Uridine-cytidine kinase

Overview
NameUridine-cytidine kinase
Smed IDSMED30003700
Length (bp)994
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Uridine-cytidine kinase (SMED30003700) t-SNE clustered cells

Violin plots show distribution of expression levels for Uridine-cytidine kinase (SMED30003700) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Uridine-cytidine kinase (SMED30003700) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Uridine-cytidine kinase (SMED30003700) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003700

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30003700SMESG000030126.1 dd_Smed_v4_5820_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Uridine-cytidine kinase vs. Ensembl Human
Match: UCK2 (uridine-cytidine kinase 2 [Source:HGNC Symbol;Acc:HGNC:12562])

HSP 1 Score: 232.261 bits (591), Expect = 1.221e-74
Identity = 125/257 (48.64%), Postives = 169/257 (65.76%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E D     + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   +   L +++  ++  I  YD  S S+  E  + + P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   + ++   C +        +   R RQ S+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEET-VTVYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNG--CLNG-------YTPSRKRQASES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. Ensembl Human
Match: UCK1 (uridine-cytidine kinase 1 [Source:HGNC Symbol;Acc:HGNC:14859])

HSP 1 Score: 222.246 bits (565), Expect = 1.276e-70
Identity = 124/270 (45.93%), Postives = 165/270 (61.11%), Query Frame = 2
Query:   53 SDKIVPKPFIIGISGGTASGKSTLTEKIYQTLK----EECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN-------HGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            +D+   +PF+IG+SGGTASGKST+ EKI + L     E+    + ++S D FYK L   +K  A  G++NFDHPDAFD + ++  L  +   ++  +  YD  + S+L E  +    DV  V+ EGIL FY   IRD FH+++FVD D+D RLSRRV RDV +  RD+E+IL  Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN        G     S KR     +F   G H    T         ++RPH
Sbjct:   16 ADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADV--VLFEGILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRG-RDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKR-----TFSEPGDHPGMLTSGKRSHLESSSRPH 277          
BLAST of Uridine-cytidine kinase vs. Ensembl Human
Match: UCK2 (uridine-cytidine kinase 2 [Source:HGNC Symbol;Acc:HGNC:12562])

HSP 1 Score: 203.371 bits (516), Expect = 1.027e-63
Identity = 113/242 (46.69%), Postives = 154/242 (63.64%), Query Frame = 2
Query:  116 STLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            S++  KI Q L + E D     + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   +   L +++  ++  I  YD  S S+  E  + + P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   + ++   C +        +   R RQ S+    ++RPH
Sbjct:   13 SSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEET-VTVYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNG--CLNG-------YTPSRKRQASES---SSRPH 240          
BLAST of Uridine-cytidine kinase vs. Ensembl Human
Match: UCK1 (uridine-cytidine kinase 1 [Source:HGNC Symbol;Acc:HGNC:14859])

HSP 1 Score: 196.823 bits (499), Expect = 9.338e-61
Identity = 116/270 (42.96%), Postives = 156/270 (57.78%), Query Frame = 2
Query:   53 SDKIVPKPFIIGISGGTASGKSTLTEKIYQTLK----EECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN-------HGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            +D+   +PF+IG         ST+ EKI + L     E+    + ++S D FYK L   +K  A  G++NFDHPDAFD + ++  L  +   ++  +  YD  + S+L E  +    DV  V+ EGIL FY   IRD FH+++FVD D+D RLSRRV RDV +  RD+E+IL  Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN        G     S KR     +F   G H    T         ++RPH
Sbjct:   16 ADRPHQRPFLIG---------STVCEKIMELLGQNEVEQRQRKVVILSQDRFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADV--VLFEGILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRG-RDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKR-----TFSEPGDHPGMLTSGKRSHLESSSRPH 268          
BLAST of Uridine-cytidine kinase vs. Ensembl Human
Match: UCK1 (uridine-cytidine kinase 1 [Source:HGNC Symbol;Acc:HGNC:14859])

HSP 1 Score: 195.282 bits (495), Expect = 5.983e-60
Identity = 117/275 (42.55%), Postives = 158/275 (57.45%), Query Frame = 2
Query:   53 SDKIVPKPFIIGISGGTAS-----GKSTLTEKIYQTLK----EECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN-------HGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            +D+   +PF+IG     A       +ST+ EKI + L     E+    + ++S D FYK L   +K  A  G++NFDHPDAFD + ++  L  +   ++  +  YD  + S+L E  +    DV  V+ EGIL FY   IRD FH+++FVD D+D RLSRRV RDV +  RD+E+IL  Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN        G     S KR     +F   G H    T         ++RPH
Sbjct:   16 ADRPHQRPFLIGDERFQAGIPLLCLQSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADV--VLFEGILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRG-RDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKR-----TFSEPGDHPGMLTSGKRSHLESSSRPH 282          
BLAST of Uridine-cytidine kinase vs. Ensembl Celegans
Match: F19B6.1 (Uridine kinase [Source:UniProtKB/TrEMBL;Acc:D3YT38])

HSP 1 Score: 172.94 bits (437), Expect = 1.748e-49
Identity = 89/213 (41.78%), Postives = 135/213 (63.38%), Query Frame = 2
Query:   59 KIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVL 697
            K +  PF+IG+ GG+ASGK+T+ EKI + L       + ++S+DSFYK L   E   A++ ++NFD P+AFDF+ LY +L ++   +S  +  YD  + S+   + +    DV  ++ EGILAF+   I++   +KVFVD D D RL+RR+ RDV    RDI+ I+  YF FVKPAF+++  P    AD+I+PRG +N V ID+I+Q++   L
Sbjct:   59 KSLKHPFVIGVCGGSASGKTTVAEKIVERLGIPW---VTILSMDSFYKVLTPEEIKAAHESRYNFDGPNAFDFDLLYEVLKRLREGKSVDVPVYDFNTHSRDPNSKMMYGADV--LIFEGILAFHDERIKNLMDMKVFVDTDGDLRLARRIVRDVTDRGRDIDGIMEQYFTFVKPAFDKYIAPCMDSADLIVPRGGENDVAIDMIVQNVMAQL 266          
BLAST of Uridine-cytidine kinase vs. Ensembl Celegans
Match: F19B6.1 (Uridine kinase [Source:UniProtKB/TrEMBL;Acc:D3YT38])

HSP 1 Score: 172.94 bits (437), Expect = 2.900e-49
Identity = 89/213 (41.78%), Postives = 135/213 (63.38%), Query Frame = 2
Query:   59 KIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVL 697
            K +  PF+IG+ GG+ASGK+T+ EKI + L       + ++S+DSFYK L   E   A++ ++NFD P+AFDF+ LY +L ++   +S  +  YD  + S+   + +    DV  ++ EGILAF+   I++   +KVFVD D D RL+RR+ RDV    RDI+ I+  YF FVKPAF+++  P    AD+I+PRG +N V ID+I+Q++   L
Sbjct:   99 KSLKHPFVIGVCGGSASGKTTVAEKIVERLGIPW---VTILSMDSFYKVLTPEEIKAAHESRYNFDGPNAFDFDLLYEVLKRLREGKSVDVPVYDFNTHSRDPNSKMMYGADV--LIFEGILAFHDERIKNLMDMKVFVDTDGDLRLARRIVRDVTDRGRDIDGIMEQYFTFVKPAFDKYIAPCMDSADLIVPRGGENDVAIDMIVQNVMAQL 306          
BLAST of Uridine-cytidine kinase vs. Ensembl Celegans
Match: F19B6.1 (Uridine kinase [Source:UniProtKB/TrEMBL;Acc:D3YT38])

HSP 1 Score: 173.326 bits (438), Expect = 3.332e-49
Identity = 89/213 (41.78%), Postives = 135/213 (63.38%), Query Frame = 2
Query:   59 KIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVL 697
            K +  PF+IG+ GG+ASGK+T+ EKI + L       + ++S+DSFYK L   E   A++ ++NFD P+AFDF+ LY +L ++   +S  +  YD  + S+   + +    DV  ++ EGILAF+   I++   +KVFVD D D RL+RR+ RDV    RDI+ I+  YF FVKPAF+++  P    AD+I+PRG +N V ID+I+Q++   L
Sbjct:  113 KSLKHPFVIGVCGGSASGKTTVAEKIVERLGIPW---VTILSMDSFYKVLTPEEIKAAHESRYNFDGPNAFDFDLLYEVLKRLREGKSVDVPVYDFNTHSRDPNSKMMYGADV--LIFEGILAFHDERIKNLMDMKVFVDTDGDLRLARRIVRDVTDRGRDIDGIMEQYFTFVKPAFDKYIAPCMDSADLIVPRGGENDVAIDMIVQNVMAQL 320          
BLAST of Uridine-cytidine kinase vs. Ensembl Celegans
Match: B0001.4 (Probable uridine-cytidine kinase [Source:UniProtKB/Swiss-Prot;Acc:Q17413])

HSP 1 Score: 163.696 bits (413), Expect = 1.474e-48
Identity = 91/236 (38.56%), Postives = 134/236 (56.78%), Query Frame = 2
Query:   74 PFIIGISGGTASGKSTLTEKIYQTLKEEC-----DCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQG 766
            P +IG++GGT+ GKST+ E+I + L           +I  +S+ SFY+ L   EK  A +GKFNFDHPD  +F+ L   L  +   ++  I +YD  + S      + + P   V+++EGIL  Y   +R     K+FV+ +A++RL  R+   +    R    I+  Y +FVKPAFEEFC PTKKYAD+I+PRGADN V  DLI +++Q+     +   SSD+    +   V QG
Sbjct:    8 PLLIGVAGGTSCGKSTIVERIIENLNANAKQSGRQIDIVHLSLHSFYRELSAEEKILAREGKFNFDHPDQINFDLLAETLQNMIDGKTVEIPKYDMITSS--MNGTVTVEP-AKVIIIEGILLLYDERVRKLLSTKLFVEKNAESRLRNRLATYIRDYHRAPLSIIRQYTEFVKPAFEEFCRPTKKYADVIIPRGADNHVATDLIAKNLQETFR--KIVVSSDEEEEKENELVKQG 238          
BLAST of Uridine-cytidine kinase vs. Ensembl Celegans
Match: B0001.4 (Probable uridine-cytidine kinase [Source:UniProtKB/Swiss-Prot;Acc:Q17413])

HSP 1 Score: 160.999 bits (406), Expect = 6.611e-48
Identity = 85/210 (40.48%), Postives = 124/210 (59.05%), Query Frame = 2
Query:   74 PFIIGISGGTASGKSTLTEKIYQTLKEEC-----DCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQ 688
            P +IG++GGT+ GKST+ E+I + L           +I  +S+ SFY+ L   EK  A +GKFNFDHPD  +F+ L   L  +   ++  I +YD  + S      + + P   V+++EGIL  Y   +R     K+FV+ +A++RL  R+   +    R    I+  Y +FVKPAFEEFC PTKKYAD+I+PRGADN V  DLI +++Q
Sbjct:    8 PLLIGVAGGTSCGKSTIVERIIENLNANAKQSGRQIDIVHLSLHSFYRELSAEEKILAREGKFNFDHPDQINFDLLAETLQNMIDGKTVEIPKYDMITSS--MNGTVTVEP-AKVIIIEGILLLYDERVRKLLSTKLFVEKNAESRLRNRLATYIRDYHRAPLSIIRQYTEFVKPAFEEFCRPTKKYADVIIPRGADNHVATDLIAKNLQ 214          
BLAST of Uridine-cytidine kinase vs. Ensembl Fly
Match: Uck (gene:FBgn0263398 transcript:FBtr0299530)

HSP 1 Score: 221.861 bits (564), Expect = 1.941e-70
Identity = 115/224 (51.34%), Postives = 151/224 (67.41%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSS 724
            V  PF+IG++GGTASGKST+ +KI + L + E D     +  IS DSFY+ L   EK  A  G FNFDHPDAF+   +Y+ L  + +     I  YD+++ S   EN + I P   VV+ EGIL FY   IR+ FH+K+FVD D+DTRL+RRV RD+ +  RD++ +L  Y  FVKPAFEEFC PTKK+AD+I+PRGADN V IDLI+QHI+D LN+  R  S+
Sbjct:   24 VKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYP-ADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVQHIRDFLNNRSRHGST 246          
BLAST of Uridine-cytidine kinase vs. Ensembl Fly
Match: Uck (gene:FBgn0263398 transcript:FBtr0309097)

HSP 1 Score: 216.853 bits (551), Expect = 5.355e-69
Identity = 114/233 (48.93%), Postives = 152/233 (65.24%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDK-RVCSDA 748
            V  PF+IG++GGTASGKST+ +KI + L + E D     +  IS DSFY+ L   EK  A  G FNFDHPDAF+   +Y+ L  + +     I  YD+++ S   EN + I P   VV+ EGIL FY   IR+ FH+K+FVD D+DTRL+RRV RD+ +  RD++ +L  Y  FVKPAFEEFC PTKK+AD+I+PRGADN V IDLI+ HI ++L      Q S+  RV + +
Sbjct:   24 VKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYP-ADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVHHIGEILATTNSAQHSNTVRVAASS 255          
BLAST of Uridine-cytidine kinase vs. Ensembl Fly
Match: Uck (gene:FBgn0263398 transcript:FBtr0309095)

HSP 1 Score: 216.853 bits (551), Expect = 5.355e-69
Identity = 114/233 (48.93%), Postives = 152/233 (65.24%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDK-RVCSDA 748
            V  PF+IG++GGTASGKST+ +KI + L + E D     +  IS DSFY+ L   EK  A  G FNFDHPDAF+   +Y+ L  + +     I  YD+++ S   EN + I P   VV+ EGIL FY   IR+ FH+K+FVD D+DTRL+RRV RD+ +  RD++ +L  Y  FVKPAFEEFC PTKK+AD+I+PRGADN V IDLI+ HI ++L      Q S+  RV + +
Sbjct:   24 VKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYP-ADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVHHIGEILATTNSAQHSNTVRVAASS 255          
BLAST of Uridine-cytidine kinase vs. Ensembl Fly
Match: Uck (gene:FBgn0263398 transcript:FBtr0309096)

HSP 1 Score: 216.853 bits (551), Expect = 5.355e-69
Identity = 114/233 (48.93%), Postives = 152/233 (65.24%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDK-RVCSDA 748
            V  PF+IG++GGTASGKST+ +KI + L + E D     +  IS DSFY+ L   EK  A  G FNFDHPDAF+   +Y+ L  + +     I  YD+++ S   EN + I P   VV+ EGIL FY   IR+ FH+K+FVD D+DTRL+RRV RD+ +  RD++ +L  Y  FVKPAFEEFC PTKK+AD+I+PRGADN V IDLI+ HI ++L      Q S+  RV + +
Sbjct:   24 VKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYP-ADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVHHIGEILATTNSAQHSNTVRVAASS 255          
BLAST of Uridine-cytidine kinase vs. Ensembl Fly
Match: Uck (gene:FBgn0263398 transcript:FBtr0084602)

HSP 1 Score: 216.853 bits (551), Expect = 5.355e-69
Identity = 114/233 (48.93%), Postives = 152/233 (65.24%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDK-RVCSDA 748
            V  PF+IG++GGTASGKST+ +KI + L + E D     +  IS DSFY+ L   EK  A  G FNFDHPDAF+   +Y+ L  + +     I  YD+++ S   EN + I P   VV+ EGIL FY   IR+ FH+K+FVD D+DTRL+RRV RD+ +  RD++ +L  Y  FVKPAFEEFC PTKK+AD+I+PRGADN V IDLI+ HI ++L      Q S+  RV + +
Sbjct:   24 VKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYP-ADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVHHIGEILATTNSAQHSNTVRVAASS 255          
BLAST of Uridine-cytidine kinase vs. Ensembl Zebrafish
Match: uck2b (uridine-cytidine kinase 2b [Source:NCBI gene;Acc:327057])

HSP 1 Score: 221.861 bits (564), Expect = 7.208e-71
Identity = 121/259 (46.72%), Postives = 164/259 (63.32%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE----ECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            V +PF+IG+SGGTASGKS++ EKI + L +         + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   +   L  + + ++  I  YD  + S+  E F+ + P   VV+ EGIL FY   IRD F +K+FVD D DTRLSRRV RD+ +  R++E++L  Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   + +            Q  H   R R+ S+    ++RPH
Sbjct:   19 VRQPFLIGVSGGTASGKSSVCEKIMELLGQNKIDRHQRQVVILSQDSFYRELTPEQKAKAVKGQFNFDHPDAFDSELIMKTLRDIIQGKTVHIPVYDFVTHSRKDE-FLTLYP-ADVVLFEGILMFYSQEIRDLFKMKLFVDTDPDTRLSRRVLRDISERGRELEQVLNQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGFTKRQNG----------FQNGHGTPRQRRTSE----SSRPH 261          
BLAST of Uridine-cytidine kinase vs. Ensembl Zebrafish
Match: uck1 (uridine-cytidine kinase 2a [Source:NCBI gene;Acc:100005763])

HSP 1 Score: 218.779 bits (556), Expect = 1.191e-69
Identity = 120/257 (46.69%), Postives = 161/257 (62.65%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKEEC----DCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            +PF+IG++GGTASGKS++  KI + L +         + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   +   L ++    +  I  YD  + S+  E  + + P   VV+ EGIL FY   IRD F +K+FVD DADTRLSRRV RD+ +  RD+E++L  Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD LN G   + +    C +         H  R R PS+    ++RPH
Sbjct:   21 QPFLIGVAGGTASGKSSVCGKIMELLGQNKIDHHQRQVAILSQDSFYRVLTPEQKAKALKGQFNFDHPDAFDNELIVKTLCEIMEGRTVQIPVYDFVTHSRKEET-VTVYP-ADVVLFEGILMFYSQEIRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQVLNQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDFLNGGLTKRLNG---CLNG--------HTPRKRHPSES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. Ensembl Zebrafish
Match: uck2a (uridine-cytidine kinase 2a [Source:NCBI gene;Acc:100005763])

HSP 1 Score: 218.779 bits (556), Expect = 1.191e-69
Identity = 120/257 (46.69%), Postives = 161/257 (62.65%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKEEC----DCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            +PF+IG++GGTASGKS++  KI + L +         + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   +   L ++    +  I  YD  + S+  E  + + P   VV+ EGIL FY   IRD F +K+FVD DADTRLSRRV RD+ +  RD+E++L  Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD LN G   + +    C +         H  R R PS+    ++RPH
Sbjct:   21 QPFLIGVAGGTASGKSSVCGKIMELLGQNKIDHHQRQVAILSQDSFYRVLTPEQKAKALKGQFNFDHPDAFDNELIVKTLCEIMEGRTVQIPVYDFVTHSRKEET-VTVYP-ADVVLFEGILMFYSQEIRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQVLNQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDFLNGGLTKRLNG---CLNG--------HTPRKRHPSES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. Ensembl Zebrafish
Match: uck1 (uridine-cytidine kinase 1 [Source:NCBI gene;Acc:447928])

HSP 1 Score: 213.386 bits (542), Expect = 2.947e-67
Identity = 114/240 (47.50%), Postives = 151/240 (62.92%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKEEC----DCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHA 778
            +PF+IG+SGGTASGKST+  KI + L +         + ++S DSFY+ L   +K  A  G++NFDHPDAFD   +   L  +   +   +  YD  + S+L E       DV  V+ EGIL FY   +RD FH+K+FVD D+D RLSRRV RD+ +  RD+E+IL  Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN G+        +C        GH+H 
Sbjct:   16 RPFLIGVSGGTASGKSTVCAKIMELLGQNKVDHHQRKVTIVSQDSFYRVLTPEQKAKALKGQYNFDHPDAFDTEFMCQTLKDIVEGKVVEVPTYDFVTHSRLSEKICVYPADV--VLFEGILVFYTQEVRDMFHMKLFVDTDSDVRLSRRVLRDMNRG-RDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILN-GD--------ICKWQRGSVNGHNHG 243          
BLAST of Uridine-cytidine kinase vs. Ensembl Zebrafish
Match: si:ch211-243j20.2 (si:ch211-243j20.2 [Source:ZFIN;Acc:ZDB-GENE-041014-345])

HSP 1 Score: 171.014 bits (432), Expect = 2.031e-48
Identity = 90/216 (41.67%), Postives = 131/216 (60.65%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSS 724
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFYK L +  +  A   ++NFDHPDAFDF  L  +L K+ + +S  +  YD  + S+  E   +     +VV+ EGILAF    +     +KVFVD D+D RL RR+ RD+    RDI  ++  Y +FVKPAFE++  PT + ADI++PRG +N V +DLI+QH+   L   E T  S
Sbjct:   93 FVIGLCGGSASGKTTVANKIIEALDVPW---VVLLSMDSFYKVLSKDAQELAAKNEYNFDHPDAFDFELLVTVLRKLKKGKSIKVPVYDFTTHSRRKE--WKTVYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVRRLKRDITDRGRDISGVIKQYNKFVKPAFEQYIEPTVQVADIVVPRGGENFVALDLIVQHVHSQLEKREITVRS 303          
BLAST of Uridine-cytidine kinase vs. Ensembl Xenopus
Match: syngr1 (synaptogyrin 1 [Source:Xenbase;Acc:XB-GENE-494921])

HSP 1 Score: 235.343 bits (599), Expect = 6.814e-76
Identity = 128/260 (49.23%), Postives = 168/260 (64.62%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECD---CNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E D     + ++S DSFY+ L   +K+ A  G+FNFDHPDAFD   +   L ++   ++  I  YD  + S+  E  +    DV  V+ EGILAFY   IRD F +K+FVD DADTRLSRRV RD+ +  RD+E++L  Y  FVKPAFEEFCLPTKKYAD+I+PRGADNVV I+LI+QHIQD+LN G   +             T G+ + +   RTR PSD    ++RPH
Sbjct:   18 QPFLIGVSGGTASGKSSVCSKIVQLLGQNEVDHHQKQVVMLSQDSFYRILTPEQKSKALKGQFNFDHPDAFDNELILKTLKELMEGKTVQIPVYDFVTHSRKEETLVVYPADV--VLFEGILAFYMQEIRDMFQMKLFVDTDADTRLSRRVLRDINERGRDLEQVLTQYITFVKPAFEEFCLPTKKYADVIIPRGADNVVAINLIVQHIQDILNGGLTKRQ------------TNGYTNGFTSPRTRHPSDSN--SSRPH 261          
BLAST of Uridine-cytidine kinase vs. Ensembl Xenopus
Match: UCK1 (uridine-cytidine kinase 1 [Source:NCBI gene;Acc:100491950])

HSP 1 Score: 216.468 bits (550), Expect = 4.117e-68
Identity = 112/214 (52.34%), Postives = 148/214 (69.16%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN 700
            +PF+IG+SGGTASGKST+ EKI + L + E D     + ++S D FYK L   +K  A  G++NFDHPDAFD   ++  L ++   +   +  YD  + S+L E       DV  V+ EGILAFY   IRD F +K+FVD D+D RLSRRV RD+++  RD+E+IL+ Y  FVKPAFEEF LPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN
Sbjct:   37 RPFLIGVSGGTASGKSTVCEKIMELLGQNEVDHRQRKVVILSQDRFYKVLTPEQKARALKGQYNFDHPDAFDNELMHRTLTRIMEGQIVDVPMYDFITHSRLPETTTVYPADV--VLFEGILAFYNQEIRDMFQLKLFVDTDSDVRLSRRVLRDMKRG-RDLEQILSQYTTFVKPAFEEFSLPTKKYADVIIPRGVDNMVAINLIVQHIQDILN 247          
BLAST of Uridine-cytidine kinase vs. Ensembl Xenopus
Match: UCK1 (uridine-cytidine kinase 1 [Source:NCBI gene;Acc:100491950])

HSP 1 Score: 215.698 bits (548), Expect = 4.686e-68
Identity = 112/214 (52.34%), Postives = 148/214 (69.16%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN 700
            +PF+IG+SGGTASGKST+ EKI + L + E D     + ++S D FYK L   +K  A  G++NFDHPDAFD   ++  L ++   +   +  YD  + S+L E       DV  V+ EGILAFY   IRD F +K+FVD D+D RLSRRV RD+++  RD+E+IL+ Y  FVKPAFEEF LPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN
Sbjct:   27 RPFLIGVSGGTASGKSTVCEKIMELLGQNEVDHRQRKVVILSQDRFYKVLTPEQKARALKGQYNFDHPDAFDNELMHRTLTRIMEGQIVDVPMYDFITHSRLPETTTVYPADV--VLFEGILAFYNQEIRDMFQLKLFVDTDSDVRLSRRVLRDMKRG-RDLEQILSQYTTFVKPAFEEFSLPTKKYADVIIPRGVDNMVAINLIVQHIQDILN 237          
BLAST of Uridine-cytidine kinase vs. Ensembl Xenopus
Match: UCK1 (uridine-cytidine kinase 1 [Source:NCBI gene;Acc:100491950])

HSP 1 Score: 192.586 bits (488), Expect = 2.293e-59
Identity = 106/216 (49.07%), Postives = 142/216 (65.74%), Query Frame = 2
Query:   71 KPFIIGISGGT--ASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN 700
            KPF++  S  T  A  +ST+ EKI + L + E D     + ++S D FYK L   +K  A  G++NFDHPDAFD   ++  L ++   +   +  YD  + S+L E       DV  V+ EGILAFY   IRD F +K+FVD D+D RLSRRV RD+++  RD+E+IL+ Y  FVKPAFEEF LPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN
Sbjct:    2 KPFLLLYSAVTHFALAQSTVCEKIMELLGQNEVDHRQRKVVILSQDRFYKVLTPEQKARALKGQYNFDHPDAFDNELMHRTLTRIMEGQIVDVPMYDFITHSRLPETTTVYPADV--VLFEGILAFYNQEIRDMFQLKLFVDTDSDVRLSRRVLRDMKRG-RDLEQILSQYTTFVKPAFEEFSLPTKKYADVIIPRGVDNMVAINLIVQHIQDILN 214          
BLAST of Uridine-cytidine kinase vs. Ensembl Xenopus
Match: UCK1 (uridine-cytidine kinase 1 [Source:NCBI gene;Acc:100491950])

HSP 1 Score: 191.43 bits (485), Expect = 4.748e-59
Identity = 101/203 (49.75%), Postives = 137/203 (67.49%), Query Frame = 2
Query:  104 ASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN 700
            ++G+ST+ EKI + L + E D     + ++S D FYK L   +K  A  G++NFDHPDAFD   ++  L ++   +   +  YD  + S+L E       DV  V+ EGILAFY   IRD F +K+FVD D+D RLSRRV RD+++  RD+E+IL+ Y  FVKPAFEEF LPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN
Sbjct:    3 STGRSTVCEKIMELLGQNEVDHRQRKVVILSQDRFYKVLTPEQKARALKGQYNFDHPDAFDNELMHRTLTRIMEGQIVDVPMYDFITHSRLPETTTVYPADV--VLFEGILAFYNQEIRDMFQLKLFVDTDSDVRLSRRVLRDMKRG-RDLEQILSQYTTFVKPAFEEFSLPTKKYADVIIPRGVDNMVAINLIVQHIQDILN 202          
BLAST of Uridine-cytidine kinase vs. Ensembl Mouse
Match: Uck2 (uridine-cytidine kinase 2 [Source:MGI Symbol;Acc:MGI:1931744])

HSP 1 Score: 233.417 bits (594), Expect = 2.773e-75
Identity = 127/260 (48.85%), Postives = 171/260 (65.77%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E D +   + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + I P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQ S+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTIYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYTPSRKRQASES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. Ensembl Mouse
Match: Uck1 (uridine-cytidine kinase 1 [Source:MGI Symbol;Acc:MGI:98904])

HSP 1 Score: 229.95 bits (585), Expect = 1.325e-73
Identity = 125/261 (47.89%), Postives = 166/261 (63.60%), Query Frame = 2
Query:   53 SDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSD-PAILAT 820
            +D+  P+PF+IG+SGGTASGKST+ EKI + L + E D     + ++S D FYK L   +K  A  G++NFDHPDAFD + ++  L  +   ++  +  YD  + S+L E  +    DV  V+ EGIL FY   IRD FH+++FVD D+D RLSRRV RDV Q  RD+E+IL  Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN           +C        G +H     +P D P +LAT
Sbjct:   22 ADRPQPRPFLIGVSGGTASGKSTVCEKIMELLGQNEVDRRQRKLVILSQDCFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADV--VLFEGILVFYTQEIRDMFHLRLFVDTDSDVRLSRRVLRDV-QRGRDLEQILTQYTAFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILN---------GDLCKRHRGGPNGRNHKRTFPEPGDHPGVLAT 270          
BLAST of Uridine-cytidine kinase vs. Ensembl Mouse
Match: Uck2 (uridine-cytidine kinase 2 [Source:MGI Symbol;Acc:MGI:1931744])

HSP 1 Score: 204.912 bits (520), Expect = 2.409e-64
Identity = 115/245 (46.94%), Postives = 156/245 (63.67%), Query Frame = 2
Query:  116 STLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            S++  KI Q L + E D +   + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + I P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQ S+    ++RPH
Sbjct:   23 SSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTIYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYTPSRKRQASES---SSRPH 250          
BLAST of Uridine-cytidine kinase vs. Ensembl Mouse
Match: Uck2 (uridine-cytidine kinase 2 [Source:MGI Symbol;Acc:MGI:1931744])

HSP 1 Score: 170.629 bits (431), Expect = 1.142e-51
Identity = 93/192 (48.44%), Postives = 124/192 (64.58%), Query Frame = 2
Query:  263 DAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            DAFD   ++  L +++  ++  I  YD  S S+  E  + I P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQ S+    ++RPH
Sbjct:   20 DAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTIYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYTPSRKRQASES---SSRPH 194          
BLAST of Uridine-cytidine kinase vs. Ensembl Mouse
Match: Uckl1 (uridine-cytidine kinase 1-like 1 [Source:MGI Symbol;Acc:MGI:1915806])

HSP 1 Score: 167.162 bits (422), Expect = 1.380e-48
Identity = 84/210 (40.00%), Postives = 132/210 (62.86%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHG 706
            F IG+ GG+ASGK+T+   I + L       + ++S+DSFYK L + ++  A    FNFDHPDAFDF+ + + L K+ +  S  +  YD  + S+  +++  +    +V++ EGI+AF    + +   +K+FVD D+D RL RR+ RD+ +  RDIE ++  Y +FVKPAF+++  PT + ADI++PRG+ N V IDLI+QH+   L  G
Sbjct:   99 FAIGLGGGSASGKTTVARMIIEALDVPW---VVLLSMDSFYKVLTQQQQEQAACNNFNFDHPDAFDFDLIISTLKKLKQGRSVQVPIYDFTTHSR-KKDWKTLY-GANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQLEEG 303          
BLAST of Uridine-cytidine kinase vs. UniProt/SwissProt
Match: sp|B1H116|UCK2_XENTR (Uridine-cytidine kinase 2 OS=Xenopus tropicalis OX=8364 GN=uck2 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.610e-75
Identity = 128/260 (49.23%), Postives = 168/260 (64.62%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECD---CNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E D     + ++S DSFY+ L   +K+ A  G+FNFDHPDAFD   +   L ++   ++  I  YD  + S+  E  +    DV  V+ EGILAFY   IRD F +K+FVD DADTRLSRRV RD+ +  RD+E++L  Y  FVKPAFEEFCLPTKKYAD+I+PRGADNVV I+LI+QHIQD+LN G   +             T G+ + +   RTR PSD    ++RPH
Sbjct:   18 QPFLIGVSGGTASGKSSVCSKIVQLLGQNEVDHHQKQVVMLSQDSFYRILTPEQKSKALKGQFNFDHPDAFDNELILKTLKELMEGKTVQIPVYDFVTHSRKEETLVVYPADV--VLFEGILAFYMQEIRDMFQMKLFVDTDADTRLSRRVLRDINERGRDLEQVLTQYITFVKPAFEEFCLPTKKYADVIIPRGADNVVAINLIVQHIQDILNGGLTKRQ------------TNGYTNGFTSPRTRHPSDSN--SSRPH 261          
BLAST of Uridine-cytidine kinase vs. UniProt/SwissProt
Match: sp|Q9QYG8|UCK2_RAT (Uridine-cytidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Uck2 PE=2 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 1.939e-74
Identity = 127/260 (48.85%), Postives = 171/260 (65.77%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E D +   + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + I P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQ S+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTIYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYTPSRKRQASES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. UniProt/SwissProt
Match: sp|Q99PM9|UCK2_MOUSE (Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.939e-74
Identity = 127/260 (48.85%), Postives = 171/260 (65.77%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E D +   + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + I P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQ S+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTIYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYTPSRKRQASES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. UniProt/SwissProt
Match: sp|Q9BZX2|UCK2_HUMAN (Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 5.862e-74
Identity = 125/257 (48.64%), Postives = 169/257 (65.76%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E D     + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   +   L +++  ++  I  YD  S S+  E  + + P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   + ++   C +        +   R RQ S+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEET-VTVYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNG--CLNG-------YTPSRKRQASES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. UniProt/SwissProt
Match: sp|P52623|UCK1_MOUSE (Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 9.864e-73
Identity = 125/261 (47.89%), Postives = 166/261 (63.60%), Query Frame = 2
Query:   53 SDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSD-PAILAT 820
            +D+  P+PF+IG+SGGTASGKST+ EKI + L + E D     + ++S D FYK L   +K  A  G++NFDHPDAFD + ++  L  +   ++  +  YD  + S+L E  +    DV  V+ EGIL FY   IRD FH+++FVD D+D RLSRRV RDV Q  RD+E+IL  Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN           +C        G +H     +P D P +LAT
Sbjct:   16 ADRPQPRPFLIGVSGGTASGKSTVCEKIMELLGQNEVDRRQRKLVILSQDCFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADV--VLFEGILVFYTQEIRDMFHLRLFVDTDSDVRLSRRVLRDV-QRGRDLEQILTQYTAFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILN---------GDLCKRHRGGPNGRNHKRTFPEPGDHPGVLAT 264          
BLAST of Uridine-cytidine kinase vs. TrEMBL
Match: U6DTN8 (Uridine-cytidine kinase (Fragment) OS=Neovison vison OX=452646 GN=UCK2 PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 5.202e-75
Identity = 129/260 (49.62%), Postives = 172/260 (66.15%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E DC    + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + I P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQPS+    ++RPH
Sbjct:   15 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDCRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTIYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYIPSRKRQPSES---SSRPH 257          
BLAST of Uridine-cytidine kinase vs. TrEMBL
Match: M3XXP1 (Uridine-cytidine kinase OS=Mustela putorius furo OX=9669 GN=UCK2 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 5.602e-75
Identity = 129/260 (49.62%), Postives = 172/260 (66.15%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E DC    + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + I P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQPS+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDCRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTIYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYIPSRKRQPSES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. TrEMBL
Match: A0A2U3WI00 (Uridine-cytidine kinase OS=Odobenus rosmarus divergens OX=9708 GN=UCK2 PE=3 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 8.935e-75
Identity = 128/260 (49.23%), Postives = 172/260 (66.15%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E DC    + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + + P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQPS+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDCRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTVYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYIPSRKRQPSES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. TrEMBL
Match: A0A2Y9JTP4 (Uridine-cytidine kinase OS=Enhydra lutris kenyoni OX=391180 GN=LOC111151023 PE=3 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 8.935e-75
Identity = 128/260 (49.23%), Postives = 172/260 (66.15%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E DC    + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + + P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQPS+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDCRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTVYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYIPSRKRQPSES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. TrEMBL
Match: A0A485MLZ1 (Uridine-cytidine kinase OS=Lynx pardinus OX=191816 GN=LYPA_23C014337 PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.991e-73
Identity = 127/260 (48.85%), Postives = 171/260 (65.77%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE-ECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAW---RTRQPSDPAILATRPH 829
            +PF+IG+SGGTASGKS++  KI Q L + E DC    + ++S DSFY+ L   +K  A  G+FNFDHPDAFD   ++  L +++  ++  I  YD  S S+  E  + + P   VV+ EGILAFY   +RD F +K+FVD DADTRLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G   +             T G+ + +   R RQ S+    ++RPH
Sbjct:   19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDCRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEET-VTVYP-ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQ------------TNGYLNGYIPSRKRQSSES---SSRPH 261          
BLAST of Uridine-cytidine kinase vs. Ensembl Cavefish
Match: uck2b (uridine-cytidine kinase 2b [Source:NCBI gene;Acc:327057])

HSP 1 Score: 221.861 bits (564), Expect = 6.368e-70
Identity = 113/218 (51.83%), Postives = 150/218 (68.81%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE----ECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHG 706
            V +PF+IG+SGGTASGKS++ EKI + L +         +  +S DSFY+ L   +K  A  G+FNFDHPDAFD   +   L  + + ++  I  YD  + S+  E F+ + P   VV+ EGIL FY   IRD F +K+FVD D DTRLSRRV RD+ +  R++E++L+ Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G
Sbjct:   93 VRQPFLIGVSGGTASGKSSVCEKIMELLGQNKIDHHQRQVATLSQDSFYRELTPEQKAKALKGQFNFDHPDAFDNELILKTLRDIIQGKTVHIPVYDFVTHSRKDE-FVTLYP-ADVVLFEGILMFYMQEIRDLFQMKLFVDTDPDTRLSRRVLRDISERGRELEQVLSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGG 308          
BLAST of Uridine-cytidine kinase vs. Ensembl Cavefish
Match: uck1 (uridine-cytidine kinase 1 [Source:NCBI gene;Acc:103029862])

HSP 1 Score: 216.853 bits (551), Expect = 1.123e-68
Identity = 116/246 (47.15%), Postives = 155/246 (63.01%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKEEC----DCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQP 796
            +PF+IG+SGGTASGKST+  KI + L +         + ++S DSFY+ L   +K+ A  G++NFDHPDAFD   +   L  +   +   +  YD  + S+L E  I + P   VV+ EGIL FY   +RD FH+K+FVD D+D RLSRRV RD+ +  RD+E+IL  Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+L       S D  +C        GH H    ++P
Sbjct:   16 RPFLIGVSGGTASGKSTVCAKIMELLGQNKVDHRQRKVVIVSQDSFYRVLTPDQKSKALKGQYNFDHPDAFDTELMCQTLKDIVEGKVVEVPTYDFITHSRLEEK-IRVYP-ADVVLFEGILVFYTQEVRDMFHMKLFVDTDSDVRLSRRVLRDMRRG-RDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDIL-------SGD--ICKWQRGAVNGHAHGQGLKRP 249          
BLAST of Uridine-cytidine kinase vs. Ensembl Cavefish
Match: uckl1a (uridine-cytidine kinase-like 1 [Source:NCBI gene;Acc:103034925])

HSP 1 Score: 174.481 bits (441), Expect = 8.942e-52
Identity = 91/216 (42.13%), Postives = 130/216 (60.19%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSS 724
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFYK L   E+  A    +NFDHP AFDF  L   L K+ + +S  I  YD  +  +  E +  +    SV++ EGI+AF    +     +KVFVD D+D RL RR+ RD+ +  RDIE ++  Y +FVKPAFE++  PT + ADI++PRG  N+V IDLI+QH+   L  G    SS
Sbjct:   82 FVIGLCGGSASGKTTVANKIIEALDVPW---VVLLSMDSFYKVLSPEEQALAASNDYNFDHPGAFDFQLLVTTLRKLKQGKSVKIPVYDFTTHGRQKE-WKNVY-GASVIIFEGIMAFTDKELLQLLDMKVFVDTDSDIRLVRRLKRDITERGRDIEGVIKQYNKFVKPAFEQYIEPTMRLADIVVPRGGGNMVAIDLIVQHVHSQLEEGSPGLSS 292          
BLAST of Uridine-cytidine kinase vs. Ensembl Cavefish
Match: uckl1b (uridine-cytidine kinase 1 like 1 [Source:NCBI gene;Acc:103031718])

HSP 1 Score: 174.481 bits (441), Expect = 1.112e-49
Identity = 92/224 (41.07%), Postives = 135/224 (60.27%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDA 748
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFYK L + E+  A    +NFDHPDAFDF  L + L K+ + +S  I  YD  +  +  E   +I    SV++ EGI++F    +     +K+FVD D+D RL RR+ RD+ +  RDIE ++  Y +FVKPAFE++  PT + ADI++PRG  N+V IDLI+QH+   L   ER    D    + A
Sbjct:   85 FVIGLCGGSASGKTTVARKIIEALDVPW---VVLLSMDSFYKVLSKEEQELAASNDYNFDHPDAFDFVLLSHTLRKLKQGKSVKIPVYDFTTHGRQKE--WKIVYGASVIIFEGIMSFGDKELLKLLDMKIFVDTDSDIRLVRRLRRDIMERGRDIEGVIKQYNKFVKPAFEQYIEPTMRLADIVVPRGGGNMVAIDLIVQHVHSQLE--ERKLRWDMAALASA 301          
BLAST of Uridine-cytidine kinase vs. Ensembl Cavefish
Match: uckl1b (uridine-cytidine kinase 1 like 1 [Source:NCBI gene;Acc:103031718])

HSP 1 Score: 174.481 bits (441), Expect = 1.119e-49
Identity = 89/211 (42.18%), Postives = 131/211 (62.09%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGE 709
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFYK L + E+  A    +NFDHPDAFDF  L + L K+ + +S  I  YD  +  +  E   +I    SV++ EGI++F    +     +K+FVD D+D RL RR+ RD+ +  RDIE ++  Y +FVKPAFE++  PT + ADI++PRG  N+V IDLI+QH+   L   E
Sbjct:   87 FVIGLCGGSASGKTTVARKIIEALDVPW---VVLLSMDSFYKVLSKEEQELAASNDYNFDHPDAFDFVLLSHTLRKLKQGKSVKIPVYDFTTHGRQKE--WKIVYGASVIIFEGIMSFGDKELLKLLDMKIFVDTDSDIRLVRRLRRDIMERGRDIEGVIKQYNKFVKPAFEQYIEPTMRLADIVVPRGGGNMVAIDLIVQHVHSQLEERE 292          
BLAST of Uridine-cytidine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008755.1 (pep scaffold:Pmarinus_7.0:GL482390:626:16690:1 gene:ENSPMAG00000007921.1 transcript:ENSPMAT00000008755.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 4.024e-50
Identity = 89/189 (47.09%), Postives = 121/189 (64.02%), Query Frame = 2
Query:   68 PKPFIIGISGGTASGK---STLTEKIYQTL-KEECDC---NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTK 613
            P+PF+IG+SGGTASGK   ST+  KI + L + E D     + ++S DSFY+ L   +   A  G+FNFDH +AFD   +   L  +    +A +  YD  + S+  E  + + P   VV+ EGIL FY   IRD FH+K+FVD DADTRLSRRV RD+ +  RD+E++L+ Y +FVKPAFEEFCLP +
Sbjct:   25 PRPFLIGVSGGTASGKGPQSTVCAKIMELLGQHEVDQRQRQVVILSQDSFYRELSPEQSARAAKGQFNFDHREAFDNELIMRTLQDLVAGRAAQVPVYDFVTSSRTAE--LMVYP-ADVVLFEGILVFYLQEIRDMFHMKLFVDMDADTRLSRRVLRDISERGRDLEQVLSQYTKFVKPAFEEFCLPVR 210          
BLAST of Uridine-cytidine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000185.1 (pep scaffold:Pmarinus_7.0:GL479726:1599:23826:-1 gene:ENSPMAG00000000165.1 transcript:ENSPMAT00000000185.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 2.861e-49
Identity = 82/203 (40.39%), Postives = 129/203 (63.55%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHI 685
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFYK   + E+  A   ++NFDHPDAFDF  + + L K+ + +S  +  YD  + S+  E+  +     +V++ EGIL+F    +     +KVFVD D+D RL RR+ RD+ +  RDI  ++  Y +FVKPAFE++  PT + ADI++PRG +N V ++LI+QH+
Sbjct:   62 FVIGLCGGSASGKTTVANKIIEALDVPW---VALLSMDSFYKIFSKEEQEMAAKSEYNFDHPDAFDFELIISTLRKLKKGKSVKVPIYDFTTHSRRKES--KTVYGANVIIFEGILSFANKELLKLLDMKVFVDTDSDIRLVRRLRRDITERGRDIHGVIKQYNKFVKPAFEQYIEPTMQLADIVVPRGGENNVALELIVQHV 259          
BLAST of Uridine-cytidine kinase vs. Ensembl Yeast
Match: URK1 (Uridine/cytidine kinase; component of the pyrimidine ribonucleotide salvage pathway that converts uridine into UMP and cytidine into CMP; involved in the pyrimidine deoxyribonucleotide salvage pathway, converting deoxycytidine into dCMP [Source:SGD;Acc:S000005295])

HSP 1 Score: 103.99 bits (258), Expect = 3.091e-25
Identity = 62/176 (35.23%), Postives = 102/176 (57.95%), Query Frame = 2
Query:  176 VISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYN-ILD-KVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVL 697
            +IS+D+FY  L   ++  A   +++FD P+A + +  Y  IL+ K  +R +  +Y + H +  ++ +  I I    SVVV+EGI A Y   + D   +K++VD D D  L+RR++RD+    RD++  +  + +FVKP   +F  PT K AD I+P  +DN   ++LII HI+  L
Sbjct:   87 LISLDNFYNPLGPEDRARAFKNEYDFDEPNAINLDLAYKCILNLKEGKRTNIPVYSFVHHN--RVPDKNIVIY-GASVVVIEGIYALYDRRLLDLMDLKIYVDADLDVCLARRLSRDIVSRGRDLDGCIQQWEKFVKPNAVKFVKPTMKNADAIIPSMSDNATAVNLIINHIKSKL 259          
BLAST of Uridine-cytidine kinase vs. Ensembl Yeast
Match: DAS2 (Putative protein of unknown function; non-essential gene identified in a screen for mutants with increased levels of rDNA transcription; weak similarity with uridine kinases and with phosphoribokinases [Source:SGD;Acc:S000002427])

HSP 1 Score: 68.9366 bits (167), Expect = 3.599e-14
Identity = 56/236 (23.73%), Postives = 108/236 (45.76%), Query Frame = 2
Query:   47 MSSDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDC-NICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAI----IYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNV---VGIDLIIQHIQDVLNHGERTQSSDK 730
            M    +  K  +I I GG A+G   +   +  T K   +  NI VI++D    N+ E      N+  ++FD           NIL+ V  + +      + Q+D++               + +++V G  A Y   I +   +KVF+D DAD RL   + +    +   + +++  Y   ++P  +++  PT+ +AD+I+P   +N+   V +D I++ I+D  +  E   +++K
Sbjct:    1 MDRKAVEEKRIVISIGGGHATGVGAIALDLQNTFKSLYNSINIRVINLD----NMIEGNIKSYNNNDYDFD-----------NILNLVYEKHAVTSQNDMIQHDYED-------------PIDLIIVCGCYALYDKRINEISQLKVFLDSDADKRLISLIKKKNVGSNEQLAQLITEYMDHLRPEMQQYIEPTRTFADLIIPSTNENLGRAVLVDGIVKAIEDTKSQIEGNNTNNK 208          
BLAST of Uridine-cytidine kinase vs. Ensembl Yeast
Match: NRK1 (Nicotinamide riboside kinase; catalyzes the phosphorylation of nicotinamide riboside and nicotinic acid riboside in salvage pathways for NAD+ biosynthesis [Source:SGD;Acc:S000005073])

HSP 1 Score: 48.1358 bits (113), Expect = 5.550e-7
Identity = 43/175 (24.57%), Postives = 80/175 (45.71%), Query Frame = 2
Query:   47 MSSDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKF---NFDHPDAFD---FNELYNILDKVSRRESAII-----------YQYDHQSFSKLHENFIEISPD-VSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTR 517
            M+S K++    ++ +SG ++SGK+T+ +     L         +I  D FYK+ +E       D K+   N+D P+A D   F +  +++ +  +  + +I           +  D Q + +L   +  I+ D   VV+V+G + F    I  KF +K+ V    +    RR +R
Sbjct:    1 MTSKKVI----LVALSGCSSSGKTTIAK-----LTASLFTKATLIHEDDFYKHDNEV----PVDAKYNIQNWDSPEALDFKLFGKELDVIKQTGKIATKLIHNNNVDDPFTKFHIDRQVWDELKAKYDSINDDKYEVVIVDGFMIFNNTGISKKFDLKILVRAPYEVLKKRRASR 162          
BLAST of Uridine-cytidine kinase vs. Ensembl Nematostella
Match: EDO41140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S545])

HSP 1 Score: 153.68 bits (387), Expect = 2.126e-42
Identity = 84/239 (35.15%), Postives = 132/239 (55.23%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSR---------------------------RESAIIYQ---YDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVL 697
            +PF+IG+ GG+ASGK+T+  +I + L       + ++S+DSFYK L   +   A   ++NFDHPDAFD +    +L ++ R                           R++ +  Q   YD ++  +L E         +V++ EGI+AF    +RD   +KVFVD D D RL+RR+ RD+ +  R++  +L  Y +FVKPAF++   PT  +ADI++PRG +N V IDLI+ H++  L
Sbjct:   92 EPFVIGLCGGSASGKTTVANRIIEELGVPW---VSMLSLDSFYKVLSSEQHEMAARNEYNFDHPDAFDADLAAKVLKRLKRGKSVQVCIQILFIPLSVLQIVQEQIINRKAIVTLQIPIYDFKTHGRLPEKTDLYG--ANVIIFEGIMAFAYKELRDLMDMKVFVDTDPDIRLARRLKRDITERGRELPGVLQQYNKFVKPAFDQHIAPTMAFADIVVPRGGENDVAIDLIVTHVKTQL 325          
BLAST of Uridine-cytidine kinase vs. Ensembl Nematostella
Match: EDO27777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8B4])

HSP 1 Score: 120.939 bits (302), Expect = 1.930e-33
Identity = 66/150 (44.00%), Postives = 89/150 (59.33%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTL-KEECDCN---ICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRR 508
            KPFIIG++GG+ASGKS++  KI + L +E+ D     + +IS DSFY+ L E E   A  G FNFDHPDAFD  + + I+  +   E   I  YD    +       +I P   V++ EGIL  Y   IR+   +K+FVD D+DTRLSRR
Sbjct:   16 KPFIIGVAGGSASGKSSVCSKIVEQLGQEDIDSKQRRVAIISQDSFYRELSEEELTEAKRGNFNFDHPDAFDTEKTHAIIKAIQNGEVVDIPSYDFGMATTSTSPAFKIYPSTDVILFEGILTLYFKEIRELLDMKLFVDTDSDTRLSRR 165          
BLAST of Uridine-cytidine kinase vs. Ensembl Medaka
Match: uck2b (uridine-cytidine kinase 2-B [Source:NCBI gene;Acc:101155299])

HSP 1 Score: 227.639 bits (579), Expect = 3.308e-73
Identity = 116/218 (53.21%), Postives = 153/218 (70.18%), Query Frame = 2
Query:   65 VPKPFIIGISGGTASGKSTLTEKIYQTLKE----ECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHG 706
            V +PF+IG+SGGTASGKS++ EKI + L +         + ++S DSFYK L   +K  A  G++NFDHPDAFD   + + L ++ + E+  I  YD  + S+  E FI + P   VV+ EGIL FY  +IRD F +K+FVD D DTRLSRRV RD  + KR++E++L  Y  FVKPAFEEFCLPTKKYAD+I+PRGADN+V I+LI+QHIQD+LN G
Sbjct:   19 VRQPFLIGVSGGTASGKSSVCEKIMELLGQNKIDHHQRQVVILSQDSFYKVLTPEQKAKALKGQYNFDHPDAFDSELIMHTLRQILQGETVQIPVYDFVTNSR-KEEFITVYP-ADVVLFEGILMFYSQDIRDLFQMKLFVDTDPDTRLSRRVLRDTTERKRELEQVLTQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGG 234          
BLAST of Uridine-cytidine kinase vs. Ensembl Medaka
Match: uck1 (uridine-cytidine kinase 1 [Source:NCBI gene;Acc:101165742])

HSP 1 Score: 218.779 bits (556), Expect = 3.562e-69
Identity = 126/271 (46.49%), Postives = 165/271 (60.89%), Query Frame = 2
Query:   71 KPFIIGISGGTASGKSTLTEKIYQTLKE----ECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLN-------------HGERTQSSDKRVCSDASFVTQGHHHAWRT-RQPSDPAILATRPH 829
            +PF+IG+SGGTASGKST+  KI + L +         + +IS DSFYK L   +K  A  G++NFDHP+AFD   +   L  +   +   +  YD  S S+L E  I + P   VV+ EGIL FYP  +R+ FH+K+FVD D+D RLSRRV RD+ +  RD+E+IL+ Y  FVKPAFEEFCLPTKKYAD+I+PRG DN+V I+LI+QHIQD+LN             HG     S KR  S+ + +  G     R   +PS      TRPH
Sbjct:   39 RPFLIGVSGGTASGKSTVCAKIMELLGQNKVDHRQRKVAIISQDSFYKVLTPEQKAKALKGQYNFDHPEAFDNELMCKTLKDIVEGKVVDVPTYDFVSHSRLEER-ITVYP-ADVVLFEGILVFYPLQVREMFHMKLFVDTDSDVRLSRRVLRDMSRG-RDLEQILSQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGEICKWQRGSINGHGR----SFKRTISEQTDLQNGASSTKRVLLEPS------TRPH 296          
BLAST of Uridine-cytidine kinase vs. Ensembl Medaka
Match: si:ch211-243j20.2 (uridine-cytidine kinase-like 1 [Source:NCBI gene;Acc:101167009])

HSP 1 Score: 174.096 bits (440), Expect = 3.421e-51
Identity = 95/240 (39.58%), Postives = 142/240 (59.17%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDA---SFVTQGHHHAWRT 787
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFY+ L++ E+  A   ++NFDHPDAFDF  L ++L K+ + +S  +  YD  S  +  E   +     +VV+ EGILAF    +     +KVFVD D+D RL RR+ RD+ Q  RD+  I+  Y +FVKPAFE++  PT + ADI++PRG +N V +DLI+QH+     H +  +   + V +D          HHH  RT
Sbjct:   99 FVIGLCGGSASGKTTVANKIIEALDVPW---VVLLSMDSFYRVLNKEEQELAAKNEYNFDHPDAFDFELLISVLRKLKKGKSVKVPVYDFTSHCRRKE--WKTVYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLIRRLKRDISQRGRDVSGIIKQYNKFVKPAFEQYIEPTVQVADIVVPRGGENFVALDLIVQHV-----HSQLEKVRGRCVSADGDGPPGPRHAHHHQVRT 328          
BLAST of Uridine-cytidine kinase vs. Ensembl Medaka
Match: si:ch211-243j20.2 (uridine-cytidine kinase-like 1 [Source:NCBI gene;Acc:101167009])

HSP 1 Score: 174.481 bits (441), Expect = 9.626e-50
Identity = 91/216 (42.13%), Postives = 134/216 (62.04%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSS 724
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFY+ L++ E+  A   ++NFDHPDAFDF  L ++L K+ + +S  +  YD  S  +  E   +     +VV+ EGILAF    +     +KVFVD D+D RL RR+ RD+ Q  RD+  I+  Y +FVKPAFE++  PT + ADI++PRG +N V +DLI+QH+   L   E T  S
Sbjct:  100 FVIGLCGGSASGKTTVANKIIEALDVPW---VVLLSMDSFYRVLNKEEQELAAKNEYNFDHPDAFDFELLISVLRKLKKGKSVKVPVYDFTSHCRRKE--WKTVYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLIRRLKRDISQRGRDVSGIIKQYNKFVKPAFEQYIEPTVQVADIVVPRGGENFVALDLIVQHVHSQLEKREITVRS 310          
BLAST of Uridine-cytidine kinase vs. Ensembl Medaka
Match: si:ch211-243j20.2 (uridine-cytidine kinase-like 1 [Source:NCBI gene;Acc:101167009])

HSP 1 Score: 173.711 bits (439), Expect = 2.559e-49
Identity = 91/232 (39.22%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   77 FIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHH 772
            F+IG+ GG+ASGK+T+  KI + L       + ++S+DSFY+ L++ E+  A   ++NFDHPDAFDF  L ++L K+ + +S  +  YD  S  +  E   +     +VV+ EGILAF    +     +KVFVD D+D RL RR+ RD+ Q  RD+  I+  Y +FVKPAFE++  PT + ADI++PRG +N V +DLI+QH+         +Q   +++  D S +   H 
Sbjct:  100 FVIGLCGGSASGKTTVANKIIEALDVPW---VVLLSMDSFYRVLNKEEQELAAKNEYNFDHPDAFDFELLISVLRKLKKGKSVKVPVYDFTSHCRRKE--WKTVYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLIRRLKRDISQRGRDVSGIIKQYNKFVKPAFEQYIEPTVQVADIVVPRGGENFVALDLIVQHVH--------SQLEKRKLRWDISALASAHQ 318          
BLAST of Uridine-cytidine kinase vs. Planmine SMEST
Match: SMESG000030126.1 (SMESG000030126.1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 261/261 (100.00%), Postives = 261/261 (100.00%), Query Frame = 2
Query:   47 MSSDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 829
            MSSDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH
Sbjct:    1 MSSDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQPSDPAILATRPH 261          
BLAST of Uridine-cytidine kinase vs. Planmine SMEST
Match: SMESG000070028.1 (SMESG000070028.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.199e-43
Identity = 81/216 (37.50%), Postives = 131/216 (60.65%), Query Frame = 2
Query:   50 SSDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTRLSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGADNVVGIDLIIQHIQDVL 697
            ++D  + +PF+IGI GG+ASGK+T+   I + L       +C+   DSFYK L+  EK  A    +NFDHP AFD + +   L ++ + +   I  YD  + S++ +   +     +V++ EGIL+F    +R+   +KVFVD DAD RL+RR+ RD+++  R +  I+  Y +FVK ++++F  P  +YADII+PRG  N V +++I+QH+   L
Sbjct:   53 TADGQLKEPFVIGICGGSASGKTTVATTITENLNIPWVSLVCM---DSFYKVLNSEEKLEAAKANYNFDHPSAFDIDLIVETLIQLKKGKKVEIPIYDFTTHSRISQT--KTIYGANVIIFEGILSFSNQKLRELMDLKVFVDTDADVRLARRMLRDMKERNRSLSSIMDQYNRFVKSSYDQFIAPCMEYADIIIPRGGQNDVAVNVIVQHVTKQL 263          
BLAST of Uridine-cytidine kinase vs. Planmine SMEST
Match: SMESG000039190.1 (SMESG000039190.1)

HSP 1 Score: 45.8246 bits (107), Expect = 3.355e-6
Identity = 34/116 (29.31%), Postives = 60/116 (51.72%), Query Frame = 2
Query:   83 IGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSFYKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDHQSFSKLHENFIEISPDVSVVVVEGILAF 430
            IGISGG+ SGK+T+++ + Q L++  +  + V++VD FY      + N   D K N          E+Y+I   ++              ++KL    I+IS + ++++VEGI+ F
Sbjct:   14 IGISGGSCSGKTTISKLLQQELQKFENIYVYVLNVDEFY--WVRGDCNHQKDEKLNC---------EIYDIPSSIN--------------WNKLMRKIIQISQNYNLIIVEGIMIF 104          
The following BLAST results are available for this feature:
BLAST of Uridine-cytidine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UCK21.221e-7448.64uridine-cytidine kinase 2 [Source:HGNC Symbol;Acc:... [more]
UCK11.276e-7045.93uridine-cytidine kinase 1 [Source:HGNC Symbol;Acc:... [more]
UCK21.027e-6346.69uridine-cytidine kinase 2 [Source:HGNC Symbol;Acc:... [more]
UCK19.338e-6142.96uridine-cytidine kinase 1 [Source:HGNC Symbol;Acc:... [more]
UCK15.983e-6042.55uridine-cytidine kinase 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F19B6.11.748e-4941.78Uridine kinase [Source:UniProtKB/TrEMBL;Acc:D3YT3... [more]
F19B6.12.900e-4941.78Uridine kinase [Source:UniProtKB/TrEMBL;Acc:D3YT3... [more]
F19B6.13.332e-4941.78Uridine kinase [Source:UniProtKB/TrEMBL;Acc:D3YT3... [more]
B0001.41.474e-4838.56Probable uridine-cytidine kinase [Source:UniProtK... [more]
B0001.46.611e-4840.48Probable uridine-cytidine kinase [Source:UniProtK... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uck1.941e-7051.34gene:FBgn0263398 transcript:FBtr0299530[more]
Uck5.355e-6948.93gene:FBgn0263398 transcript:FBtr0309097[more]
Uck5.355e-6948.93gene:FBgn0263398 transcript:FBtr0309095[more]
Uck5.355e-6948.93gene:FBgn0263398 transcript:FBtr0309096[more]
Uck5.355e-6948.93gene:FBgn0263398 transcript:FBtr0084602[more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uck2b7.208e-7146.72uridine-cytidine kinase 2b [Source:NCBI gene;Acc:3... [more]
uck11.191e-6946.69uridine-cytidine kinase 2a [Source:NCBI gene;Acc:1... [more]
uck2a1.191e-6946.69uridine-cytidine kinase 2a [Source:NCBI gene;Acc:1... [more]
uck12.947e-6747.50uridine-cytidine kinase 1 [Source:NCBI gene;Acc:44... [more]
si:ch211-243j20.22.031e-4841.67si:ch211-243j20.2 [Source:ZFIN;Acc:ZDB-GENE-041014... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syngr16.814e-7649.23synaptogyrin 1 [Source:Xenbase;Acc:XB-GENE-494921][more]
UCK14.117e-6852.34uridine-cytidine kinase 1 [Source:NCBI gene;Acc:10... [more]
UCK14.686e-6852.34uridine-cytidine kinase 1 [Source:NCBI gene;Acc:10... [more]
UCK12.293e-5949.07uridine-cytidine kinase 1 [Source:NCBI gene;Acc:10... [more]
UCK14.748e-5949.75uridine-cytidine kinase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uck22.773e-7548.85uridine-cytidine kinase 2 [Source:MGI Symbol;Acc:M... [more]
Uck11.325e-7347.89uridine-cytidine kinase 1 [Source:MGI Symbol;Acc:M... [more]
Uck22.409e-6446.94uridine-cytidine kinase 2 [Source:MGI Symbol;Acc:M... [more]
Uck21.142e-5148.44uridine-cytidine kinase 2 [Source:MGI Symbol;Acc:M... [more]
Uckl11.380e-4840.00uridine-cytidine kinase 1-like 1 [Source:MGI Symbo... [more]
back to top
BLAST of Uridine-cytidine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B1H116|UCK2_XENTR3.610e-7549.23Uridine-cytidine kinase 2 OS=Xenopus tropicalis OX... [more]
sp|Q9QYG8|UCK2_RAT1.939e-7448.85Uridine-cytidine kinase 2 OS=Rattus norvegicus OX=... [more]
sp|Q99PM9|UCK2_MOUSE1.939e-7448.85Uridine-cytidine kinase 2 OS=Mus musculus OX=10090... [more]
sp|Q9BZX2|UCK2_HUMAN5.862e-7448.64Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 ... [more]
sp|P52623|UCK1_MOUSE9.864e-7347.89Uridine-cytidine kinase 1 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Uridine-cytidine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U6DTN85.202e-7549.62Uridine-cytidine kinase (Fragment) OS=Neovison vis... [more]
M3XXP15.602e-7549.62Uridine-cytidine kinase OS=Mustela putorius furo O... [more]
A0A2U3WI008.935e-7549.23Uridine-cytidine kinase OS=Odobenus rosmarus diver... [more]
A0A2Y9JTP48.935e-7549.23Uridine-cytidine kinase OS=Enhydra lutris kenyoni ... [more]
A0A485MLZ11.991e-7348.85Uridine-cytidine kinase OS=Lynx pardinus OX=191816... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uck2b6.368e-7051.83uridine-cytidine kinase 2b [Source:NCBI gene;Acc:3... [more]
uck11.123e-6847.15uridine-cytidine kinase 1 [Source:NCBI gene;Acc:10... [more]
uckl1a8.942e-5242.13uridine-cytidine kinase-like 1 [Source:NCBI gene;A... [more]
uckl1b1.112e-4941.07uridine-cytidine kinase 1 like 1 [Source:NCBI gene... [more]
uckl1b1.119e-4942.18uridine-cytidine kinase 1 like 1 [Source:NCBI gene... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008755.14.024e-5047.09pep scaffold:Pmarinus_7.0:GL482390:626:16690:1 gen... [more]
ENSPMAT00000000185.12.861e-4940.39pep scaffold:Pmarinus_7.0:GL479726:1599:23826:-1 g... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
URK13.091e-2535.23Uridine/cytidine kinase; component of the pyrimidi... [more]
DAS23.599e-1423.73Putative protein of unknown function; non-essentia... [more]
NRK15.550e-724.57Nicotinamide riboside kinase; catalyzes the phosph... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO411402.126e-4235.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277771.930e-3344.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uck2b3.308e-7353.21uridine-cytidine kinase 2-B [Source:NCBI gene;Acc:... [more]
uck13.562e-6946.49uridine-cytidine kinase 1 [Source:NCBI gene;Acc:10... [more]
si:ch211-243j20.23.421e-5139.58uridine-cytidine kinase-like 1 [Source:NCBI gene;A... [more]
si:ch211-243j20.29.626e-5042.13uridine-cytidine kinase-like 1 [Source:NCBI gene;A... [more]
si:ch211-243j20.22.559e-4939.22uridine-cytidine kinase-like 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Uridine-cytidine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000030126.10.000e+0100.00SMESG000030126.1[more]
SMESG000070028.11.199e-4337.50SMESG000070028.1[more]
SMESG000039190.13.355e-629.31SMESG000039190.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003700 ID=SMED30003700|Name=Uridine-cytidine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=994bp
CTTATGATCATTGTTTAAATATTTCAAATAGTATATTTATATTTAAATGT
CTTCGGATAAAATTGTTCCAAAACCATTTATAATTGGTATTTCAGGAGGA
ACTGCATCTGGAAAATCTACACTTACTGAAAAAATTTACCAAACATTAAA
AGAGGAATGCGATTGCAATATTTGTGTCATCTCGGTTGATTCTTTTTATA
AAAATCTAGATGAAACCGAAAAGAATTTCGCGAACGATGGTAAATTTAAT
TTTGATCATCCAGACGCATTCGATTTTAACGAGTTATACAATATATTAGA
CAAAGTTTCTCGTCGAGAAAGTGCGATAATATATCAATACGATCATCAGT
CATTTTCAAAATTACATGAGAATTTTATTGAGATTTCCCCAGATGTTAGC
GTGGTCGTTGTTGAAGGAATTTTAGCTTTCTATCCAGCAAATATTAGAGA
TAAATTTCATGTGAAAGTTTTTGTTGATTGTGACGCAGACACGCGTCTAT
CTAGGAGGGTTACGAGAGATGTCGAACAAAACAAGCGAGATATCGAAAAG
ATATTGGCGAACTATTTTCAATTCGTCAAGCCGGCTTTTGAAGAATTTTG
TTTACCGACTAAAAAATACGCAGATATAATCTTACCGAGAGGTGCGGATA
ATGTTGTCGGGATCGATCTCATAATCCAGCACATACAGGACGTGTTGAAC
CACGGGGAACGCACTCAGAGCTCCGATAAGCGGGTGTGCTCGGATGCAAG
CTTTGTCACCCAAGGACACCACCACGCCTGGCGTACCAGGCAGCCTTCTG
ATCCCGCAATCCTCGCTACACGGCCTCACTAATAAATAATCGAAATTTCA
TGTCACATCTTTGATTTCGACCTTTCTAGAATCCATTCATAAAGCTATAT
TTTCAATAATTATCTATTTTCAGTGTTGCTCGATGAGATTGGCTGTTTCC
ATGCCGCCTCCTCCGATTATATTATTATTATTATTATTGATGAT
back to top

protein sequence of SMED30003700-orf-1

>SMED30003700-orf-1 ID=SMED30003700-orf-1|Name=SMED30003700-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MSSDKIVPKPFIIGISGGTASGKSTLTEKIYQTLKEECDCNICVISVDSF
YKNLDETEKNFANDGKFNFDHPDAFDFNELYNILDKVSRRESAIIYQYDH
QSFSKLHENFIEISPDVSVVVVEGILAFYPANIRDKFHVKVFVDCDADTR
LSRRVTRDVEQNKRDIEKILANYFQFVKPAFEEFCLPTKKYADIILPRGA
DNVVGIDLIIQHIQDVLNHGERTQSSDKRVCSDASFVTQGHHHAWRTRQP
SDPAILATRPH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR029925UCK-2
IPR000764Uridine_kinase-like
IPR027417P-loop_NTPase
IPR006083PRK/URK
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006238CMP salvage
GO:0016310phosphorylation
GO:0044206UMP salvage
GO:0044211CTP salvage
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016301kinase activity
GO:0000166nucleotide binding
GO:0004849uridine kinase activity
GO:0016740transferase activity
GO:0019206nucleoside kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00988URIDINKINASEcoord: 10..27
score: 50.62
coord: 184..197
score: 53.17
coord: 148..158
score: 55.56
coord: 162..173
score: 26.85
coord: 43..54
score: 42.59
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 9..228
e-value: 4.6E-65
score: 221.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 241..261
NoneNo IPR availablePANTHERPTHR10285URIDINE KINASEcoord: 5..221
IPR006083Phosphoribulokinase/uridine kinasePFAMPF00485PRKcoord: 12..203
e-value: 2.6E-37
score: 128.5
IPR029925Uridine-cytidine kinase 2PANTHERPTHR10285:SF147URIDINE-CYTIDINE KINASE 2-Bcoord: 5..221
IPR000764Uridine kinase-likeCDDcd02023UMPKcoord: 12..215
e-value: 6.64394E-75
score: 224.356
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..209