C-type lectin domain-containing protein

Overview
NameC-type lectin domain-containing protein
Smed IDSMED30003676
Length (bp)569
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C-type lectin domain-containing protein (SMED30003676) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C-type lectin domain-containing protein (SMED30003676) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003676

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30003676h1SMcG0000695 SmedASXL_009670SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30003676h1SMcG0000695 SmedASXL_009670SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30003676h1SMcG0000695 dd_Smed_v4_10_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003676h1SMcG0000695 dd_Smed_v4_10_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30003676h1SMcG0000695 dd_Smed_v6_10_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30003676h1SMcG0000695 dd_Smed_v4_10_1_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: SFTPD (surfactant protein D [Source:HGNC Symbol;Acc:HGNC:10803])

HSP 1 Score: 52.373 bits (124), Expect = 1.088e-7
Identity = 41/141 (29.08%), Postives = 60/141 (42.55%), Query Frame = 2
Query:   92 HLIATLAI---VFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVK----VEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPN-NPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            HL A  +    V +  N + + E   K       +  A  LC +   +L       E+    Q+V     KN      M   D K  GK+ Y  G  + Y+NW  GEPN + G E+C+E   +  G WN+  CG +  V+C
Sbjct:  240 HLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVA---KNEAAFLSM--TDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVE--IFTNGKWNDRACGEKRLVVC 373          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: COLEC10 (collectin subfamily member 10 [Source:HGNC Symbol;Acc:HGNC:2220])

HSP 1 Score: 50.447 bits (119), Expect = 3.212e-7
Identity = 31/132 (23.48%), Postives = 66/132 (50.00%), Query Frame = 2
Query:  110 AIVFILQNCEGLTESQLK---IIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMT-YTNWHQGEPNNP-GVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ++ F+     G+ E++ K   I+ ++ NY  +   C      L   +D+  + ++ ++  K+   R ++  ND +  G++++     +  Y+NW++GEP++P G E+C+E      G WN+  C      +C
Sbjct:  141 SMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPSDPYGHEDCVE--MLSSGRWNDTECHLTMYFVC 270          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: MBL2 (mannose binding lectin 2 [Source:HGNC Symbol;Acc:HGNC:6922])

HSP 1 Score: 48.9062 bits (115), Expect = 1.024e-6
Identity = 27/105 (25.71%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  179 VNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGV-ENCLEGARYPKGLWNNIVCGRENAVIC 490
            + +E    LC++    +    +   +  + N   +      ++   D+K  G++V   G ++TYTNW++GEPNN G  E+C+       G WN++ C   +  +C
Sbjct:  146 MTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE----EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCV--LLLKNGQWNDVPCSTSHLAVC 244          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: MRC1 (mannose receptor C-type 1 [Source:HGNC Symbol;Acc:HGNC:7228])

HSP 1 Score: 49.6766 bits (117), Expect = 1.062e-6
Identity = 32/119 (26.89%), Postives = 53/119 (44.54%), Query Frame = 2
Query:  155 QLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGV-ENCLEGARYPKGLWNNIVCGRENAVICYKDDSD 508
            Q     +K   + A   C      LV ++ ++  + ++ + N+N+    +  G       K+ +  G K+ Y +W  GEPN     ENC+       G WN+I CG  NA IC + +S 
Sbjct:  811 QYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSS 928          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: SFTPA2 (surfactant protein A2 [Source:HGNC Symbol;Acc:HGNC:10799])

HSP 1 Score: 46.595 bits (109), Expect = 7.213e-6
Identity = 27/106 (25.47%), Postives = 46/106 (43.40%), Query Frame = 2
Query:  173 KKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            + + ++     C     R+    +   ++ + +F  K N   Y +   +    G + Y+ G  + YTNW++GEP   G E C+E   Y  G WN+  C      IC
Sbjct:  144 QSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAY-VGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVE--MYTDGQWNDRNCLYSRLTIC 246          
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072661)

HSP 1 Score: 49.2914 bits (116), Expect = 2.635e-7
Identity = 37/115 (32.17%), Postives = 52/115 (45.22%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGR--YWMDGNDKKETGKWVY-NRGCKMTYTNWHQGEPNNPGV-----ENCLE-GARYPKGL-WNNIVCGRENAVIC 490
            K N+  AT  C    M L  +  +  +  +        LG   +W+ G D  + G + +   G  +T+TNW+ GEPNN        ENCLE   R  KGL WN+  C  E   +C
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 183          
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072660)

HSP 1 Score: 49.2914 bits (116), Expect = 2.635e-7
Identity = 37/115 (32.17%), Postives = 52/115 (45.22%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGR--YWMDGNDKKETGKWVY-NRGCKMTYTNWHQGEPNNPGV-----ENCLE-GARYPKGL-WNNIVCGRENAVIC 490
            K N+  AT  C    M L  +  +  +  +        LG   +W+ G D  + G + +   G  +T+TNW+ GEPNN        ENCLE   R  KGL WN+  C  E   +C
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 183          
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072659)

HSP 1 Score: 48.9062 bits (115), Expect = 6.785e-7
Identity = 37/115 (32.17%), Postives = 52/115 (45.22%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGR--YWMDGNDKKETGKWVY-NRGCKMTYTNWHQGEPNNPGV-----ENCLEG-ARYPKGL-WNNIVCGRENAVIC 490
            K N+  AT  C    M L  +  +  +  +        LG   +W+ G D  + G + +   G  +T+TNW+ GEPNN        ENCLE   R  KGL WN+  C  E   +C
Sbjct:  257 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 371          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-241l7.6 (si:dkey-241l7.6 [Source:ZFIN;Acc:ZDB-GENE-041014-235])

HSP 1 Score: 58.9214 bits (141), Expect = 5.064e-11
Identity = 33/113 (29.20%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  158 LKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYK 496
             +   + VN+ TA   C      L  V D++ +  +      +   R W+ G+D ++ G+W+++ G   +YTNW  GEP++ G E+CLE        WNN  C      +C K
Sbjct:   38 FRFFSRSVNWVTAERNCQSLGGNLASVHDEDENDFLLGLVPVST--RCWIGGHDGEQDGQWLWSDGSVYSYTNWCSGEPSS-GSEHCLEINWTSDHCWNNQGCSTRMGYLCAK 147          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-241l7.6 (si:dkey-241l7.6 [Source:ZFIN;Acc:ZDB-GENE-041014-235])

HSP 1 Score: 58.9214 bits (141), Expect = 5.064e-11
Identity = 33/113 (29.20%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  158 LKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYK 496
             +   + VN+ TA   C      L  V D++ +  +      +   R W+ G+D ++ G+W+++ G   +YTNW  GEP++ G E+CLE        WNN  C      +C K
Sbjct:   38 FRFFSRSVNWVTAERNCQSLGGNLASVHDEDENDFLLGLVPVST--RCWIGGHDGEQDGQWLWSDGSVYSYTNWCSGEPSS-GSEHCLEINWTSDHCWNNQGCSTRMGYLCAK 147          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: zgc:172053 (zgc:172053 [Source:ZFIN;Acc:ZDB-GENE-080219-25])

HSP 1 Score: 57.3806 bits (137), Expect = 1.860e-10
Identity = 39/147 (26.53%), Postives = 62/147 (42.18%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQ------------LKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ML  +  L+++F L N  G+   Q             + I + V + TA   C      L  V  K  +  + +    ++  R W+ G+D +  G+W++  G  + Y NW   EPNN  VENC+E        WN+  C      +C
Sbjct:    3 MLRNLLLLSVMFSLGN-AGIGTCQCPYGWSKFGVKCYRFISQSVTWATAEKNCQSLGANLASVHSKAENDFLLSLIPSSST-RCWIGGHDGENEGRWLWTDGSVIDYNNWCATEPNNQNVENCMEMQWTVNRCWNDQACSTSMGYMC 147          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: zgc:172053 (zgc:172053 [Source:ZFIN;Acc:ZDB-GENE-080219-25])

HSP 1 Score: 57.3806 bits (137), Expect = 1.860e-10
Identity = 39/147 (26.53%), Postives = 62/147 (42.18%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQ------------LKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ML  +  L+++F L N  G+   Q             + I + V + TA   C      L  V  K  +  + +    ++  R W+ G+D +  G+W++  G  + Y NW   EPNN  VENC+E        WN+  C      +C
Sbjct:    3 MLRNLLLLSVMFSLGN-AGIGTCQCPYGWSKFGVKCYRFISQSVTWATAEKNCQSLGANLASVHSKAENDFLLSLIPSSST-RCWIGGHDGENEGRWLWTDGSVIDYNNWCATEPNNQNVENCMEMQWTVNRCWNDQACSTSMGYMC 147          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-125e6.5 (si:ch211-125e6.5 [Source:ZFIN;Acc:ZDB-GENE-070912-39])

HSP 1 Score: 57.3806 bits (137), Expect = 2.020e-10
Identity = 39/147 (26.53%), Postives = 61/147 (41.50%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQ------------LKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ML  +  L+++F L N  G+   Q             + I + V + TA   C      L  V  K     + +    ++  R W+ G+D +  G+W++  G  + Y NW   EPNN  VENC+E        WN+  C      +C
Sbjct:    3 MLRNLLLLSVMFSLGN-AGIGTCQCPYGWSKFGVKCYRFISQSVTWATAEKNCQSLGANLASVHSKAEHDFLLSLIPSSST-RCWIGGHDGENEGQWLWTDGSAIDYNNWCATEPNNQNVENCMEMQWTVNRCWNDQACSTSMGYMC 147          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: pnpla8 (patatin like phospholipase domain containing 8 [Source:Xenbase;Acc:XB-GENE-495321])

HSP 1 Score: 53.9138 bits (128), Expect = 1.970e-8
Identity = 38/140 (27.14%), Postives = 70/140 (50.00%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLK---IIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKM-TYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            + HL ++L   F+     G+ E+  K   I+ ++ NY  A   C      L   +D+ T+ ++ ++ +K  L R ++  ND ++  ++VY     + TY++W  GEPN+  G E+C+E      G WN++ C      +C
Sbjct:  115 VAHLKSSLK--FVKNVIAGIRETDEKYYYIVREERNYRDALTQCRIRGGTLAMPKDQATNSLIADYISKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGSGYEDCVE--MLSTGHWNDVDCSLTIYFVC 250          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000001317.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:125388439:125508996:-1 gene:ENSXETG00000000905.1 transcript:ENSXETT00000001317.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.075e-8
Identity = 39/141 (27.66%), Postives = 65/141 (46.10%), Query Frame = 2
Query:   77 NQIMLHLIATLAIVFILQNCE--------GLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGC--KMTYTNWHQGEPNNPGV-ENCLEGARYPKGLWNNIVC 466
            N I+L    T+  +++  + E           +S   I  KK N++ A   C++E   LV V +   +Q +   +  +NL R+W+  +D +E G W +  G     +Y  W  GEPN+ G  E+C        G WN++ C
Sbjct:   16 NSILLAGQITIYTLYLFPHSEEACDSAWIQFEDSCYYITTKKTNWQKARSFCVQEGGDLVVV-NSEKEQFLKEKSGVSNLKRFWIGLSDIEEEGTWTWVDGTDYSTSYQFWRAGEPNDAGGNEDC--AHIRTNGEWNDVHC 153          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: pnpla8 (patatin like phospholipase domain containing 8 [Source:Xenbase;Acc:XB-GENE-495321])

HSP 1 Score: 53.9138 bits (128), Expect = 2.381e-8
Identity = 38/140 (27.14%), Postives = 70/140 (50.00%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLK---IIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKM-TYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            + HL ++L   F+     G+ E+  K   I+ ++ NY  A   C      L   +D+ T+ ++ ++ +K  L R ++  ND ++  ++VY     + TY++W  GEPN+  G E+C+E      G WN++ C      +C
Sbjct:  133 VAHLKSSLK--FVKNVIAGIRETDEKYYYIVREERNYRDALTQCRIRGGTLAMPKDQATNSLIADYISKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGSGYEDCVE--MLSTGHWNDVDCSLTIYFVC 268          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: ptpn11b (protein tyrosine phosphatase, non-receptor type 11, b [Source:Xenbase;Acc:XB-GENE-6054495])

HSP 1 Score: 53.5286 bits (127), Expect = 2.863e-8
Identity = 41/141 (29.08%), Postives = 66/141 (46.81%), Query Frame = 2
Query:   98 IATLA--IVFILQNCEGLTESQLKI---IPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVY-NRGCKMTYTNWHQGEPNNP-GVENCLEGARYPKGLWNNIVCGRENAVICYKD 499
            +A LA  + F+     G+ E+  KI   + ++  Y  A   C      L   +D+ T+ ++ ++ N+  L R ++  ND +  G +VY +R    T+  W QGEPNN    E+C E      G WN++ C      IC  D
Sbjct:  129 VAQLATEVKFVKNVVAGVRETDTKIYLLVKEEKKYIDAQDYCQGRGGTLSMPKDETTNSLIASYINQAGLSRVFIGINDLEREGHFVYSDRSPMQTFNKWRQGEPNNAYDEEDCAE--MVSSGGWNDVSCLITMYFICEFD 267          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: FREM1 (FRAS1 related extracellular matrix 1 [Source:NCBI gene;Acc:100488523])

HSP 1 Score: 52.373 bits (124), Expect = 1.100e-7
Identity = 32/112 (28.57%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  173 KKVNYETATCLCIEENM-RLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGV-ENCLEGARYPKGLWNNIVC--GRENAVICYK 496
            +K  + TA   C E++   LV V  K   + ++NF+ + +   +W+  ND+   G W +++G  +T+TNW +G P +    +NC+   +  +G W    C  G+ +  IC K
Sbjct: 1880 QKATWITAARACREQHFATLVDVFSKEQMEWLWNFSGRKS---FWIGLNDRVRNGNWEWSKGEMVTFTNWKRGSPRSSHKGKNCVLAQK--RGKWQAKDCKKGKGHYYICSK 1986          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Sftpd (surfactant associated protein D [Source:MGI Symbol;Acc:MGI:109515])

HSP 1 Score: 53.9138 bits (128), Expect = 1.753e-8
Identity = 31/103 (30.10%), Postives = 47/103 (45.63%), Query Frame = 2
Query:  185 YETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEP-NNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            +E A  +C +   +L        +  +      +N   + +   D    GK+ Y  G  + Y+NW  GEP NN G ENC+E   +  G WN+  CG +  VIC
Sbjct:  273 FEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAF-LSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVE--IFTNGQWNDKACGEQRLVIC 372          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Colec10 (collectin sub-family member 10 [Source:MGI Symbol;Acc:MGI:3606482])

HSP 1 Score: 48.1358 bits (113), Expect = 1.539e-6
Identity = 32/132 (24.24%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  110 AIVFILQNCEGLTESQLK---IIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMT-YTNWHQGEPNNP-GVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ++ FI     G+ E++ K   I+ ++ NY  +   C      L   +D+  + ++ ++  K+   R ++  ND +  G++V+     +  Y+NW + EP++P G E+C+E      G WN+  C      +C
Sbjct:  141 SMKFIKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVE--MLSSGRWNDTECHLTMYFVC 270          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Cd209f (CD209f antigen [Source:MGI Symbol;Acc:MGI:1916392])

HSP 1 Score: 47.7506 bits (112), Expect = 1.965e-6
Identity = 29/103 (28.16%), Postives = 49/103 (47.57%), Query Frame = 2
Query:  182 NYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ++ET+   C +    LV V +  ++Q    + N     R W+  +D    G W +  G  + ++ W +GEPNN G E+C+E        WN+  C  +N  +C
Sbjct:  147 SWETSASSCEDLGAHLVIV-NSVSEQRFMKYWNVRKNQRSWIGLSDHIHEGSWQWVDGSALKFSFWKEGEPNNDGDEDCVE---LFMDDWNDNKCTEQNFWVC 245          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Sftpa1 (surfactant associated protein A1 [Source:MGI Symbol;Acc:MGI:109518])

HSP 1 Score: 47.7506 bits (112), Expect = 2.018e-6
Identity = 30/137 (21.90%), Postives = 59/137 (43.07%), Query Frame = 2
Query:   80 QIMLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            +I   ++ T+ ++ +  +   + +       + VN++T   +C      +    +   ++ + +   K N   Y +   + +  G + Y  G  + YTNW+ GEP   G E C+E   Y  G WN+  C +    IC
Sbjct:  113 EIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIREMCTRAGGHIAAPRNPEENEAIASITKKYNTYPY-LGVIEGQTPGDFHYLDGASVNYTNWYPGEPRGRGKEKCVE--MYTDGKWNDKGCLQYRLAIC 246          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Sftpa1 (surfactant associated protein A1 [Source:MGI Symbol;Acc:MGI:109518])

HSP 1 Score: 47.7506 bits (112), Expect = 2.018e-6
Identity = 30/137 (21.90%), Postives = 59/137 (43.07%), Query Frame = 2
Query:   80 QIMLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            +I   ++ T+ ++ +  +   + +       + VN++T   +C      +    +   ++ + +   K N   Y +   + +  G + Y  G  + YTNW+ GEP   G E C+E   Y  G WN+  C +    IC
Sbjct:  113 EIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIREMCTRAGGHIAAPRNPEENEAIASITKKYNTYPY-LGVIEGQTPGDFHYLDGASVNYTNWYPGEPRGRGKEKCVE--MYTDGKWNDKGCLQYRLAIC 246          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|P42916|CL43_BOVIN (Collectin-43 OS=Bos taurus OX=9913 GN=CL43 PE=1 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 1.345e-10
Identity = 42/141 (29.79%), Postives = 60/141 (42.55%), Query Frame = 2
Query:   80 QIMLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN----PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            Q + +++       +  + + + E   K      +Y  A  LC E   +L        ++ V       N   Y +  ND  + GK+ Y  G  + Y+NW  GEPNN     G ENCLE   Y  G WN+I C  E  VIC
Sbjct:  182 QRLQNIVTQYRKAVLFPDGQAVGEKIFKTAGAVKSYSDAEQLCREAKGQLASPRSSAENEAVTQLVRAKNKHAY-LSMNDISKEGKFTYPTGGSLDYSNWAPGEPNNRAKDEGPENCLE--IYSDGNWNDIECREERLVIC 319          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|P82596|PLC_HALLA (Perlucin OS=Haliotis laevigata OX=36097 PE=1 SV=3)

HSP 1 Score: 58.9214 bits (141), Expect = 5.395e-10
Identity = 35/113 (30.97%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGR---YWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNP-GVENCLEGAR-YPKGLWNNIVCGRENAVICYKD 499
            K ++  A   C      L  + +K+ D  +  +A +  LG    YW+  +D    G+W++    +M YTNW  G+P+N  G+E+CLE  R     LWN+  C + +  IC K+
Sbjct:   20 KSSFAEAAGYCRYLESHLAIISNKDEDSFIRGYATR--LGEAFNYWLGASDLNIEGRWLWEGQRRMNYTNWSPGQPDNAGGIEHCLELRRDLGNYLWNDYQCQKPSHFICEKE 130          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|P35246|SFTPD_BOVIN (Pulmonary surfactant-associated protein D OS=Bos taurus OX=9913 GN=SFTPD PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 2.378e-9
Identity = 34/126 (26.98%), Postives = 58/126 (46.03%), Query Frame = 2
Query:  116 VFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
              +  N   + E   K    +  ++ A  +C +   +L        ++ +   A   N   + +  +D ++ G ++Y  G  + Y+NW   EPNN  G ENC+E   +P G WN+ VCG +  VIC
Sbjct:  245 AMLFPNGRSVGEKIFKTEGSEKTFQDAQQICTQAGGQLPSPRSAAENEALTQLATAQNKAAF-LSMSDTRKEGTFIYPTGEPLVYSNWAPQEPNNDGGSENCVE--IFPNGKWNDKVCGEQRLVIC 367          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q66S03|LECG_THANI (Galactose-specific lectin nattectin OS=Thalassophryne nattereri OX=289382 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.844e-8
Identity = 27/112 (24.11%), Postives = 55/112 (49.11%), Query Frame = 2
Query:  179 VNYETATCLCIEENMRLVKVEDKN----TDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPN-NPGVENCLEGARYPKGLWNNIVCGRENAVICYKD 499
            +++ +A   CI +   L  + ++        +++  + +N   R W+ GND  + G W ++ G K  Y  W +G+P+ +   E+C E   +    WNN +C  + + +C K+
Sbjct:   50 MDWASAEAACIRKGGNLASIHNRREQNFITHLIHKLSGENR--RTWIGGNDAVKEGMWFWSDGSKFNYKGWKKGQPDKHVPAEHCAE-TNFKGAFWNNALCKVKRSFLCAKN 158          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9N1X4|SFTPD_PIG (Pulmonary surfactant-associated protein D OS=Sus scrofa OX=9823 GN=SFTPD PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.066e-8
Identity = 35/129 (27.13%), Postives = 55/129 (42.64%), Query Frame = 2
Query:  116 VFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN----PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            V +  N  G+ E   K    +  ++ A  +C +   ++     +  ++ +       N   + +   D K  G + Y  G  + Y NW  GEPNN     G ENC+E   +P G WN+  CG    VIC
Sbjct:  251 VELFPNGRGVGEKIFKTGGFEKTFQDAQQVCTQAGGQMASPRSETENEALSQLVTAQNKAAF-LSMTDIKTEGNFTYPTGEPLVYANWAPGEPNNNGGSSGAENCVE--IFPNGKWNDKACGELRLVIC 376          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: Q8WSW6 (Scarf1 OS=Girardia tigrina OX=6162 GN=scarf1 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.484e-25
Identity = 56/138 (40.58%), Postives = 77/138 (55.80%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLKIIPK-KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICY 493
            MLH      +  I Q    LT++Q   + K K+NY  A   C  + +RLVK+ D  T+  V+  A+KN +G YWM+GND    G WV      + Y NW++GEPNN  G +NCL  A +P  +W +I C   N+VICY
Sbjct:    1 MLHFFQLFLVGLIFQ----LTQAQYYHLNKNKMNYNDAVKYCNSKEIRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNDMWFDIGCDTLNSVICY 134          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: Q8WSX2 (Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN=lec1 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.693e-22
Identity = 49/115 (42.61%), Postives = 75/115 (65.22%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC--YKDDSDD 511
            K+ ++ A   C +  M LV++ + + + +V+N A KNNLGRYW++GND+++ G WVY    ++TY NW  GEPNN  G ++C+ G  +P G W++  C  +NAVIC   K D+DD
Sbjct:  153 KMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDD 267          

HSP 2 Score: 102.449 bits (254), Expect = 9.790e-22
Identity = 49/115 (42.61%), Postives = 75/115 (65.22%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC-YKDDSDDD 514
            K+    A   C +  M LV++ +K+ + +V+N A KNNLGRYW++GND+++ G WVY    ++TY NW  GEPNN  G ++C+ GA +P G W++  C  +N+VIC    D+D+D
Sbjct:   28 KMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDND 142          

HSP 3 Score: 100.523 bits (249), Expect = 4.191e-21
Identity = 48/126 (38.10%), Postives = 76/126 (60.32%), Query Frame = 2
Query:  143 LTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNP-GVENCLEGARYPKGLWNNIVCGRENAVIC--YKDDSDD 511
            + +   ++   K  ++ A   C  + M LV++ + + ++ VYN A K  +GRYW++GNDK++ G WVY    ++TY NW  GEPNN  G ++C+ GA YP G W++  C  +N V+C   K D+DD
Sbjct:  281 VVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDD 406          

HSP 4 Score: 98.9821 bits (245), Expect = 1.709e-20
Identity = 49/123 (39.84%), Postives = 73/123 (59.35%), Query Frame = 2
Query:  146 TESQLKIIPK-------KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNP-GVENCLEGARYPKGLWNNIVCGRENAVIC 490
            T+S  K++ +       K+ ++ A   C +  M LVK+ + N +  VYN A K  +GRYW++GND+ + G WV     ++TY NW  GEPNN  G ++C+ GA YP G W++  C  +NAVIC
Sbjct:  414 TDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVIC 536          

HSP 5 Score: 93.9745 bits (232), Expect = 8.502e-19
Identity = 42/103 (40.78%), Postives = 66/103 (64.08%), Query Frame = 2
Query:  185 YETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNP-GVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ++ A   C ++ M LV++ + + ++ VYN A K  +GRYW++GND+++ G WV     ++TY NW  GEPNN  G ++C+ GA YP G W++  C  +N VIC
Sbjct:  585 FDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVIC 687          

HSP 6 Score: 87.4261 bits (215), Expect = 1.697e-16
Identity = 45/132 (34.09%), Postives = 75/132 (56.82%), Query Frame = 2
Query:  122 ILQNCEGLTES-QLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDD 511
            I ++ EG   S   +I   K+N++ A   C ++ M +V++ +   +  V+  + K  LG+YW++GND+   G WV     ++ Y NW +GEPNN  GV++C++G  Y  G W++I C  + +VIC    S D
Sbjct:  709 IFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKD 840          

HSP 7 Score: 78.5666 bits (192), Expect = 2.096e-13
Identity = 40/119 (33.61%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  143 LTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEP-NNPGVENCLEGARYPKGLWNNIVCGRENAVICYK 496
            +  +   +   K+N++ A   C ++ M LVK+ ++  + +V+  A K NL  YW++GND+ + G WV      +TY NW  GEP NN G ++CL+G+    G W    C   N+V+C +
Sbjct:  911 VVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVCVR 1029          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: Q8WTP3 (Scarf2 OS=Girardia tigrina OX=6162 GN=scarf2 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.705e-22
Identity = 55/137 (40.15%), Postives = 76/137 (55.47%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLKIIPK-KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            MLH      +  I Q    LT++Q   + K K+NY  A   C  + +RLVK+ D  T+  V+  A+KN +G YWM+GND    G WV      + Y NW++GEPNN  G +NCL  A +P  +W +I C   N+VIC
Sbjct:    1 MLHFFQLFLVGLIFQ----LTQAQYYHLNKNKMNYNDAVKYCNSKEIRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVIC 133          

HSP 2 Score: 90.1225 bits (222), Expect = 1.891e-18
Identity = 48/107 (44.86%), Postives = 62/107 (57.94%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICY 493
            K+ Y  A   C + NM LVK+ +   +  VYN A K+NLG YWM+GND    G WV      + Y NW+ GEPNN  G +NCL  A +P  +W +I C   N+VICY
Sbjct:  146 KMTYNDAVKYCNDRNMGLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVNTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMWFDIGCDTLNSVICY 252          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: Q24696 (C-type lectin-like protein OS=Girardia tigrina OX=6162 GN=scarf PE=2 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 3.864e-22
Identity = 55/137 (40.15%), Postives = 76/137 (55.47%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLKIIPK-KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            MLH      +  I Q    LT++Q   + K K+NY  A   C  + +RLVK+ D  T+  V+  A+KN +G YWM+GND    G WV      + Y NW++GEPNN  G +NCL  A +P  +W +I C   N+VIC
Sbjct:    1 MLHFFQLFLVGLIFQ----LTQAQYYHLNKNKMNYNDAVKYCNSKEIRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVIC 133          

HSP 2 Score: 90.1225 bits (222), Expect = 2.166e-18
Identity = 48/107 (44.86%), Postives = 62/107 (57.94%), Query Frame = 2
Query:  176 KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICY 493
            K+ Y  A   C + NM LVK+ +   +  VYN A K+NLG YWM+GND    G WV      + Y NW+ GEPNN  G +NCL  A +P  +W +I C   N+VICY
Sbjct:  146 KMTYNDAVKYCNDRNMGLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIGGTWVNTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMWFDIGCDTLNSVICY 252          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: Q8WTP2 (Scarf2a OS=Girardia tigrina OX=6162 GN=scarf2a PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.439e-22
Identity = 58/137 (42.34%), Postives = 76/137 (55.47%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLKIIPK-KVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGV-ENCLEGARYPKGLWNNIVCGRENAVIC 490
            MLH      +  I Q    LT++Q   + K K+NY  A   C  + MRLVK+ D  T   V+  A+KN +G YWM+GND    G WV      + Y NWH+GEPNN G  ENCL GA + + +W +I C   N+VIC
Sbjct:    1 MLHFFQLFLVGLIFQ----LTQAQYYHLNKNKMNYNDAVKYCNSKEMRLVKITDSQTYAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWHKGEPNNAGGNENCLVGAWFHE-MWFDIGCNTLNSVIC 132          

HSP 2 Score: 89.7373 bits (221), Expect = 2.764e-18
Identity = 52/121 (42.98%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  134 CEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGV-ENCLEGARYPKGLWNNIVCGRENAVICY 493
            CE + E+   I   K+ Y  A   C + NM LVK+ +   +  VYN A K+NLG YWM+GND    G WV      + Y NW++GEPNN G  ENCL  A     +W +I C   N+VICY
Sbjct:  132 CEIVIEN-YHINKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNAGGNENCLVAAYLTNEMWFDIGCNTLNSVICY 251          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000033246.1 (ladderlectin-like [Source:NCBI gene;Acc:111190577])

HSP 1 Score: 53.9138 bits (128), Expect = 4.522e-9
Identity = 33/109 (30.28%), Postives = 50/109 (45.87%), Query Frame = 2
Query:  206 CIEENMRLVKVEDKNTDQMVYNFANKNNLGRY---WMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPG-VENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII 520
            CI     L  V    T   +  F+ K   G+Y   W+ G+D  E  +W+++ G K  +T W   EPNN G  E+C+E       LWN+  C      +C K  + D ++
Sbjct:   53 CISLGGNLASVHSLQTHNFLKRFS-KTKAGKYVRTWIGGHDATENFQWLWSDGTKFDFTAWLTDEPNNAGNAEHCVEMNYGGGVLWNDARCNAALYSVCQKPAAVDYVM 160          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053854.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:24939255:24949357:1 gene:ENSAMXG00000040947.1 transcript:ENSAMXT00000053854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.776e-8
Identity = 30/99 (30.30%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  206 CIEENMRLVKVEDKNTDQMVYNFA-NKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGV-ENCLEGARYPKGLWNNIVCGRENAVICYK 496
            C+     L  V        + N   N ++    W+ G+D  + G WV+  G   +YT W++GEP+N G  ENC+E   +  G WN++ C      +C K
Sbjct:   16 CVAMGGHLASVHSSEEHTFIVNLVLNASSSDSAWIGGSDTAQEGAWVWTDGSAFSYTYWNKGEPSNYGQWENCMEINYH--GKWNDLYCKLVLPSVCAK 112          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055453.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001063.1:27839:46936:-1 gene:ENSAMXG00000009023.2 transcript:ENSAMXT00000055453.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 9.198e-8
Identity = 32/115 (27.83%), Postives = 52/115 (45.22%), Query Frame = 2
Query:  152 SQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYK 496
            S L +I +K  +  A   C E ++ LV V  +   + V   A   +    W+        G W+++ G   +Y+NW+ GEPNN   +NC+         WN+  C   +  ICY+
Sbjct:   28 SALVLIKEKKTWWEALRYCRENHVDLVSVHTEGIQRWVKTVARNASTDNVWV--------GLWIWSDGSNSSYSNWNTGEPNNAVGDNCVILQSNYGYRWNDARCIWPDQFICYE 134          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000038574.1 (macrophage mannose receptor 1-like [Source:NCBI gene;Acc:103025801])

HSP 1 Score: 49.6766 bits (117), Expect = 1.213e-7
Identity = 30/94 (31.91%), Postives = 47/94 (50.00%), Query Frame = 2
Query:  227 LVKVEDKNTDQMVYNFANKNNL---GRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKG--LWNNIVCGRENAVIC 490
            L + + KN + M  +  + NN       WM G+D    G ++++ G  +++TNW  GEPN+  G ENC+E      G   WN+I C      +C
Sbjct:   43 LTECQSKNANLMSISDIHDNNYLLTMSLWMGGHDSVTEGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVC 136          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036206.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001235.1:47839:62864:1 gene:ENSAMXG00000042260.1 transcript:ENSAMXT00000036206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.359e-7
Identity = 33/120 (27.50%), Postives = 54/120 (45.00%), Query Frame = 2
Query:  158 LKIIPKKVNYETATCLCIEENMRLVKV---EDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSD 508
            L +I +K  +  A   C E ++ LV V   E +   + V   A+ +N+               W+++ G    Y NW  GEPN+P  +NC+E     +  WN+  C   +  +CYK D +
Sbjct:   42 LVLITEKKTWRDALSYCRENHVDLVSVHTEEIQRRVEAVIKVASTDNV---------------WIWSDGSNSPYRNWISGEPNSPEKDNCVELWSESEYRWNDAGCTYPSPFVCYKGDCE 146          
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009130.1 (pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 gene:ENSPMAG00000008249.1 transcript:ENSPMAT00000009130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 3.755e-8
Identity = 31/125 (24.80%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  113 IVFILQNCEGLTESQLK---IIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKM---TYTNWHQGEPNNP-GVENCLEGARYPKGLWNNIVC 466
            + F+     G+ E++ K   ++ ++  Y  A   C      L    D+ T+ ++  + +   L R ++  +D    G + Y  G  +    +T W  GEPNN  G E+C+E      G WN++ C
Sbjct:  140 VSFLKTAVAGVRETERKMYLLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSC 262          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO49509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGD7])

HSP 1 Score: 56.225 bits (134), Expect = 1.185e-9
Identity = 30/106 (28.30%), Postives = 50/106 (47.17%), Query Frame = 2
Query:  179 VNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYK 496
            +++E A   C     RL  + D+N    +     +    R+W+  ND+   G + +  G   ++ NW +GEPNN   E+C E A +  G WN+ +C      IC +
Sbjct:   50 LSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAE-AVWNTGQWNDELCSNTYGYICKR 154          

HSP 2 Score: 55.4546 bits (132), Expect = 2.549e-9
Identity = 34/114 (29.82%), Postives = 58/114 (50.88%), Query Frame = 2
Query:  185 YETATCLCIEENMRLVKVEDKNTDQMVYN-FANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII 520
            ++ A   C +    L+ ++    +  VY+ F  K      W+  ND  +   + ++ G  ++YTN++  EPN+  G E+CLE  R+  G WN+  C R+N  IC K ++   II
Sbjct: 1370 WQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPII 1482          

HSP 3 Score: 50.0618 bits (118), Expect = 1.717e-7
Identity = 33/93 (35.48%), Postives = 50/93 (53.76%), Query Frame = 2
Query:  227 LVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYN-RGCKMTYTNWHQGEPNN-PGVENCLE-GARYPKGLWNNIVCGRENAVICYK 496
            LVKV+D  T+Q   ++ ++      W+   D+   G +V+   G  + YTNW +GEPN+  G E+C+E  A Y  G WN+  C +    IC K
Sbjct:  212 LVKVDDA-TEQNFLSYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEK 303          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO49512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE1])

HSP 1 Score: 52.7582 bits (125), Expect = 2.264e-8
Identity = 32/109 (29.36%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  167 IPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            I   V +  A   C  +   LV + ++  +Q    + +K++    W+  ND+   G W ++ G  + Y  W+ GEPN+  GVENC E     + LWN+  C ++   IC
Sbjct: 1791 ISAYVTWSQARSTCTRQGADLVSILNQE-EQDFLIYQSKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNR-LWNDYSCSQQRGYIC 1897          

HSP 2 Score: 51.9878 bits (123), Expect = 3.362e-8
Identity = 32/105 (30.48%), Postives = 49/105 (46.67%), Query Frame = 2
Query:  182 NYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRG-CKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            ++E A  LC      L  + D++    +     +     +W+  ND+     + +  G  K  YTNW +GEPNN    E+C E   Y  GLWN+  C +E + IC
Sbjct:   50 SWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFIC 153          

HSP 3 Score: 45.0542 bits (105), Expect = 8.769e-6
Identity = 24/69 (34.78%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  302 WMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICYKDDS 505
            W+  ND    G   ++ G  M+Y NW   EPNN  G+E+C E +R+  G WN+  C  +   +C K ++
Sbjct: 1397 WIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGEMSRF-DGRWNDQNCNLKRTFVCRKHNN 1464          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO41680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Q6])

HSP 1 Score: 47.3654 bits (111), Expect = 2.423e-7
Identity = 33/115 (28.70%), Postives = 52/115 (45.22%), Query Frame = 2
Query:  161 KIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKM---TYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYK 496
            K++  K N++ A   C      L  V +    + + NF N  +    W+   D+K  G W ++ G K    +YTNW +  PNN GV   +      KG W++  C  + + IC K
Sbjct:   20 KVVFDKSNWDDARANCQSAGGDLFSVTNAYEQRFLENFTNIES----WLGYRDQKAAGTWRWSDGSKYMTSSYTNWDERSPNNGGVTCAI---VTKKGRWHDEQCQAKYSYICKK 127          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO41830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S362])

HSP 1 Score: 45.8246 bits (107), Expect = 8.551e-7
Identity = 35/127 (27.56%), Postives = 55/127 (43.31%), Query Frame = 2
Query:  143 LTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKN--NLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNP-GVENCLEGARYPKGL-----WNNIVCGRENAVICYKD 499
               S  K++    N+  A   C +    LVK++ +  ++++YN + K   +    W+         K+ +  G K  YT W + EPNN  G ENC +    P  L     WN+  C R+   IC K 
Sbjct:    8 FRRSCYKVVKTIANWTDARATCGKLGGDLVKIKGEEENKLLYNLSRKEAPSAPHMWIGLKRNPNDKKFYWVDGSKPGYTKWMKNEPNNAYGNENCGQLYSVPDNLPYFQQWNDYDCSRKCTFICEKS 134          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003236.2 (ladderlectin-like [Source:NCBI gene;Acc:110013319])

HSP 1 Score: 55.4546 bits (132), Expect = 1.425e-9
Identity = 34/108 (31.48%), Postives = 51/108 (47.22%), Query Frame = 2
Query:  170 PKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVIC 490
            PK  +     C  I  N+  VK   +NT  +      K N    W+ G+D ++ G W ++ G K  YTNW   EPNN  G ++CL+ +   K  W+++ C      IC
Sbjct:   64 PKTWDEAENFCRSIGANLASVKNSLENTKLLSLINQQKANYTPTWIGGSDAQKNGVWFWSDGSKYQYTNWCPKEPNNGRGQQHCLQMSYTKKRCWDDLECRERRPFIC 171          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003234.2 (ladderlectin-like [Source:NCBI gene;Acc:101174137])

HSP 1 Score: 52.373 bits (124), Expect = 2.156e-8
Identity = 36/120 (30.00%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  155 QLKIIPKKVNYETATCLC--IEENMRLVKVEDKNTDQMVYNFANKNNLGRY---WMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICYK 496
                 P  + +  A   C  I  N+  VK   +NT+ +      K   GRY   W+ G+D +  G W ++ G    YTNW   EPNN  G + CL  +   +  W+++ CG     IC K
Sbjct:   57 HFSYFPSTMTWAEAESFCRSIGGNLASVKNRFENTELLSLI---KQKQGRYKPTWIGGSDAQTNGIWFWSDGSNDQYTNWCPNEPNNYFGNQKCLIMSAKKRRCWDDVRCGARRPFICAK 173          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033058.1 (pep primary_assembly:ASM223467v1:21:6426657:6438028:1 gene:ENSORLG00000027148.1 transcript:ENSORLT00000033058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 2.717e-8
Identity = 32/107 (29.91%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  182 NYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICYKD 499
            +++ A   C      LV +  K+ ++    F +K N  R W+   D+   G W +  G  +  T W  G+P+N  G E+C+E      GLWN+I C     +IC K+
Sbjct:   35 SWDEARKSCKARGADLVVINSKDENE----FISKLNTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 137          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035036.1 (pep primary_assembly:ASM223467v1:21:6365863:6438028:1 gene:ENSORLG00000027148.1 transcript:ENSORLT00000035036.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 3.434e-8
Identity = 31/99 (31.31%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  206 CIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICYKD 499
            C      LV +  K+ ++    F +K N  R W+   D+   G W +  G  +  T W  G+P+N  G E+C+E      GLWN+I C     +IC K+
Sbjct:   43 CKARGADLVVINSKDENE----FISKLNTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 137          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000043418.1 (pep primary_assembly:ASM223467v1:21:6365863:6438028:1 gene:ENSORLG00000027148.1 transcript:ENSORLT00000043418.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 4.132e-8
Identity = 31/99 (31.31%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  206 CIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNN-PGVENCLEGARYPKGLWNNIVCGRENAVICYKD 499
            C      LV +  K+ ++    F +K N  R W+   D+   G W +  G  +  T W  G+P+N  G E+C+E      GLWN+I C     +IC K+
Sbjct:   52 CKARGADLVVINSKDENE----FISKLNTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 146          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000028258.1 (SMESG000028258.1)

HSP 1 Score: 298.901 bits (764), Expect = 2.586e-105
Identity = 144/145 (99.31%), Postives = 144/145 (99.31%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII 520
            MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNW QGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII
Sbjct:    1 MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWQQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII 145          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000028260.1 (SMESG000028260.1)

HSP 1 Score: 295.434 bits (755), Expect = 6.647e-104
Identity = 143/145 (98.62%), Postives = 143/145 (98.62%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII 520
            MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWV NRGCKMTYTNW QGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII
Sbjct:    1 MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVNNRGCKMTYTNWQQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII 145          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000028261.1 (SMESG000028261.1)

HSP 1 Score: 197.978 bits (502), Expect = 3.571e-66
Identity = 95/96 (98.96%), Postives = 96/96 (100.00%), Query Frame = 2
Query:   86 MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYT 373
            MLHLIATLA+VFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYT
Sbjct:    1 MLHLIATLAVVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYT 96          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000028264.1 (SMESG000028264.1)

HSP 1 Score: 180.259 bits (456), Expect = 1.120e-56
Identity = 80/122 (65.57%), Postives = 99/122 (81.15%), Query Frame = 2
Query:  140 GLTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDS 505
            GLTESQL ++  K +YE A+CLC  E M+LVK+ED  ++ +VYNFA +N LG+YWMDGNDKK TG+W +N GCKMTYTNW++GEPN PGVE CLEGA YP GLWNNI C  +NA+ICYK++S
Sbjct:  147 GLTESQLVVLRTKASYEVASCLCSVEGMKLVKIEDPASNTLVYNFAMRNKLGKYWMDGNDKKFTGRWTFNDGCKMTYTNWYRGEPNYPGVEQCLEGAYYPNGLWNNIKCSEQNAIICYKENS 268          

HSP 2 Score: 127.872 bits (320), Expect = 2.975e-36
Identity = 59/144 (40.97%), Postives = 90/144 (62.50%), Query Frame = 2
Query:   89 LHLIATLAIVFILQNCEGL---TESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDD 511
            ++ I  +A++  +  C+ L   TE QL ++P K NY+ AT  C  +N+RLVKV D  ++++++NFA K  LG+YW+DGN+K+ TG+WV + G  +++T W  GEPN    E C+EG  +    WNNI C    A ICY   +D+
Sbjct:    1 MNFIILVALIGFIVTCDALGQLTEDQLVVLPHKYNYDEATRQCASKNLRLVKVNDIESNELLFNFAVKKRLGKYWIDGNNKQGTGRWVDSEGNMLSFTKWAPGEPNYLKTERCIEGLFFKDSSWNNIGCDSAKATICYDPSTDE 144          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000031111.1 (SMESG000031111.1)

HSP 1 Score: 137.887 bits (346), Expect = 8.389e-41
Identity = 61/119 (51.26%), Postives = 85/119 (71.43%), Query Frame = 2
Query:  143 LTESQLKIIPKKVNYETATCLCIEENMRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKD 499
            + E+QL ++P KVN +TA  +C    ++LVKV+++  +Q+VY+FA +NN+G+YWMD ND ++   WVY+ G ++TY+ WH GEPNN G ENCL G  Y  G WN+I C   NAVICYKD
Sbjct:  102 IQENQLVVLPGKVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYSKWHSGEPNNYGGENCLHGLFYQNGFWNDISCNSNNAVICYKD 220          

HSP 2 Score: 108.612 bits (270), Expect = 1.836e-29
Identity = 46/100 (46.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:  221 MRLVKVEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQGEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII 520
            M L++++D+ T+Q+VYNFA +  LG+YW+D ND+ +  ++VY  G ++TY+ WH+GEPNN   E+C+ G  Y  G WN+I C   NAVICY++ S + I+
Sbjct:    1 MNLIRIQDEQTNQIVYNFAVRRGLGQYWIDANDRVQERQFVYEDGNRITYSKWHRGEPNNYNNEDCVHGLFYQNGFWNDIKCDINNAVICYRERSQNSIV 100          
The following BLAST results are available for this feature:
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SFTPD1.088e-729.08surfactant protein D [Source:HGNC Symbol;Acc:HGNC:... [more]
COLEC103.212e-723.48collectin subfamily member 10 [Source:HGNC Symbol;... [more]
MBL21.024e-625.71mannose binding lectin 2 [Source:HGNC Symbol;Acc:H... [more]
MRC11.062e-626.89mannose receptor C-type 1 [Source:HGNC Symbol;Acc:... [more]
SFTPA27.213e-625.47surfactant protein A2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tfc2.635e-732.17gene:FBgn0035199 transcript:FBtr0072661[more]
tfc2.635e-732.17gene:FBgn0035199 transcript:FBtr0072660[more]
tfc6.785e-732.17gene:FBgn0035199 transcript:FBtr0072659[more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-241l7.65.064e-1129.20si:dkey-241l7.6 [Source:ZFIN;Acc:ZDB-GENE-041014-2... [more]
si:dkey-241l7.65.064e-1129.20si:dkey-241l7.6 [Source:ZFIN;Acc:ZDB-GENE-041014-2... [more]
zgc:1720531.860e-1026.53zgc:172053 [Source:ZFIN;Acc:ZDB-GENE-080219-25][more]
zgc:1720531.860e-1026.53zgc:172053 [Source:ZFIN;Acc:ZDB-GENE-080219-25][more]
si:ch211-125e6.52.020e-1026.53si:ch211-125e6.5 [Source:ZFIN;Acc:ZDB-GENE-070912-... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnpla81.970e-827.14patatin like phospholipase domain containing 8 [So... [more]
ENSXETT00000001317.12.075e-827.66pep primary_assembly:Xenopus_tropicalis_v9.1:3:125... [more]
pnpla82.381e-827.14patatin like phospholipase domain containing 8 [So... [more]
ptpn11b2.863e-829.08protein tyrosine phosphatase, non-receptor type 11... [more]
FREM11.100e-728.57FRAS1 related extracellular matrix 1 [Source:NCBI ... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sftpd1.753e-830.10surfactant associated protein D [Source:MGI Symbol... [more]
Colec101.539e-624.24collectin sub-family member 10 [Source:MGI Symbol;... [more]
Cd209f1.965e-628.16CD209f antigen [Source:MGI Symbol;Acc:MGI:1916392][more]
Sftpa12.018e-621.90surfactant associated protein A1 [Source:MGI Symbo... [more]
Sftpa12.018e-621.90surfactant associated protein A1 [Source:MGI Symbo... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42916|CL43_BOVIN1.345e-1029.79Collectin-43 OS=Bos taurus OX=9913 GN=CL43 PE=1 SV... [more]
sp|P82596|PLC_HALLA5.395e-1030.97Perlucin OS=Haliotis laevigata OX=36097 PE=1 SV=3[more]
sp|P35246|SFTPD_BOVIN2.378e-926.98Pulmonary surfactant-associated protein D OS=Bos t... [more]
sp|Q66S03|LECG_THANI3.844e-824.11Galactose-specific lectin nattectin OS=Thalassophr... [more]
sp|Q9N1X4|SFTPD_PIG4.066e-827.13Pulmonary surfactant-associated protein D OS=Sus s... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8WSW67.484e-2540.58Scarf1 OS=Girardia tigrina OX=6162 GN=scarf1 PE=4 ... [more]
Q8WSX22.693e-2242.61Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN... [more]
Q8WTP33.705e-2240.15Scarf2 OS=Girardia tigrina OX=6162 GN=scarf2 PE=4 ... [more]
Q246963.864e-2240.15C-type lectin-like protein OS=Girardia tigrina OX=... [more]
Q8WTP24.439e-2242.34Scarf2a OS=Girardia tigrina OX=6162 GN=scarf2a PE=... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033246.14.522e-930.28ladderlectin-like [Source:NCBI gene;Acc:111190577][more]
ENSAMXT00000053854.11.776e-830.30pep primary_assembly:Astyanax_mexicanus-2.0:16:249... [more]
ENSAMXT00000055453.19.198e-827.83pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000038574.11.213e-731.91macrophage mannose receptor 1-like [Source:NCBI ge... [more]
ENSAMXT00000036206.12.359e-727.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009130.13.755e-824.80pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 g... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO495091.185e-928.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495122.264e-829.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416802.423e-728.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418308.551e-727.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003236.21.425e-931.48ladderlectin-like [Source:NCBI gene;Acc:110013319][more]
ENSORLT00000003234.22.156e-830.00ladderlectin-like [Source:NCBI gene;Acc:101174137][more]
ENSORLT00000033058.12.717e-829.91pep primary_assembly:ASM223467v1:21:6426657:643802... [more]
ENSORLT00000035036.13.434e-831.31pep primary_assembly:ASM223467v1:21:6365863:643802... [more]
ENSORLT00000043418.14.132e-831.31pep primary_assembly:ASM223467v1:21:6365863:643802... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028258.12.586e-10599.31SMESG000028258.1[more]
SMESG000028260.16.647e-10498.62SMESG000028260.1[more]
SMESG000028261.13.571e-6698.96SMESG000028261.1[more]
SMESG000028264.11.120e-5665.57SMESG000028264.1[more]
SMESG000031111.18.389e-4151.26SMESG000031111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003676 ID=SMED30003676|Name=C-type lectin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=569bp
CTTATTTCAAGTCCCATATTTGTTTTCGAAAACAAAAAGATAAAAGCACT
ATAAATCTATCAGATTATTTTAATAAAATCAAATCATGCTTCATTTGATA
GCTACTTTAGCCATAGTCTTTATCCTTCAAAATTGTGAAGGATTGACTGA
AAGTCAGCTGAAAATAATACCGAAAAAGGTGAATTATGAAACTGCGACCT
GTCTATGCATTGAAGAGAATATGAGACTCGTCAAAGTTGAAGATAAAAAT
ACAGATCAAATGGTATATAATTTTGCCAACAAGAACAACCTCGGTAGATA
TTGGATGGACGGCAATGATAAGAAAGAAACAGGAAAGTGGGTATATAATC
GTGGATGCAAAATGACCTACACAAATTGGCATCAAGGAGAACCAAATAAT
CCAGGAGTTGAAAATTGCTTGGAAGGAGCTCGTTACCCGAAAGGATTGTG
GAATAATATTGTTTGCGGTCGGGAAAATGCGGTTATCTGTTATAAAGACG
ACTCTGATGATGACATCATTTAAAATAGAGCTAGAAGCTTTTAATATAAT
AAAACTTTAGTCTGTCCTT
back to top

protein sequence of SMED30003676-orf-1

>SMED30003676-orf-1 ID=SMED30003676-orf-1|Name=SMED30003676-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
MLHLIATLAIVFILQNCEGLTESQLKIIPKKVNYETATCLCIEENMRLVK
VEDKNTDQMVYNFANKNNLGRYWMDGNDKKETGKWVYNRGCKMTYTNWHQ
GEPNNPGVENCLEGARYPKGLWNNIVCGRENAVICYKDDSDDDII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000421tail
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR001304C-type_lectin-like
IPR016186C-type_lectin-like/link_sf
IPR018378C-type_lectin_CS
IPR016187CTDL_fold
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0007585respiratory gaseous exchange
GO:0043129surfactant homeostasis
GO:0045087innate immune response
GO:0048286lung alveolus development
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005581collagen trimer
GO:0005615extracellular space
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 17..136
e-value: 1.1E-7
score: 41.5
IPR001304C-type lectin-likePFAMPF00059Lectin_Ccoord: 31..137
e-value: 5.0E-12
score: 46.5
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 33..136
score: 14.797
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 4..137
e-value: 2.1E-23
score: 84.5
NoneNo IPR availablePANTHERPTHR22802C-TYPE LECTIN SUPERFAMILY MEMBERcoord: 28..139
NoneNo IPR availablePANTHERPTHR22802:SF358coord: 28..139
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.757
IPR018378C-type lectin, conserved sitePROSITEPS00615C_TYPE_LECTIN_1coord: 111..135
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 22..138