G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30003712
Length (bp)1227
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003712) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003712) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003712) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003712) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003712

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003712SMESG000061117.1 SmedASXL_060230SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003712SMESG000061117.1 SmedASXL_006041SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003712SMESG000061117.1 dd_Smed_v6_26402_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3SPR4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS6974 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.116e-12
Identity = 65/276 (23.55%), Postives = 125/276 (45.29%), Query Frame = 2
Query:  407 LLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEM--------------------------------IFNSLENTSLVNV---QSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFL-QYRISNEIKSFNQ-KNEQKXXXXXXXXXXXXXXXQGPLALYTGLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQFRKRFYRLLDGRWSNRHRSSCSTAAIFS 1123
            L +SNW+ T   +ER +A+  PF AK+I  +HR   +S++ + + +  IP  +L I + E                                 I  +    S V V   + K+ + ++I + +Q+W V F +FF++PF  +C  S+ LL A++ S +F+ Q+ I   ++  N  + E ++T+    ++  F I Q P  +Y   + +G+ +  S       ++R       ++K++  F+ + + N +F     R+L    SN     C  +  +S
Sbjct:  118 LFTSNWLMTAQAIERTIAISKPFKAKQIREKHRRIVVSVIFILSVLFTIPTLVLDIMQTERYQEDPGDFHKDGDGFFHFFNKFKNDINLPQFDINQTYSLESFVPVSPSKDKWPRYLVIFEKVQSWLVYFVLFFILPFVCLCLTSFYLLSAVKMSGRFVRQHCIRGGVEFRNTLREEARMTVLTLCLIGAFFICQSPFVIYQAFTHVGLLSRPS---HEMSLVRALIHLALALKSDCTFVFHCWLNQRFALALRRMLCSFSSNTASGRCHGSKSYS 390          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7TMC4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_215199 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.334e-11
Identity = 67/234 (28.63%), Postives = 124/234 (52.99%), Query Frame = 2
Query:  395 LDIILLSSNWITTLLGLERCVAVRDPFLAKRITN--RHRYFSISIVIVTAAILRIPNAILAIWKQEMI--FNSLENTSLVNVQS-KFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKSFN------QKNEQKXXXXXXXXXXXXXXXQGPLALYTGLSSI-------GMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQF 1042
            + + L++S W+T +L +ER +A+  PFLA ++ +  R R F +SI +  A ++R+P    A W+ E++  F++L NTS+   +S +   N+  L+ I  W VD  +  ++PF L+  ++  L+  +R S ++LQ  +   + +        +K E +IT+ L  +++ F I Q P  +YT + SI       G +  + IF Q   V       + + K+  NFI+Y + + +F
Sbjct:  114 MHVFLMASIWLTVMLAVERYIAICQPFLAAKVCSVKRARIFVVSIYVF-AFLVRLP----AFWEHEVVTRFDTLSNTSISYTKSTELASNVHYLR-INPWVVDGILMSILPFILLLVLNVRLIWEVRKSTRYLQATMVASVSAPGRSAGTIKKEELQITVMLISIIIVFFICQAPYVVYTAIFSINKDILSSGSSTGFLIFHQLAIV-------VLAFKSAVNFIIYCWFSEKF 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183A6C3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2508 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 7.496e-9
Identity = 39/131 (29.77%), Postives = 71/131 (54.20%), Query Frame = 2
Query:  389 ELLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQ 781
            E +D +L  SNW+T +L  ER VA+  P  ++RI+ +HR   +++VIV++ I+R P  +L          ++ N  +         NI + Q    W V   +F + PF+L+ +++  L++A+R S + L+
Sbjct:  122 ESVDTLLFISNWLTAMLATERYVAICYPLQSRRISRKHRRIVVTMVIVSSLIIRTPGFVLL---------NMSNDPVT------YPNIAVYQRCYVWIVQVTLFLIAPFALLTFVNLRLIQAVRRSSKLLR 237          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3Q0KCG8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.431e-7
Identity = 40/140 (28.57%), Postives = 76/140 (54.29%), Query Frame = 2
Query:  389 ELLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKS 808
            EL+D +LL SNW+T L+  ER +AV  P   + I  ++R   I +VI+++ ++++P  I+  + +E+      N+S           I+I + I  W V   +F ++PFS++ +++  L++ +R+S Q +  R     K 
Sbjct:  144 ELVDTLLLISNWLTVLIATERYLAVCHPLKVRFIDCKYRRIFIILVILSSILIKLPGFIILGYAKEI------NSSY---------TIIIFRKIYIWIVQILLFLIIPFSILTFVNVRLIQTVRNSLQLINQRCKKTTKE 268          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183P0J3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS7879 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 5.906e-7
Identity = 40/133 (30.08%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  389 ELLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYR 787
            EL+D +LL SNW+T L+  ER +AV  P   + I  ++R   I +VI  + ++++P  I+  + +E+      N+S           I+IL+ I  W V   +F ++PFS++ +++  L++ +R+S Q +  R
Sbjct:  135 ELVDTLLLISNWLTVLIATERYLAVCHPLKVRFIDCKYRRIFIILVIFFSVLIKLPGFIILGFAKEI------NSSYT---------IIILRKIYIWIVQILLFLIIPFSILTFVNVRLIQTVRNSLQLINQR 252          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061117.1 (SMESG000061117.1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 377/377 (100.00%), Postives = 377/377 (100.00%), Query Frame = 2
Query:   65 MKSNFRMNYFIFNGTSSLNFFENDSSVIVSTKIFDVLIPVNCSVNALITLILITVCIRKGVIGPSTKVYXXXXXXXXXXXXXXXMFINFDLHYKFQNAHLMVMIKCFIELLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKSFNQKNEQKXXXXXXXXXXXXXXXQGPLALYTGLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQFRKRFYRLLDGRWSNRHRSSCSTAAIFSASYAYKNTVSVPFRLSSCNVMQDL 1195
            MKSNFRMNYFIFNGTSSLNFFENDSSVIVSTKIFDVLIPVNCSVNALITLILITVCIRKGVIGPSTKVYIIANAILDLIAILILMFINFDLHYKFQNAHLMVMIKCFIELLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKSFNQKNEQKITIFLFVVLLNFIIFQGPLALYTGLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQFRKRFYRLLDGRWSNRHRSSCSTAAIFSASYAYKNTVSVPFRLSSCNVMQDL
Sbjct:    1 MKSNFRMNYFIFNGTSSLNFFENDSSVIVSTKIFDVLIPVNCSVNALITLILITVCIRKGVIGPSTKVYIIANAILDLIAILILMFINFDLHYKFQNAHLMVMIKCFIELLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKSFNQKNEQKITIFLFVVLLNFIIFQGPLALYTGLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQFRKRFYRLLDGRWSNRHRSSCSTAAIFSASYAYKNTVSVPFRLSSCNVMQDL 377          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000039899.1 (SMESG000039899.1)

HSP 1 Score: 102.064 bits (253), Expect = 6.834e-24
Identity = 68/224 (30.36%), Postives = 126/224 (56.25%), Query Frame = 2
Query:  392 LLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKSFNQKNEQKXXXXXXXXXXXXXXXQGPLALYTGLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQFRKRFYRL 1063
            L + +LL SNW+TT+LG+ER + V  PFL KRITN HR        V   +++IP+ IL I  + ++ N  +  +      + +K++   +  Q+W VDF +F +VPF ++ +++  L+  IR S +F++   +N  +   +  E+KIT  +  V++ F I QGP   YT LS++ +  ++  +   Q +++   + I S+K++ +F+L+ +   +F     R+
Sbjct:  108 LFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHT-----QEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKI-ENEERKITCIMICVIMAFFICQGPFITYTALSNVHL--FHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRM 323          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078268.1 (SMESG000078268.1)

HSP 1 Score: 75.485 bits (184), Expect = 7.694e-15
Identity = 82/293 (27.99%), Postives = 147/293 (50.17%), Query Frame = 2
Query:  323 INFDLHYKFQNAHLMVMIKCFIELLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNIL--ILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKSFNQKN----EQKXXXXXXXXXXXXXXXQGPLALYTGLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQFRKRFYRLLDGRWSNRHRSSCSTAAIFSASYAYKNTVSVPFRLSSCNV 1183
            +NF++  K+ N  +++      E L  ++  SNWIT LLG ER +AV  P  ++RI   HR  +++++ V   I ++P  I+    +   F+ L          + Q+N +  +  ++Q W +   +F +VPF  +  +++ L+ A+R S +FL+ + SN+  ++   N    E KIT  L  +++ F +FQGP  +Y  L S    NY+SI       +R     + S+K+  +F LY +   +FR+  Y LL  R S +  SS + A   +    Y  + ++  R +  N+
Sbjct:   87 LNFEMISKWFNVKMILA-----EFLHGLIFISNWITVLLGFERYIAVCYPLYSRRIDYIHRKIAVAVIFVVIIIFKLPLIIMIYLHR---FHDL----------RIQRNFIYKLYTHVQLWIITLFLFLIVPFVCLALINFQLILAVRRSSRFLR-QCSNQNPNYQNSNSRTEEHKITFVLIGIIVIFFVFQGPFGIYVTLQSF---NYHSI------SLRGISSILLSLKSIVHFFLYCWFCEKFRQILYHLL-CRSSRQEISSFTLADQSTQQLMYPISPTLEQRNAKANI 350          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SPR41.116e-1223.55G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
R7TMC44.334e-1128.63G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183A6C37.496e-929.77G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A3Q0KCG82.431e-728.57G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183P0J35.906e-730.08G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061117.10.000e+0100.00SMESG000061117.1[more]
SMESG000039899.16.834e-2430.36SMESG000039899.1[more]
SMESG000078268.17.694e-1527.99SMESG000078268.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003712 ID=SMED30003712|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1227bp
AACATTTCTATTATTTTATTATGTTTACTATGTTGCTATAAATAAAGAAA
AAGTCTTTTTCAATATGAAATCTAATTTCAGAATGAATTATTTCATTTTT
AATGGAACTTCGAGTTTGAACTTCTTTGAAAATGATAGCTCAGTGATTGT
CAGCACGAAGATTTTTGATGTCCTCATTCCTGTCAATTGTTCCGTGAACG
CTTTGATAACGCTGATCCTGATCACAGTATGCATTCGGAAAGGAGTGATC
GGTCCTAGCACAAAGGTCTACATTATCGCAAATGCTATACTCGATTTAAT
AGCAATTTTAATTTTAATGTTTATCAACTTTGATCTGCACTATAAATTCC
AAAACGCTCATTTAATGGTCATGATTAAATGTTTCATTGAACTACTCGAT
ATCATTCTTTTATCGTCGAACTGGATCACGACTCTTTTAGGTCTAGAACG
ATGTGTAGCCGTTCGGGATCCATTCTTGGCGAAACGCATTACCAATCGCC
ATCGGTACTTCAGTATATCTATAGTAATTGTTACGGCGGCCATTTTAAGA
ATACCAAACGCAATTTTGGCAATTTGGAAACAAGAAATGATCTTTAATTC
TCTTGAAAACACCAGTCTTGTAAACGTTCAATCGAAATTCCAGAAAAACA
TTTTGATTTTGCAAAATATCCAAAATTGGTTCGTTGATTTTTGCATTTTT
TTCGTTGTTCCGTTTTCACTGATGTGCTGGATGAGTTACGTACTGCTTCG
AGCGATTCGGTCGTCGCAACAATTTCTCCAATATCGGATTTCGAATGAAA
TAAAATCTTTCAATCAGAAAAATGAGCAGAAAATTACGATATTTCTTTTC
GTTGTGTTGTTGAATTTTATCATTTTTCAGGGACCCTTGGCTTTGTATAC
GGGACTGTCTTCGATAGGAATGGCAAATTACTATTCAATCTTTACTCAGT
ACCAGTTTGTTATTCGGCCGTCATGTGTTTTCATTTTTTCAATCAAAAAT
GAAGCGAACTTCATTTTATATCTTTACCATAATTATCAATTCCGCAAGCG
TTTCTACCGTTTATTAGACGGAAGATGGAGTAACAGGCACCGATCAAGCT
GCAGTACCGCTGCGATTTTTTCAGCTAGTTATGCGTATAAAAACACGGTA
TCTGTCCCCTTCAGGTTATCTTCATGTAATGTTATGCAGGATTTATGACA
CTTTTACATTTTAAGCATTCATAACAT
back to top

protein sequence of SMED30003712-orf-1

>SMED30003712-orf-1 ID=SMED30003712-orf-1|Name=SMED30003712-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
TFLLFYYVYYVAINKEKVFFNMKSNFRMNYFIFNGTSSLNFFENDSSVIV
STKIFDVLIPVNCSVNALITLILITVCIRKGVIGPSTKVYIIANAILDLI
AILILMFINFDLHYKFQNAHLMVMIKCFIELLDIILLSSNWITTLLGLER
CVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNS
LENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLR
AIRSSQQFLQYRISNEIKSFNQKNEQKITIFLFVVLLNFIIFQGPLALYT
GLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLYHNYQFRKR
FYRLLDGRWSNRHRSSCSTAAIFSASYAYKNTVSVPFRLSSCNVMQDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 322..348
score: 18.92
coord: 50..74
score: 16.45
coord: 132..154
score: 19.66
coord: 228..252
score: 17.17
coord: 87..108
score: 24.69
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 72..305
e-value: 6.1E-10
score: 38.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 49..368
e-value: 5.4E-24
score: 86.6
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 30..369
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 138..351
e-value: 4.82625E-14
score: 69.9692
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 48..369
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 128..148
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
NoneNo IPR availableTMHMMTMhelixcoord: 89..108
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
NoneNo IPR availableTMHMMTMhelixcoord: 320..342
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 65..340
score: 15.637