEKLLAGAHWMDTHFRTAPVDQNAPMLLALLGIWYINFFQAETHCLLPYDQYMHRFAAYFQQGDMESNGKYITTKGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPADFLIPAQTQHPIRNSLHHKILLANFLAQTEALMKGKTTEEAKKELEAGGLSGDNLEKILPHKVFQGNKPTNSIVFKKLSPFTLGVLIAMYEHKIFIQGVMWEINSFDQWGVELGKQLAKKIEPELQDSAQ--VSSHDSSTNGLINFLKN 550          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Zebrafish
Match: gpia (glucose-6-phosphate isomerase a [Source:ZFIN;Acc:ZDB-GENE-020513-2])

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 364/550 (66.18%), Postives = 437/550 (79.45%), Query Frame = 2
Query:   62 NFIEMASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            NFI++   Q +     ++NM   F+++++RF++FS  L   + G LL DFSKNLI+ D+   L  +A+   VE  R +MF+GEKINFTE R+VLH ALRNRSN  I VD  DVMP VN VL+ M+ F   V  G + G +GK ITDVVNIGIGGSDLGP+MVTEALKP++     V FVSNIDGTHMA+TLA+LN ET LFIIASKTFTT ET+TNA+TA++WFL+  K  SAV+KHFVALSTN PKVKEFGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG DNFE+LLSG H MDNHF+  PLEQN PVI+A+LG+ Y++ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTRLIPADFLIP+Q+ +PI + LHH+IL++NFLAQTEALMRGK +++ ++EL+A G+SG  LE L  HK F GN+P+NS +F K+ PFMLG L+AMYEHKIFVQG +W INSYDQWGVE GK LAKKI+ EL+  +   + SHDSSTNGLI F K  +
Sbjct:    8 NFIKLE--QWYKSSAGNLNMRQMFEADADRFNKFSLQLS-TDDGDLLLDFSKNLINEDVMSLLFDMARSVGVEAAREQMFAGEKINFTEGRAVLHTALRNRSNTPIIVDGKDVMPEVNRVLEQMKSFCHKVRSGAWKGFSGKSITDVVNIGIGGSDLGPLMVTEALKPYSKGGPNVWFVSNIDGTHMAKTLAQLNAETTLFIIASKTFTTQETITNAETAREWFLQAAKDKSAVAKHFVALSTNAPKVKEFGIDTNNMFEFWDWVGGRYSLWSAIGLSIALHIGFDNFEQLLSGAHWMDNHFRSAPLEQNAPVILALLGVWYVNFFQAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQSQHPIRDNLHHKILMANFLAQTEALMRGKTSDEAKKELQASGLSGDSLEKLLPHKVFQGNKPSNSIIFKKLTPFMLGALVAMYEHKIFVQGVMWNINSYDQWGVELGKQLAKKIEPELQDDAE--VHSHDSSTNGLIGFFKKNR 552          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/533 (70.17%), Postives = 440/533 (82.55%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +NM   F+++  RFS+FS+TL   +HG +L D+SKNLI+ D+ + LI+LA    VE+ R KMFS EKINFTENR+VLHIALRNRSN    ++  DVMP VNAVL+ M+ F + V  G + G+TGK ITDVVNIGIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LNPET LFIIASKTFTT ET+TNA+TAK+WFL + K ASAV+KHFVALSTN PKVK+FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVE GK LAKKI+ EL T  +  ITSHDSSTNGLI+FIK  +
Sbjct:   23 LNMRQMFEADKGRFSKFSKTL-VTDHGDILLDYSKNLINEDVMKLLIELAHSRGVESARQKMFSAEKINFTENRAVLHIALRNRSNTPTLLEGKDVMPEVNAVLEKMKAFCQKVRSGDWKGYTGKAITDVVNIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLAELNPETSLFIIASKTFTTQETITNAETAKEWFLNSAKDASAVAKHFVALSTNAPKVKDFGIDTANMFEFWDWVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELET--DAAITSHDSSTNGLIEFIKKHR 552          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 362/534 (67.79%), Postives = 431/534 (80.71%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKV-KEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +NM   F+++  RFS+FS+TL   +HG +L D+SKNLI+ D+ + LI+LA    VE+ R KMFS EKINFTENR+VLHIALRNRSN    ++  DVMP VNAVL+ M+ F + V  G + G+TGK ITDVVNIGIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LNPET LFIIASKTFTT ET+TNA+TAK+WFL + K  S   K++   ++NI    K+FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVE GK LAKKI+ EL T  +  ITSHDSSTNGLI+FIK  +
Sbjct:   23 LNMRQMFEADKGRFSKFSKTL-VTDHGDILLDYSKNLINEDVMKLLIELAHSRGVESARQKMFSAEKINFTENRAVLHIALRNRSNTPTLLEGKDVMPEVNAVLEKMKAFCQKVRSGDWKGYTGKAITDVVNIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLAELNPETSLFIIASKTFTTQETITNAETAKEWFLNSAKDVSL--KNYYEKTSNIQTCFKDFGIDTANMFEFWDWVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELET--DAAITSHDSSTNGLIEFIKKHR 551          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 362/541 (66.91%), Postives = 431/541 (79.67%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAV--------SKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +NM   F+++  RFS+FS+TL   +HG +L D+SKNLI+ D+ + LI+LA    VE+ R KMFS EKINFTENR+VLHIALRNRSN    ++  DVMP VNAVL+ M+ F + V  G + G+TGK ITDVVNIGIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LNPET LFIIASKTFTT ET+TNA+TAK+WFL + K  + +         +H  +     PKVK+FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVE GK LAKKI+ EL T  +  ITSHDSSTNGLI+FIK  +
Sbjct:   25 LNMRQMFEADKGRFSKFSKTL-VTDHGDILLDYSKNLINEDVMKLLIELAHSRGVESARQKMFSAEKINFTENRAVLHIALRNRSNTPTLLEGKDVMPEVNAVLEKMKAFCQKVRSGDWKGYTGKAITDVVNIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLAELNPETSLFIIASKTFTTQETITNAETAKEWFLNSAKDVTILYNLHAYVKCQHIFSPLFLQPKVKDFGIDTANMFEFWDWVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELET--DAAITSHDSSTNGLIEFIKKHR 562          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 361/533 (67.73%), Postives = 426/533 (79.92%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +NM   F+++  RFS+FS+TL   +HG +L D+SKNLI+ D+ + LI+LA    VE+ R KMFS EKINFTENR+VLHIALRNRSN    ++  DVMP VNAVL+ M+ F + V  G + G+TGK ITDVVNIGIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LNPET LFIIASKTFTT ET+TNA+TAK+WFL + K                PKVK+FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVE GK LAKKI+ EL T  +  ITSHDSSTNGLI+FIK  +
Sbjct:   23 LNMRQMFEADKGRFSKFSKTL-VTDHGDILLDYSKNLINEDVMKLLIELAHSRGVESARQKMFSAEKINFTENRAVLHIALRNRSNTPTLLEGKDVMPEVNAVLEKMKAFCQKVRSGDWKGYTGKAITDVVNIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLAELNPETSLFIIASKTFTTQETITNAETAKEWFLNSAKD---------------PKVKDFGIDTANMFEFWDWVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELET--DAAITSHDSSTNGLIEFIKKHR 537          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 362/541 (66.91%), Postives = 431/541 (79.67%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAV--------SKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +NM   F+++  RFS+FS+TL   +HG +L D+SKNLI+ D+ + LI+LA    VE+ R KMFS EKINFTENR+VLHIALRNRSN    ++  DVMP VNAVL+ M+ F + V  G + G+TGK ITDVVNIGIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LNPET LFIIASKTFTT ET+TNA+TAK+WFL + K  + +         +H  +     PKVK+FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVE GK LAKKI+ EL T  +  ITSHDSSTNGLI+FIK  +
Sbjct:   25 LNMRQMFEADKGRFSKFSKTL-VTDHGDILLDYSKNLINEDVMKLLIELAHSRGVESARQKMFSAEKINFTENRAVLHIALRNRSNTPTLLEGKDVMPEVNAVLEKMKAFCQKVRSGDWKGYTGKAITDVVNIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLAELNPETSLFIIASKTFTTQETITNAETAKEWFLNSAKDVTILYNLHAYVKCQHIFSPLFLQPKVKDFGIDTANMFEFWDWVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELET--DAAITSHDSSTNGLIEFIKKHR 562          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 362/534 (67.79%), Postives = 432/534 (80.90%), Query Frame = 2
Query:  110 HINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            ++ +   F+++  RF+ FS  L+   HG +L D+SKNL++ ++ + L++LAK   VE  R+ MFSG KIN+TENR+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITD++NIGIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA L+PET LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G D+FE+LLSG H MD HF +TPLE+N PV++A+LGI YI+CY  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG +W+INS+DQWGVE GK LAKKI+ EL  SS   +TSHDSSTNGLI FIK Q+
Sbjct:   23 NLKLRELFEADPERFNNFSLNLN-TNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAARDNMFSGSKINYTENRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSS--AVTSHDSSTNGLISFIKQQR 553          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 256.914 bits (655), Expect = 4.892e-82
Identity = 124/172 (72.09%), Postives = 141/172 (81.98%), Query Frame = 2
Query: 1196 GTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            GTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG +W+INS+DQWGVE GK LAKKI+ EL  SS   +TSHDSSTNGLI FIK Q+
Sbjct:   17 GTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSA--VTSHDSSTNGLISFIKQQR 186          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 91.2781 bits (225), Expect = 3.427e-21
Identity = 43/65 (66.15%), Postives = 52/65 (80.00%), Query Frame = 2
Query: 1238 GTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELL 1432
            GT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DLE L
Sbjct:   87 GTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKL 151          

HSP 2 Score: 54.6842 bits (130), Expect = 2.291e-8
Identity = 26/62 (41.94%), Postives = 42/62 (67.74%), Query Frame = 2
Query:  131 FDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKI 316
            F+++  RF+ FS  L+   HG +L D+SKNL++ ++ + L++LAK   VE  R+ MFSG K+
Sbjct:   30 FEADPERFNNFSLNLN-TNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAARDNMFSGTKM 90          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 85.5001 bits (210), Expect = 2.490e-19
Identity = 40/79 (50.63%), Postives = 58/79 (73.42%), Query Frame = 2
Query:  131 FDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRS 367
            F+++  RF+ FS  L+   HG +L D+SKNL++ ++ + L++LAK   VE  R+ MFSG KIN+TENR+VLH+ALRNR 
Sbjct:   30 FEADPERFNNFSLNLN-TNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAARDNMFSGSKINYTENRAVLHVALRNRP 107          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 55.0694 bits (131), Expect = 3.329e-9
Identity = 23/35 (65.71%), Postives = 30/35 (85.71%), Query Frame = 2
Query:  917 DNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGI 1021
            D+FE+LLSG H MD HF +TPLE+N PV++A+LGI
Sbjct:    2 DHFEQLLSGAHWMDQHFLKTPLEKNAPVLLALLGI 36          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|P06744|G6PI_HUMAN (Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 366/533 (68.67%), Postives = 435/533 (81.61%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +N+   FD+N +RF+ FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITDV+NIGIGGSDLGP+MVTEALKP+++   RV +VSNIDGTH+A+TLA+LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  S+   +TSHD+STNGLI FIK Q+
Sbjct:   24 LNLRRLFDANKDRFNHFSLTLN-TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQ--VTSHDASTNGLINFIKQQR 553          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|Q4R591|G6PI_MACFA (Glucose-6-phosphate isomerase OS=Macaca fascicularis OX=9541 GN=GPI PE=2 SV=3)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 363/533 (68.11%), Postives = 435/533 (81.61%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +N+   FD++ +RF+ FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITDV+NIGIGGSDLGP+MVTEALKP++++  RV +VSNIDGTH+A+TL +LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  ++ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  S+   +TSHD+STNGLI FIK Q+
Sbjct:   24 LNLRRLFDADKDRFNHFSLTLN-TNHGHILLDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSEGPRVWYVSNIDGTHIAKTLTQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTDEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQ--VTSHDASTNGLINFIKQQR 553          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|Q5R4E3|G6PI_PONAB (Glucose-6-phosphate isomerase OS=Pongo abelii OX=9601 GN=GPI PE=2 SV=3)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 362/533 (67.92%), Postives = 434/533 (81.43%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +N+   FD+N +RF+ FS TL+   HG +L D+SKNL++ D+ R L+ LAK   VE  R +MF+GEKIN+TE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITD++NIGIGGSDLGP+MVTEALKP+++   RV +VSNIDGTH+A+TLA+LNPE+ + IIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH++LL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  S+   +TSHD+STNGLI FIK Q+
Sbjct:   24 LNLRRLFDANKDRFNHFSLTLN-TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDIINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSVSIIASKTFTTQETITNAETAKEWFLQTAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKVLLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQ--VTSHDASTNGLINFIKQQR 553          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|Q3ZBD7|G6PI_BOVIN (Glucose-6-phosphate isomerase OS=Bos taurus OX=9913 GN=GPI PE=2 SV=4)

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 365/542 (67.34%), Postives = 438/542 (80.81%), Query Frame = 2
Query:   95 TLKEKH---INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            T  E+H   +N+   F+ + +RF+ FS  L+   HG +L D+SKNL++  + + L+ +AK   VE  R +MF+GEKINFTE+R+VLH+ALRNRSN  I VD  DVMP VN VL+ M+ F + V  G + G++GK ITDV+NIGIGGSDLGP+MVTEALKP++++  RV FVSNIDGTH+A+TLA LNPE+ LFIIASKTFTT ET+TNA+TAK+WFL + K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV Y TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP Q+ +PI NGLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  D E L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG IW+INS+DQWGVE GK LAKKI+ EL  SS   +TSHDSSTNGLI FIK ++
Sbjct:   15 TWYEQHGSDLNLRRLFEGDRDRFNRFSLNLN-TNHGHILVDYSKNLVTETVMQMLVDVAKSRGVEAARERMFTGEKINFTEDRAVLHVALRNRSNAPILVDGKDVMPEVNRVLEKMKSFCQRVRSGEWKGYSGKAITDVINIGIGGSDLGPLMVTEALKPYSSEGPRVWFVSNIDGTHIAKTLATLNPESSLFIIASKTFTTQETITNAETAKEWFLLSAKDPSAVAKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVNYQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQSQHPIRNGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGRSPEDFEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSSP--VTSHDSSTNGLINFIKQER 553          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|P06745|G6PI_MOUSE (Glucose-6-phosphate isomerase OS=Mus musculus OX=10090 GN=Gpi PE=1 SV=4)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 362/534 (67.79%), Postives = 432/534 (80.90%), Query Frame = 2
Query:  110 HINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            ++ +   F+++  RF+ FS  L+   HG +L D+SKNL++ ++ + L++LAK   VE  R+ MFSG KIN+TENR+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G+TGK ITD++NIGIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA L+PET LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN  KVKEFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G D+FE+LLSG H MD HF +TPLE+N PV++A+LGI YI+CY  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG +W+INS+DQWGVE GK LAKKI+ EL  SS   +TSHDSSTNGLI FIK Q+
Sbjct:   23 NLKLRELFEADPERFNNFSLNLN-TNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAARDNMFSGSKINYTENRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSS--AVTSHDSSTNGLISFIKQQR 553          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A4E0RGH6 (Glucose-6-phosphate isomerase OS=Fasciola hepatica OX=6192 GN=D915_003292 PE=3 SV=1)

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 386/551 (70.05%), Postives = 451/551 (81.85%), Query Frame = 2
Query:   65 FIEMASLQKF--TLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
              EM++L++F  + K+    M   F SN NRF+EFS  L   +HG +L DFSKNLI TD F  LI+LA+DS+VE  R+ MFSGEKINFTENR+VLH+ALRNRSN  I VD  DVMP VNAVL+HM+EF +SV  G + G+TGK ITDV+NIGIGGSDLGPVM TE L+P+A K+I+VHFVSNIDGTH++ETL KLNPET LFI+ASKTFTTIETMTN+++AK WFL++ K  S V+KHFVALSTN P+V++FGI E+NMFEFWDWVGGRYS+WSAIGLSIALYIGMDNF  LL G HAMD HF E PL +NIPVI+A+LG++YI+ Y AET AILPYDQYM RF AYFQQGDMESNGKF+    + V Y TGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIP  THNPI NG+HHEILLSNFLAQTEALM GK  E+V  EL + G++G  LE LS HKSF GNRPTNS VFT+++P+MLG L+AMYEHKIFVQG IW+INSYDQWGVE GKVLAKKIQ EL+T     +T+HDSSTNGLI F+K  +
Sbjct:   25 LCEMSALKEFLSSFKKVPCTMKEMFQSNPNRFNEFSHVLKL-QHGSILLDFSKNLIDTDTFARLIKLARDSNVERMRDAMFSGEKINFTENRAVLHVALRNRSNTPILVDGKDVMPGVNAVLRHMKEFCDSVRSGEWKGYTGKAITDVINIGIGGSDLGPVMATECLRPYA-KHIKVHFVSNIDGTHISETLKKLNPETALFIVASKTFTTIETMTNSESAKAWFLEHAKDPSHVAKHFVALSTNAPEVRKFGIAEENMFEFWDWVGGRYSMWSAIGLSIALYIGMDNFISLLEGAHAMDKHFLEAPLHKNIPVILAVLGVLYINVYGAETQAILPYDQYMLRFPAYFQQGDMESNGKFVTRQMQEVTYATGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPVHTHNPIQNGIHHEILLSNFLAQTEALMTGKTREEVHAELFSAGVTGEKLEALSLHKSFKGNRPTNSIVFTQLSPYMLGALVAMYEHKIFVQGVIWDINSYDQWGVELGKVLAKKIQPELKTPGP--VTTHDSSTNGLINFLKESR 571          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A2H1CIV9 (Glucose-6-phosphate isomerase OS=Fasciola hepatica OX=6192 GN=D915_05229 PE=3 SV=1)

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 385/548 (70.26%), Postives = 450/548 (82.12%), Query Frame = 2
Query:   74 MASLQKF--TLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            M++L++F  + K+    M   F SN NRF+EFS  L   +HG +L DFSKNLI TD F  LI+LA+DS+VE  R+ MFSGEKINFTENR+VLH+ALRNRSN  I VD  DVMP VNAVL+HM+EF +SV  G + G+TGK ITDV+NIGIGGSDLGPVM TE L+P+A K+I+VHFVSNIDGTH++ETL KLNPET LFI+ASKTFTTIETMTN+++AK WFL++ K  S V+KHFVALSTN P+V++FGI E+NMFEFWDWVGGRYS+WSAIGLSIALYIGMDNF  LL G HAMD HF E PL +NIPVI+A+LG++YI+ Y AET AILPYDQYM RF AYFQQGDMESNGKF+    + V Y TGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIP  THNPI NG+HHEILLSNFLAQTEALM GK  E+V  EL + G++G  LE LS HKSF GNRPTNS VFT+++P+MLG L+AMYEHKIFVQG IW+INSYDQWGVE GKVLAKKIQ EL+T     +T+HDSSTNGLI F+K  +
Sbjct:    1 MSALKEFLSSFKKVPCTMKEMFQSNPNRFNEFSHVLKL-QHGSILLDFSKNLIDTDTFARLIKLARDSNVERMRDAMFSGEKINFTENRAVLHVALRNRSNTPILVDGKDVMPGVNAVLRHMKEFCDSVRSGEWKGYTGKAITDVINIGIGGSDLGPVMATECLRPYA-KHIKVHFVSNIDGTHISETLKKLNPETALFIVASKTFTTIETMTNSESAKAWFLEHAKDPSHVAKHFVALSTNAPEVRKFGIAEENMFEFWDWVGGRYSMWSAIGLSIALYIGMDNFISLLEGAHAMDKHFLEAPLHKNIPVILAVLGVLYINVYGAETQAILPYDQYMLRFPAYFQQGDMESNGKFVTRQMQEVTYATGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPVHTHNPIQNGIHHEILLSNFLAQTEALMTGKTREEVHAELFSAGVTGEKLEALSLHKSFKGNRPTNSIVFTQLSPYMLGALVAMYEHKIFVQGVIWDINSYDQWGVELGKVLAKKIQPELKTPGP--VTTHDSSTNGLINFLKESR 544          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A1S8WXB4 (Glucose-6-phosphate isomerase OS=Opisthorchis viverrini OX=6198 GN=X801_05037 PE=3 SV=1)

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 390/547 (71.30%), Postives = 442/547 (80.80%), Query Frame = 2
Query:   74 MASLQKF--TLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQ 1708
            MA+L+ F    K+  + M   F+ N  RF+E S+ L+   HG +L D+SKNLI TD F  LIQLAKDS VE  R+ MF+GEKINFTENR+VLHIALRNRSN  I VD  DVMP VNAVL HM++F   V  G + G+TGK ITD+VNIGIGGSDLGPVM TE LKP+AN ++RVHFVSNIDGTHMAETL KLNPET LFIIASKTFTTIETMTN+ +AKQWFLK+ K    V+KHFVALSTN  +VK+FGI E+NMFEFWDWVGGRYSLWSAIGLSIALY+GMDNF +LL G HAMD HFKE PL +N+PVI+A+LG++YI+ Y AETHAILPYDQYM RFAAYFQQGDMESNGKF+    K V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADFLIP  T NPI  GLHHEIL+SNFLAQTEALM GK  ++V  EL   G++G  LE LS HKSF GNRPTNS VF+++ P+MLG LIAMYEHKIFVQG IW+INSYDQWGVE GKVLAKKIQ EL+T     IT+HDSSTNGLI FIK +
Sbjct:    1 MAALRDFLANFKKVPLTMKEMFEKNPKRFTELSQVLNLA-HGNILLDYSKNLIDTDTFNKLIQLAKDSHVEKLRDAMFAGEKINFTENRAVLHIALRNRSNVPILVDGKDVMPGVNAVLNHMKDFCGRVISGSWKGYTGKAITDIVNIGIGGSDLGPVMATECLKPYAN-HLRVHFVSNIDGTHMAETLKKLNPETTLFIIASKTFTTIETMTNSHSAKQWFLKHAKEEVHVAKHFVALSTNSDEVKKFGIAEENMFEFWDWVGGRYSLWSAIGLSIALYVGMDNFIQLLEGAHAMDKHFKEAPLHKNLPVILAVLGVLYINVYGAETHAILPYDQYMSRFAAYFQQGDMESNGKFVTRASKEVDYATGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFLIPVHTQNPIQGGLHHEILISNFLAQTEALMTGKSRDEVHTELFNSGVTGEKLEALSLHKSFKGNRPTNSIVFSRLTPYMLGCLIAMYEHKIFVQGVIWDINSYDQWGVELGKVLAKKIQPELKTPDP--ITTHDSSTNGLINFIKEE 543          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A4S2LZB6 (Glucose-6-phosphate isomerase OS=Opisthorchis felineus OX=147828 GN=CRM22_003821 PE=3 SV=1)

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 389/547 (71.12%), Postives = 443/547 (80.99%), Query Frame = 2
Query:   74 MASLQKF--TLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQ 1708
            MA+L++F  + K+  + M   F+ N  RF+E S+ L+   HG +L D+SKNLI TD F  LI+LAKDS VE  R+ MF+GEKINFTENR+VLHIALRNRSN  I VD  DVMP VNAVL HM++F   V  G + G+T K ITD+VNIGIGGSDLGPVM TE LKP+AN ++RVHFVSNIDGTHMAETL KLNPET LFIIASKTFTTIETMTN+ +AKQWFL++ K    V+KHFVALSTN  +VK+FGI E+NMFEFWDWVGGRYSLWSAIGLSIALYIGMDNF +LL G HAMD HFKE PL +N+PVI+A+LG++YI+ Y AETHAILPYDQYM RFAAYFQQGDMESNGKF+    K V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADFLIP  T NPI  GLHHEIL+SNFLAQTEALM GK  ++V  EL   G++G  LE LS HKSF GNRPTNS VF+++ P+MLG LIAMYEHKIFVQG IW INSYDQWGVE GKVLAKKIQ EL+TS    IT+HDSSTNGLI FIK +
Sbjct:    1 MAALEEFLASFKKVPLTMKEMFEKNPKRFTELSQVLNLA-HGNILLDYSKNLIDTDTFNKLIKLAKDSHVEKLRDAMFAGEKINFTENRAVLHIALRNRSNVPILVDGKDVMPGVNAVLNHMKDFCGRVISGAWKGYTDKPITDIVNIGIGGSDLGPVMATECLKPYAN-HLRVHFVSNIDGTHMAETLKKLNPETTLFIIASKTFTTIETMTNSHSAKQWFLEHAKEEVHVAKHFVALSTNSTEVKKFGIAEENMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFIQLLEGAHAMDKHFKEAPLHKNLPVILAVLGVLYINVYGAETHAILPYDQYMSRFAAYFQQGDMESNGKFVTRASKEVDYATGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFLIPVHTQNPIQGGLHHEILMSNFLAQTEALMMGKSRDEVHTELFNSGITGEKLEALSLHKSFKGNRPTNSIVFSRLTPYMLGCLIAMYEHKIFVQGVIWNINSYDQWGVELGKVLAKKIQPELKTSGP--ITTHDSSTNGLINFIKEE 543          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A3R7FZV5 (Glucose-6-phosphate isomerase OS=Clonorchis sinensis OX=79923 GN=Gpi PE=3 SV=1)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 388/547 (70.93%), Postives = 442/547 (80.80%), Query Frame = 2
Query:   74 MASLQKF--TLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQ 1708
            MA+L++F    K+  + M   F+ N  RF+E S+ L+   HG +L D+SKNLI TD F  LIQLAKDS VE  R+ MF+GEKINFTENR+VLHIALRNRSN  I VD  DVMP VNAVL HM++F   V  G + G+T K ITDVVNIGIGGSDLGPVM TE LKP+AN ++RVHFVSNIDGTHMAETL KLNPET LFIIASKTFTTIETMTN+ +AKQWFL++ K    V+KHFVALSTN  +VK+FGI E+NMFEFWDWVGGRYSLWSAIGLSIALY+GMDNF +LL G HAMD HFKE PL +N+PVI+A+LG++YI+ Y AETHAILPYDQYM RFAAYFQQGDMESNGKF+    K V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADFLIP  T NPI  GLHHEIL+SNFLAQTEALM GK  ++V  EL   G++G  LE LS HKSF GNRPTNS VF+++ P+MLG LIAMYEHKIFVQG IW+INSYDQWGVE GKVLAKKIQ EL+T     +T+HDSSTNGLI FIK +
Sbjct:    1 MAALKEFLANFKKVPLTMKEMFEKNPKRFTELSQVLNLA-HGNILLDYSKNLIDTDTFNKLIQLAKDSHVEKLRDAMFAGEKINFTENRAVLHIALRNRSNVPILVDGKDVMPGVNAVLNHMKDFCGRVITGAWKGYTNKAITDVVNIGIGGSDLGPVMATECLKPYAN-HLRVHFVSNIDGTHMAETLKKLNPETTLFIIASKTFTTIETMTNSHSAKQWFLEHAKEEVHVAKHFVALSTNSDEVKKFGIAEENMFEFWDWVGGRYSLWSAIGLSIALYVGMDNFIQLLEGAHAMDKHFKEAPLHKNLPVILAVLGVLYINVYGAETHAILPYDQYMSRFAAYFQQGDMESNGKFVTRASKEVDYATGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFLIPVHTQNPIQGGLHHEILMSNFLAQTEALMMGKSPDEVHTELFNSGITGEKLEALSLHKSFKGNRPTNSIVFSRLTPYMLGCLIAMYEHKIFVQGVIWDINSYDQWGVELGKVLAKKIQPELKTPGP--VTTHDSSTNGLINFIKEE 543          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpia (glucose-6-phosphate isomerase-like [Source:NCBI gene;Acc:103031298])

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 365/533 (68.48%), Postives = 430/533 (80.68%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +NM   FD + +RFS+FS TL+  + G LL D+SKNLI+ D+ + L  +AK   VE  R++MF GEKINFTE R+VLHIALRNRSN  I VD  DVMP VN VLK M++F   V  G + G  GK ITDVVNIGIGGSDLGP+MVTEALKP++     V FVSNIDGTHMA+TLA+LN ET LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN PKV EFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LL+G H MDNHF   PLEQN PV++A+LGI Y++ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIP+QT +PI + LHH+IL++NFLAQTEALM+GK +++ R+ELEA G SG  LE L  HK F GN+P+NS +F K++PFMLG L+AMYEHKIFVQG +W INSYDQWGVE GK LAKKI+ EL+  S   + SHDSSTNGLI F K  +
Sbjct:   23 LNMRQMFDGDKDRFSKFSLTLN-TDDGDLLLDYSKNLINEDVMKMLFAMAKSIGVEEARSQMFGGEKINFTEGRAVLHIALRNRSNTPIMVDGKDVMPEVNRVLKKMKDFCHRVRSGEWKGFNGKTITDVVNIGIGGSDLGPLMVTEALKPYSKGGPNVWFVSNIDGTHMAKTLAQLNAETTLFIIASKTFTTQETITNAETAKEWFLQTAKDPSAVAKHFVALSTNAPKVSEFGIDTENMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLAGAHWMDNHFCSAPLEQNAPVLLALLGIWYVNFFQAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKNGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQTQHPIRDNLHHKILMANFLAQTEALMKGKTSDEARKELEAAGKSGEALEKLLPHKVFEGNKPSNSIIFKKLSPFMLGALVAMYEHKIFVQGVMWNINSYDQWGVELGKQLAKKIEPELQDDSE--VHSHDSSTNGLISFFKKNR 552          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:103043831])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 360/552 (65.22%), Postives = 441/552 (79.89%), Query Frame = 2
Query:   47 VTYQENFIEMASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIK 1702
            +T   NF ++   Q +      ++M   F+++  RFS+FS TL   + G +L D+SKNLI+ ++ + LI+LAK   VE  R+KMFSGEKINFTE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F   V  G + G+TGK ITDVVN+GIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LN ET LFIIASKTFTT ET+TNA++AK+WFL+  K  SAV+KHFVALSTN PKVK+FGID +NMFEFWDWVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MD HF+  PL+QN PV++AMLGI YI+ ++ ETH +LPYDQYMHRFAAYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR +P+DFLIP+Q+ +PI N LHH+IL++NFLAQTEA+M+GK  E+ ++ELEA G+SG  L+ +  HK F GN+PTNS +F K+ P+ LGVLIAMYEHKIF+QG +WEINS+DQWGVE GK LAKKI+ EL+    T ++SHDSSTNGLI FIK
Sbjct:    3 LTSDPNFQKLE--QWYKANAASLSMRQMFEADQQRFSKFSVTLK-TDDGDVLLDYSKNLINDEVMKMLIELAKSRGVEAARDKMFSGEKINFTEGRAVLHVALRNRSNTPITVDGKDVMPEVNKVLDKMKGFCHKVRSGEWKGYTGKSITDVVNVGIGGSDLGPLMVTEALKPYSKDGPRVWFVSNIDGTHIAKTLAQLNAETTLFIIASKTFTTQETITNAESAKEWFLEAAKDKSAVAKHFVALSTNGPKVKDFGIDTENMFEFWDWVGGRYSLWSAIGLSIALHIGFENFEKLLAGAHWMDTHFRTAPLDQNAPVLLAMLGIWYINFFQMETHCLLPYDQYMHRFAAYFQQGDMESNGKYITNHGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRTVPSDFLIPAQSQHPIRNNLHHKILIANFLAQTEAMMKGKTTEEAKKELEAGGLSGEKLDKILPHKVFLGNKPTNSIIFKKLTPYTLGVLIAMYEHKIFIQGVMWEINSFDQWGVELGKQLAKKIEPELQ--DKTEVSSHDSSTNGLINFIK 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:103043831])

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 351/552 (63.59%), Postives = 433/552 (78.44%), Query Frame = 2
Query:   47 VTYQENFIEMASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIK 1702
            +T   NF ++   Q +      ++M   F+++  RFS+FS TL   + G +L D+SKNLI+ ++ + LI+LAK   VE  R+KMFSGEKINFTE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F   V  G + G+TGK ITDVVN+GIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+A+TLA+LN ET LFIIASKTFTT ET+TNA++AK+WFL+   +A  V   FV+     PKVK+FGID +NMFEFWDWVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MD HF+  PL+QN PV++AMLGI YI+ ++ ETH +LPYDQYMHRFAAYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR +P+DFLIP+Q+ +PI N LHH+IL++NFLAQTEA+M+GK  E+ ++ELEA G+SG  L+ +  HK F GN+PTNS +F K+ P+ LGVLIAMYEHKIF+QG +WEINS+DQWGVE GK LAKKI+ EL+    T ++SHDSSTNGLI FIK
Sbjct:    3 LTSDPNFQKLE--QWYKANAASLSMRQMFEADQQRFSKFSVTLK-TDDGDVLLDYSKNLINDEVMKMLIELAKSRGVEAARDKMFSGEKINFTEGRAVLHVALRNRSNTPITVDGKDVMPEVNKVLDKMKGFCHKVRSGEWKGYTGKSITDVVNVGIGGSDLGPLMVTEALKPYSKDGPRVWFVSNIDGTHIAKTLAQLNAETTLFIIASKTFTTQETITNAESAKEWFLE---AAKDVICFFVSALAPQPKVKDFGIDTENMFEFWDWVGGRYSLWSAIGLSIALHIGFENFEKLLAGAHWMDTHFRTAPLDQNAPVLLAMLGIWYINFFQMETHCLLPYDQYMHRFAAYFQQGDMESNGKYITNHGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRTVPSDFLIPAQSQHPIRNNLHHKILIANFLAQTEAMMKGKTTEEAKKELEAGGLSGEKLDKILPHKVFLGNKPTNSIIFKKLTPYTLGVLIAMYEHKIFIQGVMWEINSFDQWGVELGKQLAKKIEPELQ--DKTEVSSHDSSTNGLINFIK 546          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpia (glucose-6-phosphate isomerase-like [Source:NCBI gene;Acc:103031298])

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 341/492 (69.31%), Postives = 402/492 (81.71%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWG 1588
            +NM   FD + +RFS+FS TL+  + G LL D+SKNLI+ D+ + L  +AK   VE  R++MF GEKINFTE R+VLHIALRNRSN  I VD  DVMP VN VLK M++F   V  G + G  GK ITDVVNIGIGGSDLGP+MVTEALKP++     V FVSNIDGTHMA+TLA+LN ET LFIIASKTFTT ET+TNA+TAK+WFL+  K  SAV+KHFVALSTN PKV EFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G DNFE+LL+G H MDNHF   PLEQN PV++A+LGI Y++ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIP+QT +PI + LHH+IL++NFLAQTEALM+GK +++ R+ELEA G SG  LE L  HK F GN+P+NS +F K++PFMLG L+AMYEHKIFVQG +W INSYDQWG
Sbjct:   23 LNMRQMFDGDKDRFSKFSLTLN-TDDGDLLLDYSKNLINEDVMKMLFAMAKSIGVEEARSQMFGGEKINFTEGRAVLHIALRNRSNTPIMVDGKDVMPEVNRVLKKMKDFCHRVRSGEWKGFNGKTITDVVNIGIGGSDLGPLMVTEALKPYSKGGPNVWFVSNIDGTHMAKTLAQLNAETTLFIIASKTFTTQETITNAETAKEWFLQTAKDPSAVAKHFVALSTNAPKVSEFGIDTENMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLAGAHWMDNHFCSAPLEQNAPVLLALLGIWYVNFFQAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKNGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQTQHPIRDNLHHKILMANFLAQTEALMKGKTSDEARKELEAAGKSGEALEKLLPHKVFEGNKPSNSIIFKKLSPFMLGALVAMYEHKIFVQGVMWNINSYDQWG 513          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpia (glucose-6-phosphate isomerase-like [Source:NCBI gene;Acc:103031298])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 352/538 (65.43%), Postives = 420/538 (78.07%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAV---SKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEEL--LSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            +NM   FD + +RFS+FS TL+  + G LL D+SKNLI+ D+ + L  +AK   VE  R++MF GEKINFTE R+VLHIALRNRSN  I VD  DVMP VN VLK M++F   V  G + G  GK ITDVVNIGIGGSDLGP+MVTEALKP++     V FVSNIDGTHMA+TLA+LN ET LFIIASKTFTT ET+TNA+TAK+WFL+  K  S +   S +F  +    PKV EFGID +NMFEFWDWVGGRYSLWSAIGLSIAL++G + F +L  LS  H+ DNHF   PLEQN PV++A+LGI Y++ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIP+QT +PI + LHH+IL++NFLAQTEALM+GK +++ R+ELEA G SG  LE L  HK F GN+P+NS +F K++PFMLG L+AMYEHKIFVQG +W INSYDQWGVE GK LAKKI+ EL+  S   + SHDSSTNGLI F K  +
Sbjct:   23 LNMRQMFDGDKDRFSKFSLTLN-TDDGDLLLDYSKNLINEDVMKMLFAMAKSIGVEEARSQMFGGEKINFTEGRAVLHIALRNRSNTPIMVDGKDVMPEVNRVLKKMKDFCHRVRSGEWKGFNGKTITDVVNIGIGGSDLGPLMVTEALKPYSKGGPNVWFVSNIDGTHMAKTLAQLNAETTLFIIASKTFTTQETITNAETAKEWFLQTAKDVSILINKSFYFSLIYFLQPKVSEFGIDTENMFEFWDWVGGRYSLWSAIGLSIALHVG-NIFTDLFDLSPSHSQDNHFCSAPLEQNAPVLLALLGIWYVNFFQAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKNGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQTQHPIRDNLHHKILMANFLAQTEALMKGKTSDEARKELEAAGKSGEALEKLLPHKVFEGNKPSNSIIFKKLSPFMLGALVAMYEHKIFVQGVMWNINSYDQWGVELGKQLAKKIEPELQDDSE--VHSHDSSTNGLISFFKKNR 556          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Sea Lamprey
Match: gpib (glucose-6-phosphate isomerase b [Source:ZFIN;Acc:ZDB-GENE-020513-3])

HSP 1 Score: 259.225 bits (661), Expect = 4.898e-84
Identity = 126/175 (72.00%), Postives = 143/175 (81.71%), Query Frame = 2
Query:  431 MREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAM 955
            MR F E V  G + G++GK I DVVNIGIGGSDLGP+MVTEALKP++       FVSNIDGTHMA+TLA L+PET LFIIASKTFTT ET+TNA++AK+WFLK     +AV+KHFVALSTN  KVK FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG +NFE+LLSG H M
Sbjct:    1 MRGFCERVRSGQWKGYSGKPIADVVNIGIGGSDLGPLMVTEALKPYSKGGPNSWFVSNIDGTHMAKTLAVLDPETTLFIIASKTFTTQETITNAESAKEWFLKKAGDPAAVAKHFVALSTNGEKVKAFGIDTNNMFEFWDWVGGRYSLWSAIGLSIALHIGFENFEQLLSGAHWM 175          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Yeast
Match: PGI1 (Glycolytic enzyme phosphoglucose isomerase; catalyzes the interconversion of glucose-6-phosphate and fructose-6-phosphate; required for cell cycle progression and completion of the gluconeogenic events of sporulation [Source:SGD;Acc:S000000400])

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 311/544 (57.17%), Postives = 396/544 (72.79%), Query Frame = 2
Query:   77 ASLQK-FTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFL-KNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIK 1702
            + LQK +  + K +++  +F  ++ RF + ++T    +  K+LFD+SKNL++ +I   LI+LAK+++V   R+ MF GE IN TE+R+V H+ALRNR+NK +YVD V+V P V++VLKHM+EF+E V  G + G+TGKKITDVVNIGIGGSDLGPVMVTEALK +A   + VHFVSNIDGTH+AETL  ++PET LF+IASKTFTT ET+TNA TAK WFL K     S ++KHF ALSTN  +V +FGID KNMF F  WVGGRYS+WSAIGLS+ALYIG DNFE  L G  A+DNHF +TPLE NIP++  +L + Y + + A+TH + P+DQY+HRF AY QQ  MESNGK +        Y TG I++GEP TN QH+F+QL+HQGT+LIP+DF++ +Q+HNPI N LH ++L SNF AQ EALM GK  E+V+    AEG +G     L  HK F GNRPT S +  K+ P  LG LIA YEH  F +GAIW INS+DQWGVE GKVLAK I +EL  SS   I++HD+STNGLI   K
Sbjct:   19 SKLQKIYESQGKTLSVKQEFQKDAKRFEKLNKTFTNYDGSKILFDYSKNLVNDEIIAALIELAKEANVTGLRDAMFKGEHINSTEDRAVYHVALRNRANKPMYVDGVNVAPEVDSVLKHMKEFSEQVRSGEWKGYTGKKITDVVNIGIGGSDLGPVMVTEALKHYAGV-LDVHFVSNIDGTHIAETLKVVDPETTLFLIASKTFTTAETITNANTAKNWFLSKTGNDPSHIAKHFAALSTNETEVAKFGIDTKNMFGFESWVGGRYSVWSAIGLSVALYIGYDNFEAFLKGAEAVDNHFTQTPLEDNIPLLGGLLSVWYNNFFGAQTHLVAPFDQYLHRFPAYLQQLSMESNGKSVTRGNVFTDYSTGSILFGEPATNAQHSFFQLVHQGTKLIPSDFILAAQSHNPIENKLHQKMLASNFFAQAEALMVGKDEEQVK----AEGATGG----LVPHKVFSGNRPTTSILAQKITPATLGALIAYYEHVTFTEGAIWNINSFDQWGVELGKVLAKVIGKELDNSST--ISTHDASTNGLINQFK 551          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Nematostella
Match: EDO37039 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:A7SGU1])

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 362/534 (67.79%), Postives = 426/534 (79.78%), Query Frame = 2
Query:  113 INMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQN--IPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQ 1708
            ++M   F  ++NRF +FS  LD   HG+LL D+SKN+++ +  + L +LA    V++   KMFSGEKINFTE+R+VLHIALRNRSN  I VD  DVM  VNAVL  MR FTE V  G + GHTGK ITDV+NIGIGGSDLGP+MVTEAL+P+  K + VHFVSNIDGTH+A+TLA+LNPET LFIIASKTFTTIET+TNA +A++W L ++K  SAV+KHFVALSTN PKV EFGI + NMF FWDWVGGRYSLWSAIGLSIA+YIGMDNFE LLSG HAMDNHFK+ PLE N  IPVI+A+LGI Y + + A++H +  YDQYMHRFAAYFQQGDMESNGKF+   G+ V Y TGPI+WGEPGTNGQHAFYQLIHQGT++IPADFL P +THNPI+NGLHH+ILLSNFLAQ EALM+GK  E+ R EL AEG +G  L+ ++  K F GN+PTNS VF K+ PF LG+LIAMYEHKIF QG IW INS+DQWGVE GK LAK IQ EL  +S   +TSHDSSTNGLI FIK +
Sbjct:   24 LHMRKLFQEDANRFEKFSTFLD-TSHGRLLVDYSKNIVTEETMKLLFRLANARGVKSMCQKMFSGEKINFTEDRAVLHIALRNRSNTPILVDGKDVMGDVNAVLTQMRSFTEDVRTGTWKGHTGKAITDVINIGIGGSDLGPLMVTEALQPYGKKGLNVHFVSNIDGTHLAKTLAELNPETSLFIIASKTFTTIETITNATSARKWLLDHLKDKSAVAKHFVALSTNEPKVTEFGISKDNMFAFWDWVGGRYSLWSAIGLSIAIYIGMDNFEALLSGAHAMDNHFKDAPLENNLMIPVILALLGIWYNNFFGAQSHGMFAYDQYMHRFAAYFQQGDMESNGKFMTRFGEEVDYSTGPIVWGEPGTNGQHAFYQLIHQGTKMIPADFLAPIETHNPISNGLHHQILLSNFLAQPEALMKGKTLEEARTELAAEGKTGEKLDKIAPQKVFKGNKPTNSIVFKKLTPFTLGLLIAMYEHKIFTQGVIWGINSFDQWGVELGKQLAKVIQPEL--ASPGRVTSHDSSTNGLINFIKGE 554          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Nematostella
Match: EDO27774 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:A7T8B5])

HSP 1 Score: 310.071 bits (793), Expect = 3.300e-101
Identity = 154/307 (50.16%), Postives = 215/307 (70.03%), Query Frame = 2
Query:  107 KHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMY 1027
            K +++   F +N NR  EFS  LD       + DFSKN I+ +    L++LA + D+ +  +K FSG+ IN TENR+VLH ALRN S+K I VD  +++P +   L+ ++ F+E V  G + G+TGK ITD+VNIGIGGSDLGP MV  AL+ + N ++  HFVSNIDG H++E L  L+PET LF++ SKTFTT ET++NA T K+WFLK+  +   ++KHFVA+STN+    +FGID KN+F  W+WVGGR+SLWSA+GLSI+L +G  NF+++L G   MD HFKE   ++NIPV++A++ I Y
Sbjct:   25 KEVHLKELFQNNPNRQEEFSIELD-----DFIIDFSKNRITKETLNLLVKLANEVDLHDAIHKYFSGDVINTTENRAVLHTALRNFSDKEIIVDNNNIVPEIKNTLQKIQNFSEKVIVGNWKGYTGKPITDIVNIGIGGSDLGPDMVVSALQYYKN-HLNTHFVSNIDGDHVSEVLKNLHPETTLFVVVSKTFTTQETLSNATTIKEWFLKSA-TQKDIAKHFVAVSTNLSAATKFGIDTKNIFPMWNWVGGRFSLWSAVGLSISLSVGFANFKQILLGASXMDTHFKEATFDKNIPVVLALISIWY 324          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Nematostella
Match: EDO27552 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:A7T8Y2])

HSP 1 Score: 253.447 bits (646), Expect = 5.045e-80
Identity = 133/269 (49.44%), Postives = 181/269 (67.29%), Query Frame = 2
Query:  107 KHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIG 913
            K+I+M   F  +S R  +F       E    + D+SKN I+ +    LI LA + +++      FSGE IN TENR+VLH ALR   N  +YV+  +++P +  V K +  FT  +  G+  G+T K  TDVVNIGIGGSDLGP M+ E L+ + N ++ +HFVSN+DG H+ E L K+NPET LF+I SKTFTT ET++NAQT ++WFLK+  +   V+KHFVA+STN+  V EFGI E+N+F  WDWVGGR+SLWSA+GLSI+L +G
Sbjct:   14 KNISMKEMFFQDSERVEKFHI-----EWEDFVIDYSKNKITEETKGLLIDLANEINLKEAIEDYFSGEIINKTENRAVLHTALRADVNDEVYVEGKNIIPEIFEVKKKIDFFTNDIVSGIRKGYTNKPFTDVVNIGIGGSDLGPAMIVEGLEYYKN-HLNLHFVSNVDGDHVNEILKKINPETTLFVIVSKTFTTQETLSNAQTIREWFLKSA-NIDDVAKHFVAVSTNVKNVTEFGIAEENIFPMWDWVGGRFSLWSAVGLSISLSVG 275          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpia (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101173933])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 360/537 (67.04%), Postives = 428/537 (79.70%), Query Frame = 2
Query:   92 FTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIK 1702
            F      +NM   FD +  RFS+FS      + G LL DFSKNL++ D+   L+ LAK   VE  R+KMFSGEKINFTE R+VLH+ALRNRSN  I VD  DVMP VN VL  M+ F + V  G + G +GK ITDVVNIGIGGSDLGP+MVTEALKP++ +   V FVSNIDGTH+A+TLA+LNPET LFIIASKTFTT ET+TNA++A+ WFL+     SAV+KHFVALSTN  KVK+FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MDNHF   PL+QN+PV++A+LG+ YI+ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I+  G RV Y TGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIP+Q+ +PI N LHH+IL++NFLAQTEALM+GK A++ R ELEA G+ G  LE L  HK F GN+P+NS VF K+ PFMLG L+AMYEHKIFVQG IW INSYDQWGVE GK LAK+I+ EL+ ++   +TSHDSSTNGLI F+K
Sbjct:   16 FRANSGSLNMREMFDKDKQRFSKFS-VTLDTDDGDLLLDFSKNLVNQDVMAMLLALAKSRGVEEARDKMFSGEKINFTEGRAVLHVALRNRSNTPILVDGKDVMPDVNQVLGKMKVFCQKVRSGEWKGFSGKSITDVVNIGIGGSDLGPLMVTEALKPYSAEGPNVWFVSNIDGTHLAKTLARLNPETTLFIIASKTFTTQETITNAESARDWFLQTAGDKSAVAKHFVALSTNSVKVKDFGIDTANMFEFWDWVGGRYSLWSAIGLSIALHIGFNNFEQLLAGAHWMDNHFCNAPLDQNVPVLLALLGVWYINFFQAETHAMLPYDQYMHRFAAYFQQGDMESNGKYISKDGSRVKYQTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQSQHPIRNNLHHKILMANFLAQTEALMKGKTADEARRELEAAGLKGEALEKLLPHKVFQGNKPSNSIVFKKLTPFMLGALVAMYEHKIFVQGVIWNINSYDQWGVELGKQLAKQIEPELQDAAE--VTSHDSSTNGLINFLK 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101165966])

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 348/537 (64.80%), Postives = 429/537 (79.89%), Query Frame = 2
Query:   92 FTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIK 1702
            FT    ++N+ + F+++  RF +FS TL+  E G +L D+SKNLI+ ++ + L  L K   +E  R KMF+G+KINFTE R+VLH+ALRNRSN  I V+  DVMP VN VL+ M+ F   V  G + G TGK ITDVVN+GIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+ +TLA+LN ET LFIIASKTFTT ET+TNA++AK WFL++ K  +AV+KHFVALSTN PKVK+FGID +NMFEFWDWVGGR+SLWSAIG+SIAL++G DNFE+LLSG H MD HF+  PLE+N PV++A+LGI YI+ + AETHA+LPYDQYMHRF AYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR++P+DFLIP+Q+ +PI + LHH+IL +NFLAQTEALM+GK  E+ R+ELEA G+SG  LE +  HK F GNRPTNS +F K+ P+ LG LIAMYEHKIFVQG +WEINS+DQWGVE GK LAK I+ EL  ++   + SHD+STNGLI F+K
Sbjct:   16 FTAHALNLNVRHLFEADKERFRKFSLTLN-TEDGDILLDYSKNLITDEVMKMLTDLGKSRGIEAAREKMFTGDKINFTEGRAVLHVALRNRSNTPILVEGKDVMPEVNKVLEKMKSFCHRVRSGEWKGFTGKAITDVVNVGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHITKTLAQLNAETTLFIIASKTFTTQETITNAESAKAWFLEHAKDKAAVAKHFVALSTNGPKVKDFGIDTENMFEFWDWVGGRFSLWSAIGMSIALHVGFDNFEKLLSGAHWMDKHFRTAPLEKNAPVLLALLGIWYINFFHAETHAVLPYDQYMHRFTAYFQQGDMESNGKYITNHGARVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPSDFLIPAQSQHPIRDNLHHKILSANFLAQTEALMKGKTTEEARKELEASGLSGEALEKILPHKVFQGNRPTNSIIFKKLTPYTLGALIAMYEHKIFVQGVMWEINSFDQWGVELGKQLAKNIEPELNNTAE--VHSHDASTNGLINFLK 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101165966])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 336/538 (62.45%), Postives = 418/538 (77.70%), Query Frame = 2
Query:   92 FTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTN-IPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIK 1702
            FT    ++N+ + F+++  RF +FS TL+  E G +L D+SKNLI+ ++ + L  L K   +E  R KMF+G+KINFTE R+VLH+ALRNRSN  I V+  DVMP VN VL+ M+ F   V  G + G TGK ITDVVN+GIGGSDLGP+MVTEALKP++    RV FVSNIDGTH+ +TLA+LN ET LFIIASKTFTT ET+TNA++AK WFL++ K  +AV+KHFVALSTN +  V  F I  + +     WVGGR+SLWSAIG+SIAL++G DNFE+LLSG H MD HF+  PLE+N PV++A+LGI YI+ + AETHA+LPYDQYMHRF AYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR++P+DFLIP+Q+ +PI + LHH+IL +NFLAQTEALM+GK  E+ R+ELEA G+SG  LE +  HK F GNRPTNS +F K+ P+ LG LIAMYEHKIFVQG +WEINS+DQWGVE GK LAK I+ EL  ++   + SHD+STNGLI F+K
Sbjct:   16 FTAHALNLNVRHLFEADKERFRKFSLTLN-TEDGDILLDYSKNLITDEVMKMLTDLGKSRGIEAAREKMFTGDKINFTEGRAVLHVALRNRSNTPILVEGKDVMPEVNKVLEKMKSFCHRVRSGEWKGFTGKAITDVVNVGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHITKTLAQLNAETTLFIIASKTFTTQETITNAESAKAWFLEHAKDKAAVAKHFVALSTNGVSYVHFFLIIRRKLHL---WVGGRFSLWSAIGMSIALHVGFDNFEKLLSGAHWMDKHFRTAPLEKNAPVLLALLGIWYINFFHAETHAVLPYDQYMHRFTAYFQQGDMESNGKYITNHGARVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPSDFLIPAQSQHPIRDNLHHKILSANFLAQTEALMKGKTTEEARKELEASGLSGEALEKILPHKVFQGNRPTNSIIFKKLTPYTLGALIAMYEHKIFVQGVMWEINSFDQWGVELGKQLAKNIEPELNNTAE--VHSHDASTNGLINFLK 547          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpia (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101173933])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 268/387 (69.25%), Postives = 323/387 (83.46%), Query Frame = 2
Query:  542 MVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIK 1702
            MVTEALKP++ +   V FVSNIDGTH+A+TLA+LNPET LFIIASKTFTT ET+TNA++A+ WFL+   +A  VS+  +    N+ KVK+FGID  NMFEFWDWVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MDNHF   PL+QN+PV++A+LG+ YI+ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I+  G RV Y TGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIP+Q+ +PI N LHH+IL++NFLAQTEALM+GK A++ R ELEA G+ G  LE L  HK F GN+P+NS VF K+ PFMLG L+AMYEHKIFVQG IW INSYDQWGVE GK LAK+I+ EL+ ++   +TSHDSSTNGLI F+K
Sbjct:    1 MVTEALKPYSAEGPNVWFVSNIDGTHLAKTLARLNPETTLFIIASKTFTTQETITNAESARDWFLQ---TAGDVSRPQIRTLVNV-KVKDFGIDTANMFEFWDWVGGRYSLWSAIGLSIALHIGFNNFEQLLAGAHWMDNHFCNAPLDQNVPVLLALLGVWYINFFQAETHAMLPYDQYMHRFAAYFQQGDMESNGKYISKDGSRVKYQTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQSQHPIRNNLHHKILMANFLAQTEALMKGKTADEARRELEAAGLKGEALEKLLPHKVFQGNKPSNSIVFKKLTPFMLGALVAMYEHKIFVQGVIWNINSYDQWGVELGKQLAKQIEPELQDAAE--VTSHDSSTNGLINFLK 381          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067583.1 (SMESG000067583.1)

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 535/546 (97.99%), Postives = 537/546 (98.35%), Query Frame = 2
Query:   74 MASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            MASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIP+QTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVE GKVLAKKIQ EL  S   +I SHDSSTNGLI FIKSQK
Sbjct:    1 MASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPEL--SGGEVIKSHDSSTNGLIDFIKSQK 544          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067583.1 (SMESG000067583.1)

HSP 1 Score: 1074.31 bits (2777), Expect = 0.000e+0
Identity = 520/531 (97.93%), Postives = 522/531 (98.31%), Query Frame = 2
Query:  119 MSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 1711
            MSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIP+QTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVE GKVLAKKIQ EL  S   +I SHDSSTNGLI FIKSQK
Sbjct:    1 MSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPEL--SGGEVIKSHDSSTNGLIDFIKSQK 529          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067534.1 (SMESG000067534.1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 478/547 (87.39%), Postives = 515/547 (94.15%), Query Frame = 2
Query:   74 MASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQKM 1714
            M+SL KFTL+E++INMS QFD N NRFSEFSRTL+F+EHG LLFDFSKNLIS+ +F+DLI LAK+S +E+KR+KMF GEKINFTENRSV H+ALRNRSNK I +D+ DVMPSVNAVL HM+EFT SVHKGLFLGHTGK +TDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTN++ AKQWFLK+ K+ +A+SKHFVALSTNIPKVKEFGIDE+N+F+FW+WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAY QQ DMESNGKFIN  GKR+ Y TGP+IWGEPGTNGQHAFYQLIHQGTRLIPADFLIP+QTHNPINNGLHH+ILLSNFLAQTEALMRGK  +KV++EL AEG  G ++ELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVE GKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQKM
Sbjct:    1 MSSLPKFTLRERNINMSIQFDENPNRFSEFSRTLNFEEHGLLLFDFSKNLISSAVFKDLIHLAKESGIEDKRDKMFVGEKINFTENRSVSHVALRNRSNKPINIDRADVMPSVNAVLSHMKEFTNSVHKGLFLGHTGKMLTDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNSEAAKQWFLKHAKAENAISKHFVALSTNIPKVKEFGIDERNVFQFWEWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYLQQSDMESNGKFINQAGKRIAYSTGPVIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHDILLSNFLAQTEALMRGKSVDKVKKELIAEGKKGPEMELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQKM 547          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067534.1 (SMESG000067534.1)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 468/532 (87.97%), Postives = 501/532 (94.17%), Query Frame = 2
Query:  119 MSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNLISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNKSIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGIDEKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPSQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQKM 1714
            MS QFD N NRFSEFSRTL+F+EHG LLFDFSKNLIS+ +F+DLI LAK+S +E+KR+KMF GEKINFTENRSV H+ALRNRSNK I +D+ DVMPSVNAVL HM+EFT SVHKGLFLGHTGK +TDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTN++ AKQWFLK+ K+ +A+SKHFVALSTNIPKVKEFGIDE+N+F+FW+WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAY QQ DMESNGKFIN  GKR+ Y TGP+IWGEPGTNGQHAFYQLIHQGTRLIPADFLIP+QTHNPINNGLHH+ILLSNFLAQTEALMRGK  +KV++EL AEG  G ++ELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVE GKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQKM
Sbjct:    1 MSIQFDENPNRFSEFSRTLNFEEHGLLLFDFSKNLISSAVFKDLIHLAKESGIEDKRDKMFVGEKINFTENRSVSHVALRNRSNKPINIDRADVMPSVNAVLSHMKEFTNSVHKGLFLGHTGKMLTDVVNIGIGGSDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIASKTFTTIETMTNSEAAKQWFLKHAKAENAISKHFVALSTNIPKVKEFGIDERNVFQFWEWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYLQQSDMESNGKFINQAGKRIAYSTGPVIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHDILLSNFLAQTEALMRGKSVDKVKKELIAEGKKGPEMELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQKM 532          
The following BLAST results are available for this feature:
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPI0.000e+068.67glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
GPI0.000e+068.67glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
GPI0.000e+065.10glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
GPI1.033e-1765.39glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
GPI1.068e-10663.56glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpi-10.000e+065.73Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
gpi-10.000e+065.73Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
gpi-10.000e+065.73Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
gpi-10.000e+065.73Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pgi0.000e+063.62gene:FBgn0003074 transcript:FBtr0088680[more]
Pgi0.000e+063.62gene:FBgn0003074 transcript:FBtr0088681[more]
Pgi0.000e+063.62gene:FBgn0003074 transcript:FBtr0088679[more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gpib0.000e+067.86glucose-6-phosphate isomerase b [Source:ZFIN;Acc:Z... [more]
gpia0.000e+066.18glucose-6-phosphate isomerase a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpi0.000e+070.17glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi0.000e+067.79glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi0.000e+066.91glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi0.000e+067.73glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi0.000e+066.91glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpi10.000e+067.79glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
Gpi14.892e-8272.09glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
Gpi13.427e-2166.15glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
Gpi12.490e-1950.63glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
Gpi13.329e-965.71glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P06744|G6PI_HUMAN0.000e+068.67Glucose-6-phosphate isomerase OS=Homo sapiens OX=9... [more]
sp|Q4R591|G6PI_MACFA0.000e+068.11Glucose-6-phosphate isomerase OS=Macaca fascicular... [more]
sp|Q5R4E3|G6PI_PONAB0.000e+067.92Glucose-6-phosphate isomerase OS=Pongo abelii OX=9... [more]
sp|Q3ZBD7|G6PI_BOVIN0.000e+067.34Glucose-6-phosphate isomerase OS=Bos taurus OX=991... [more]
sp|P06745|G6PI_MOUSE0.000e+067.79Glucose-6-phosphate isomerase OS=Mus musculus OX=1... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RGH60.000e+070.05Glucose-6-phosphate isomerase OS=Fasciola hepatica... [more]
A0A2H1CIV90.000e+070.26Glucose-6-phosphate isomerase OS=Fasciola hepatica... [more]
A0A1S8WXB40.000e+071.30Glucose-6-phosphate isomerase OS=Opisthorchis vive... [more]
A0A4S2LZB60.000e+071.12Glucose-6-phosphate isomerase OS=Opisthorchis feli... [more]
A0A3R7FZV50.000e+070.93Glucose-6-phosphate isomerase OS=Clonorchis sinens... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpia0.000e+068.48glucose-6-phosphate isomerase-like [Source:NCBI ge... [more]
gpib0.000e+065.22glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpib0.000e+063.59glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpia0.000e+069.31glucose-6-phosphate isomerase-like [Source:NCBI ge... [more]
gpia0.000e+065.43glucose-6-phosphate isomerase-like [Source:NCBI ge... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpib4.898e-8472.00glucose-6-phosphate isomerase b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PGI10.000e+057.17Glycolytic enzyme phosphoglucose isomerase; cataly... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO370390.000e+067.79Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
EDO277743.300e-10150.16Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
EDO275525.045e-8049.44Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpia0.000e+067.04glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpib0.000e+064.80glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpib0.000e+062.45glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpia0.000e+069.25glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000067583.10.000e+097.99SMESG000067583.1[more]
SMESG000067583.10.000e+097.93SMESG000067583.1[more]
SMESG000067534.10.000e+087.39SMESG000067534.1[more]
SMESG000067534.10.000e+087.97SMESG000067534.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003716 ID=SMED30003716|Name=Glucose-6-phosphate isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1815bp
ATATAAACCTAAATTTCAATAGGTTTATTATACTTTTGGATTTGAAGTCA
CGTATCAAGAAAATTTTATTGAAATGGCATCGTTACAAAAATTTACTTTG
AAAGAGAAACATATTAATATGTCTAACCAATTCGATTCAAATTCTAACAG
ATTTTCCGAATTCAGCCGGACTCTAGATTTTAAAGAACACGGGAAATTGC
TTTTTGACTTTTCTAAAAATTTGATATCCACCGATATTTTTAGAGATTTG
ATTCAATTGGCTAAAGACAGTGATGTGGAAAACAAAAGAAATAAAATGTT
TAGTGGTGAAAAAATAAATTTCACTGAGAATAGATCAGTATTACATATCG
CTTTACGAAATAGGTCAAATAAATCAATTTATGTTGATCAAGTAGATGTA
ATGCCCTCTGTCAATGCAGTATTAAAGCACATGAGAGAATTTACAGAATC
GGTGCACAAAGGATTATTTTTGGGACATACTGGTAAAAAGATTACTGACG
TAGTTAATATTGGAATAGGGGGTTCGGATTTGGGGCCAGTTATGGTGACA
GAGGCTTTGAAGCCATTTGCCAACAAGAATATTCGAGTTCATTTTGTGTC
AAATATCGATGGAACGCATATGGCTGAGACCTTAGCTAAATTGAATCCTG
AAACTGTTTTGTTTATTATCGCTTCAAAAACATTTACAACTATTGAAACG
ATGACAAATGCACAAACTGCGAAACAATGGTTTTTGAAAAATGTCAAATC
AGCTTCTGCAGTTTCTAAACATTTCGTTGCACTCTCAACTAATATTCCAA
AGGTCAAAGAATTCGGAATCGATGAGAAAAATATGTTTGAATTTTGGGAC
TGGGTTGGTGGAAGATATTCACTCTGGTCTGCAATTGGACTTTCTATTGC
TTTGTACATTGGAATGGACAATTTTGAAGAATTATTATCTGGTGGGCATG
CAATGGATAACCATTTCAAAGAAACTCCATTAGAACAAAACATTCCAGTA
ATAATGGCAATGTTGGGCATCATGTACATTCATTGTTACAAAGCCGAAAC
GCATGCAATTCTACCATACGATCAATATATGCATCGTTTCGCTGCCTATT
TCCAACAAGGTGACATGGAATCCAATGGGAAATTTATTAATCATGTGGGC
AAACGCGTTCCATATCACACTGGACCAATCATTTGGGGTGAACCTGGAAC
TAATGGCCAACATGCCTTCTATCAATTGATACACCAGGGAACGAGACTCA
TTCCTGCTGATTTCTTGATTCCTTCACAAACTCATAATCCTATCAATAAT
GGCTTGCATCACGAAATCTTGTTGTCGAATTTCTTAGCGCAAACTGAGGC
ACTGATGCGTGGTAAAGGTGCAGAGAAAGTTCGAGAAGAACTAGAAGCTG
AAGGAATGAGTGGTGCAGATTTAGAATTATTGTCACAGCATAAGTCATTT
CCTGGAAATCGTCCTACGAATTCTTTCGTCTTTACAAAGATGAATCCATT
TATGTTGGGGGTGTTGATTGCAATGTATGAGCACAAGATATTTGTACAAG
GCGCTATATGGGAAATCAATTCTTACGATCAATGGGGCGTGGAATTTGGA
AAGGTTTTGGCTAAAAAAATCCAACAAGAGTTACGCACCAGCAGCAACAC
ATTGATAACATCGCACGATTCTTCAACTAATGGATTGATTCAATTTATCA
AGTCACAGAAAATGTAGCGATATTTATAAATGATTGCTGTTGTTTGTTAT
TTTTACCGTTTCTTTGAGTTTATTATTTACATTATAACTTGATAAAAATA
ATAAACATTTTGAAA
back to top

protein sequence of SMED30003716-orf-1

>SMED30003716-orf-1 ID=SMED30003716-orf-1|Name=SMED30003716-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MASLQKFTLKEKHINMSNQFDSNSNRFSEFSRTLDFKEHGKLLFDFSKNL
ISTDIFRDLIQLAKDSDVENKRNKMFSGEKINFTENRSVLHIALRNRSNK
SIYVDQVDVMPSVNAVLKHMREFTESVHKGLFLGHTGKKITDVVNIGIGG
SDLGPVMVTEALKPFANKNIRVHFVSNIDGTHMAETLAKLNPETVLFIIA
SKTFTTIETMTNAQTAKQWFLKNVKSASAVSKHFVALSTNIPKVKEFGID
EKNMFEFWDWVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKE
TPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMES
NGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIP
SQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADL
ELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINS
YDQWGVEFGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0006094gluconeogenesis
GO:0006096glycolytic process
GO:0001525angiogenesis
GO:0001701in utero embryonic development
GO:0001707mesoderm formation
GO:0005975carbohydrate metabolic process
GO:0006959humoral immune response
GO:0007599hemostasis
GO:0007611learning or memory
GO:0019242methylglyoxal biosynthetic process
GO:0032355response to estradiol
GO:0032570response to progesterone
GO:0033574response to testosterone
GO:0034101erythrocyte homeostasis
GO:0035902response to immobilization stress
GO:0035994response to muscle stretch
GO:0042593glucose homeostasis
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043278response to morphine
GO:0043312neutrophil degranulation
GO:0043524negative regulation of neuron apoptotic process
GO:0046185aldehyde catabolic process
GO:0046686response to cadmium ion
GO:0051156glucose 6-phosphate metabolic process
GO:0061621canonical glycolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035482SIS_PGI_2
IPR035476SIS_PGI_1
IPR001672G6P_Isomerase
IPR023096G6P_Isomerase_C
IPR018189Phosphoglucose_isomerase_CS
Vocabulary: molecular function
TermDefinition
GO:0004347glucose-6-phosphate isomerase activity
GO:0005125cytokine activity
GO:0008083growth factor activity
GO:0016853isomerase activity
GO:0016866intramolecular transferase activity
GO:0031625ubiquitin protein ligase binding
GO:0048029monosaccharide binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0034774secretory granule lumen
GO:0043005neuron projection
GO:0043209myelin sheath
GO:0060170ciliary membrane
GO:0070062extracellular exosome
GO:1904813ficolin-1-rich granule lumen
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001672Phosphoglucose isomerase (PGI)PRINTSPR00662G6PISOMERASEcoord: 143..162
score: 71.38
coord: 332..353
score: 61.36
coord: 493..504
score: 54.8
coord: 255..273
score: 77.04
coord: 479..493
score: 62.07
coord: 461..479
score: 40.02
IPR001672Phosphoglucose isomerase (PGI)PFAMPF00342PGIcoord: 45..504
e-value: 5.9E-224
score: 744.1
IPR001672Phosphoglucose isomerase (PGI)PANTHERPTHR11469GLUCOSE-6-PHOSPHATE ISOMERASEcoord: 6..504
IPR001672Phosphoglucose isomerase (PGI)PROSITEPS51463P_GLUCOSE_ISOMERASE_3coord: 17..504
score: 132.556
NoneNo IPR availableGENE3DG3DSA:3.40.50.10490coord: 94..288
e-value: 3.8E-223
score: 743.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.10490coord: 17..504
e-value: 3.8E-223
score: 743.2
NoneNo IPR availablePANTHERPTHR11469:SF4GLUCOSE-6-PHOSPHATE ISOMERASEcoord: 6..504
NoneNo IPR availableSUPERFAMILYSSF53697SIS domaincoord: 12..504
IPR018189Phosphoglucose isomerase, conserved sitePROSITEPS00765P_GLUCOSE_ISOMERASE_1coord: 259..272
IPR035482Phosphoglucose isomerase, SIS domain 2CDDcd05016SIS_PGI_2coord: 325..504
e-value: 2.1759E-77
score: 237.883
IPR035476Phosphoglucose isomerase, SIS domain 1CDDcd05015SIS_PGI_1coord: 114..278
e-value: 4.09405E-83
score: 252.447