Mitochondrial import inner membrane translocase subunit TIM17

Overview
NameMitochondrial import inner membrane translocase subunit TIM17
Smed IDSMED30003672
Length (bp)775
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial import inner membrane translocase subunit TIM17 (SMED30003672) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial import inner membrane translocase subunit TIM17 (SMED30003672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial import inner membrane translocase subunit TIM17 (SMED30003672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial import inner membrane translocase subunit TIM17 (SMED30003672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 30

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003672SMESG000027888.1 SmedASXL_011169SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v4_904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig51115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig51115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig31402uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig31402newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig35977uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig35977newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 SMESG000027888.1 Contig4616uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 SMESG000027888.1 Contig4616newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig45080uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000027783.1 Contig45080newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000038481.1 SMESG000038485.1 Contig4616uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003672SMESG000038481.1 SMESG000038485.1 Contig4616newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30003672SMESG000027783.1 SMESG000027888.1 dd_Smed_v6_904_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30003672SMESG000027783.1 PL030001B10A09ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oocyteSMED30003672SMESG000027783.1 Contig31402uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003672SMESG000027783.1 Contig31402uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30003672SMESG000027783.1 Contig31402newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003672SMESG000027783.1 Contig31402newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30003672SMESG000027783.1 Contig3425GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003672SMESG000027783.1 Contig3425GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Human
Match: TIMM17A (translocase of inner mitochondrial membrane 17A [Source:HGNC Symbol;Acc:HGNC:17315])

HSP 1 Score: 109.768 bits (273), Expect = 3.535e-29
Identity = 58/107 (54.21%), Postives = 79/107 (73.83%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +N+P G + +    +T  K ++P  GGSFA+WGG+FS +DCS++ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Human
Match: TIMM17B (translocase of inner mitochondrial membrane 17B [Source:HGNC Symbol;Acc:HGNC:17310])

HSP 1 Score: 103.99 bits (258), Expect = 6.369e-27
Identity = 57/107 (53.27%), Postives = 75/107 (70.09%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +NAP G   +        + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARS 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Human
Match: TIMM17B (translocase of inner mitochondrial membrane 17B [Source:HGNC Symbol;Acc:HGNC:17310])

HSP 1 Score: 80.4925 bits (197), Expect = 1.215e-17
Identity = 57/157 (36.31%), Postives = 75/157 (47.77%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPP--------------------------------------------------GFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +NAP                                                   G   +        + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVCRLLSEAPLFIYSCSRSVSPTVNVSSERAESRPTLFMAVSLHMAWCLAHIGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARS 157          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Human
Match: TIMM17B (translocase of inner mitochondrial membrane 17B [Source:HGNC Symbol;Acc:HGNC:17310])

HSP 1 Score: 80.4925 bits (197), Expect = 1.215e-17
Identity = 57/157 (36.31%), Postives = 75/157 (47.77%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPP--------------------------------------------------GFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +NAP                                                   G   +        + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVCRLLSEAPLFIYSCSRSVSPTVNVSSERAESRPTLFMAVSLHMAWCLAHIGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARS 157          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Human
Match: TIMM17B (translocase of inner mitochondrial membrane 17B [Source:HGNC Symbol;Acc:HGNC:17310])

HSP 1 Score: 77.411 bits (189), Expect = 1.002e-16
Identity = 33/65 (50.77%), Postives = 44/65 (67.69%), Query Frame = 2
Query:  134 GFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            G   +        + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:   63 GIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARS 127          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Celegans
Match: timm-17B.1 (Probable mitochondrial import inner membrane translocase subunit tim-17B.1 [Source:UniProtKB/Swiss-Prot;Acc:O44477])

HSP 1 Score: 88.5817 bits (218), Expect = 1.948e-21
Identity = 54/107 (50.47%), Postives = 73/107 (68.22%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCP+RI  D G A+AMG +GG +F    G KNA  G  KK V  + + + +S + G  FA WGGMFS +DC L+ +R+KEDP NSI++G  TGALLA+R+
Sbjct:    1 MEEYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAKG--KKLVGMMREVRMRSTLTGVQFAAWGGMFSTIDCCLVAIRKKEDPINSIVSGGLTGALLAIRS 105          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Celegans
Match: timm-17B.2 (Translocase, Inner Mitochondrial Membrane [Source:UniProtKB/TrEMBL;Acc:X5LX78])

HSP 1 Score: 61.2326 bits (147), Expect = 1.105e-11
Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 2
Query:  167 KFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            + + +S + G  FA WGG+FS +DC L+  R+KED  NSI++G  TGALLA+R+
Sbjct:    3 EVRMRSTLAGVQFAAWGGLFSTIDCCLVANRKKEDSINSIVSGGLTGALLAIRS 56          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Fly
Match: Tim17b (gene:FBgn0263977 transcript:FBtr0113895)

HSP 1 Score: 114.39 bits (285), Expect = 3.348e-31
Identity = 60/107 (56.07%), Postives = 82/107 (76.64%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCP+RI+ D GGA+AMG IGGG+F  + G +NAP G +++ V  I   K +SPV  G+FA+WGGMFS +DC+L+  R+KEDPWNSI++GA+TG +LA RN
Sbjct:    1 MEEYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGNFAVWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Fly
Match: Tim17b (gene:FBgn0263977 transcript:FBtr0345179)

HSP 1 Score: 114.39 bits (285), Expect = 3.348e-31
Identity = 60/107 (56.07%), Postives = 82/107 (76.64%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCP+RI+ D GGA+AMG IGGG+F  + G +NAP G +++ V  I   K +SPV  G+FA+WGGMFS +DC+L+  R+KEDPWNSI++GA+TG +LA RN
Sbjct:    1 MEEYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGNFAVWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Fly
Match: Tim17b2 (gene:FBgn0020371 transcript:FBtr0089699)

HSP 1 Score: 110.538 bits (275), Expect = 8.440e-30
Identity = 60/107 (56.07%), Postives = 76/107 (71.03%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCP RI+ D GGA+ MG +GGGLF  + G +NAP G  ++    +   K KSPV GGSFA WG +FS +DCSL+  RQKEDPWNSI++GA TG +LA RN
Sbjct:    1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGSFAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Fly
Match: Tim17b2 (gene:FBgn0020371 transcript:FBtr0343734)

HSP 1 Score: 110.538 bits (275), Expect = 8.440e-30
Identity = 60/107 (56.07%), Postives = 76/107 (71.03%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCP RI+ D GGA+ MG +GGGLF  + G +NAP G  ++    +   K KSPV GGSFA WG +FS +DCSL+  RQKEDPWNSI++GA TG +LA RN
Sbjct:    1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGSFAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Fly
Match: CG1724 (gene:FBgn0031164 transcript:FBtr0077257)

HSP 1 Score: 107.842 bits (268), Expect = 1.236e-28
Identity = 58/107 (54.21%), Postives = 78/107 (72.90%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCP+RI+ D GGA+ MG  GGGLF  + G +NAP G  ++F  G+   K++SP  GG+FA WG +FS +DCSL+ LR+KEDPWNSIM+GA  G +L+ RN
Sbjct:    1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGNFAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Zebrafish
Match: timm17a (translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:ZFIN;Acc:ZDB-GENE-031030-6])

HSP 1 Score: 109.768 bits (273), Expect = 4.523e-29
Identity = 59/107 (55.14%), Postives = 79/107 (73.83%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MGAIGGG+F  V G +N+P G + +    +T  + ++P  GGSFA+WGG+FS +DC L+ +R KEDPWNSI +GA TGA+LA RN
Sbjct:   36 MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPSGMNHRMKGSLTAIRTRAPQLGGSFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARN 142          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Zebrafish
Match: timm17a (translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:ZFIN;Acc:ZDB-GENE-031030-6])

HSP 1 Score: 109.768 bits (273), Expect = 4.523e-29
Identity = 59/107 (55.14%), Postives = 79/107 (73.83%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MGAIGGG+F  V G +N+P G + +    +T  + ++P  GGSFA+WGG+FS +DC L+ +R KEDPWNSI +GA TGA+LA RN
Sbjct:   36 MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPSGMNHRMKGSLTAIRTRAPQLGGSFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARN 142          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Zebrafish
Match: timm17b (translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:ZFIN;Acc:ZDB-GENE-081104-144])

HSP 1 Score: 106.301 bits (264), Expect = 4.666e-28
Identity = 59/107 (55.14%), Postives = 76/107 (71.03%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MGAIGGG+F  V G +NAP G   +        + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGVFQTVKGFRNAPVGVRHRLRGSANAVRVRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGAMTGAILAARS 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Zebrafish
Match: timm17a (translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:ZFIN;Acc:ZDB-GENE-031030-6])

HSP 1 Score: 83.5741 bits (205), Expect = 9.964e-20
Identity = 35/72 (48.61%), Postives = 49/72 (68.06%), Query Frame = 2
Query:  113 GCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            G +    G + +    +T  + ++P  GGSFA+WGG+FS +DC L+ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    7 GVREGAVGMNHRMKGSLTAIRTRAPQLGGSFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARN 78          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Xenopus
Match: pth1r (parathyroid hormone 1 receptor [Source:Xenbase;Acc:XB-GENE-957445])

HSP 1 Score: 108.997 bits (271), Expect = 5.688e-29
Identity = 57/107 (53.27%), Postives = 78/107 (72.90%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +N+P G   +F   +   + ++P  GGSFA+WGG+FS +DCS++ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYTREPCPWRIVDDCGGAFTMGMIGGGIFQAIKGFRNSPQGLKHRFKGSLISIRTRAPQLGGSFAVWGGLFSMIDCSMVKMRGKEDPWNSITSGALTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Mouse
Match: Timm17a (translocase of inner mitochondrial membrane 17a [Source:MGI Symbol;Acc:MGI:1343131])

HSP 1 Score: 108.997 bits (271), Expect = 4.954e-29
Identity = 58/107 (54.21%), Postives = 78/107 (72.90%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F    G +N+P G + +    +T  K ++P  GGSFA+WGG+FS +DCS++ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGINHRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Mouse
Match: Timm17b (translocase of inner mitochondrial membrane 17b [Source:MGI Symbol;Acc:MGI:1343176])

HSP 1 Score: 107.071 bits (266), Expect = 2.647e-28
Identity = 58/107 (54.21%), Postives = 77/107 (71.96%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +NAP G   +F   +   + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARS 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Mouse
Match: Timm17b (translocase of inner mitochondrial membrane 17b [Source:MGI Symbol;Acc:MGI:1343176])

HSP 1 Score: 96.2857 bits (238), Expect = 2.092e-24
Identity = 53/98 (54.08%), Postives = 70/98 (71.43%), Query Frame = 2
Query:   35 PWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            PWRI+ D GGA+ MG IGGG+F  + G +NAP G   +F   +   + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:   33 PWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARS 130          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Mouse
Match: Timm17a (translocase of inner mitochondrial membrane 17a [Source:MGI Symbol;Acc:MGI:1343131])

HSP 1 Score: 91.2781 bits (225), Expect = 3.667e-23
Identity = 39/78 (50.00%), Postives = 55/78 (70.51%), Query Frame = 2
Query:   95 LFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            +F    G +N+P G + +    +T  K ++P  GGSFA+WGG+FS +DCS++ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    8 IFQAFKGFRNSPVGINHRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAILAARN 85          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. UniProt/SwissProt
Match: sp|Q99595|TI17A_HUMAN (Mitochondrial import inner membrane translocase subunit Tim17-A OS=Homo sapiens OX=9606 GN=TIMM17A PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.698e-28
Identity = 58/107 (54.21%), Postives = 79/107 (73.83%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +N+P G + +    +T  K ++P  GGSFA+WGG+FS +DCS++ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. UniProt/SwissProt
Match: sp|Q9Z0V8|TI17A_MOUSE (Mitochondrial import inner membrane translocase subunit Tim17-A OS=Mus musculus OX=10090 GN=Timm17a PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.465e-28
Identity = 58/107 (54.21%), Postives = 78/107 (72.90%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F    G +N+P G + +    +T  K ++P  GGSFA+WGG+FS +DCS++ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGINHRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. UniProt/SwissProt
Match: sp|O35092|TI17A_RAT (Mitochondrial import inner membrane translocase subunit Tim17-A OS=Rattus norvegicus OX=10116 GN=Timm17a PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.604e-27
Identity = 57/107 (53.27%), Postives = 77/107 (71.96%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F    G +N+P G + +    +T  K ++P  GGSFA+WGG+FS +DC ++ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. UniProt/SwissProt
Match: sp|Q9Z0V7|TI17B_MOUSE (Mitochondrial import inner membrane translocase subunit Tim17-B OS=Mus musculus OX=10090 GN=Timm17b PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.852e-27
Identity = 58/107 (54.21%), Postives = 77/107 (71.96%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +NAP G   +F   +   + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARS 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. UniProt/SwissProt
Match: sp|Q2HJE9|TI17B_BOVIN (Mitochondrial import inner membrane translocase subunit Tim17-B OS=Bos taurus OX=9913 GN=TIMM17B PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.836e-27
Identity = 57/107 (53.27%), Postives = 76/107 (71.03%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MG IGGG+F  + G +NAP G   +    +   + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGMRHRLRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARS 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. TrEMBL
Match: A0A1E1WKI1 (Uncharacterized protein OS=Pectinophora gossypiella OX=13191 GN=g.8841 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 3.692e-34
Identity = 94/164 (57.32%), Postives = 120/164 (73.17%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNXXXXXXXXXXXXXXXXXXXXXXXXXFQRFST-------PMIEEIAQDNQSVSQPLGF 478
            MD Y R+PCPWRIL D+GGA+ MGAIGGG+F  + G +NAP GFS+K +  +   K +SP+ GG+FA+WGGMFS +DCSL++LRQKEDPWNSIM+GA TG +LA RNGVPA+ G A+VGG+LL +IEG GI+F R S        P+ E+ +   QS  QP  F
Sbjct:    1 MDEYSREPCPWRILDDSGGAFIMGAIGGGIFHSIKGFRNAPIGFSRKMIGSLAAVKERSPIVGGNFAVWGGMFSTIDCSLVYLRQKEDPWNSIMSGALTGGILAARNGVPAMAGSALVGGILLALIEGIGIMFTRLSAEQFKPQQPIFEDPSVLGQSQGQPQQF 164          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. TrEMBL
Match: A0A2A4J445 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_8087 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 6.722e-34
Identity = 69/107 (64.49%), Postives = 86/107 (80.37%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            MD Y R+PCPWRIL D+GGA+ MGAIGGG+F  + G +NAP GFS+K +  +   K +SPV GG+FA+WGGMFS +DCSL++LRQKEDPWNSIM+GA TG +LA RN
Sbjct:    1 MDEYTREPCPWRILDDSGGAFIMGAIGGGIFHSIKGFRNAPVGFSRKMLGSLAALKERSPVVGGNFAVWGGMFSTIDCSLVYLRQKEDPWNSIMSGALTGGILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. TrEMBL
Match: A0A0L7LUX6 (Mitochondrial import inner membrane translocase OS=Operophtera brumata OX=104452 GN=OBRU01_00795 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 7.374e-34
Identity = 69/107 (64.49%), Postives = 86/107 (80.37%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            MD Y R+PCPWRIL D+GGA+ MGAIGGG+F  + G +NAP GFS+K +  +   K +SPV GG+FA+WGGMFS +DCSL++LRQKEDPWNSIM+GA TG +LA RN
Sbjct:    1 MDEYTREPCPWRILDDSGGAFIMGAIGGGIFHSIKGFRNAPVGFSRKMLGSLAAVKERSPVIGGNFAVWGGMFSTIDCSLVYLRQKEDPWNSIMSGALTGGILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. TrEMBL
Match: A0A212EI53 (Mitochondrial import inner membrane translocase OS=Danaus plexippus plexippus OX=278856 GN=KGM_208320 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 9.515e-34
Identity = 69/107 (64.49%), Postives = 86/107 (80.37%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            MD Y R+PCPWRIL DAGGA+ MGAIGGG+F  + G +NAP GFS+K +  +   K +SP+ GG+FA+WGGMFS +DCSL++LRQKEDPWNSIM+GA TG +LA RN
Sbjct:    1 MDEYSREPCPWRILDDAGGAFLMGAIGGGIFHSIKGFRNAPTGFSRKMLGSLAAMKERSPIVGGNFAVWGGMFSTIDCSLVYLRQKEDPWNSIMSGALTGGILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. TrEMBL
Match: A0A2H1WZD1 (SFRICE_009093 OS=Spodoptera frugiperda OX=7108 GN=SFRICE_009093 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.124e-33
Identity = 67/107 (62.62%), Postives = 86/107 (80.37%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            MD Y R+PCPWRIL D+GGA+ MGAIGGG+F  + G +NAP GFS+K +  +   K +SP+ GG+FA+WGGMFS +DCSL+++RQKEDPWNSIM+GA TG +LA RN
Sbjct:    1 MDEYTREPCPWRILDDSGGAFIMGAIGGGIFHSIKGFRNAPVGFSRKMLGSMAALKERSPIVGGNFAVWGGMFSTIDCSLVYMRQKEDPWNSIMSGALTGGILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Cavefish
Match: timm17a (translocase of inner mitochondrial membrane 17A [Source:NCBI gene;Acc:103042884])

HSP 1 Score: 108.997 bits (271), Expect = 2.790e-29
Identity = 59/107 (55.14%), Postives = 79/107 (73.83%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MGAIGGG+F  V G +N+P G + +    +T  + ++P  GGSFA+WGG+FS +DC L+ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPAGINHRLKGSMTAIRTRAPQLGGSFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Cavefish
Match: timm17b (translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:ZFIN;Acc:ZDB-GENE-081104-144])

HSP 1 Score: 104.76 bits (260), Expect = 3.854e-27
Identity = 58/107 (54.21%), Postives = 76/107 (71.03%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MGAIGGG+F  + G +NAP G   +        + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:   38 MEEYAREPCPWRIVDDCGGAFTMGAIGGGVFQSIKGFRNAPVGVQHRLKGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGAMTGAILAARS 144          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Sea Lamprey
Match: timm17b (translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:ZFIN;Acc:ZDB-GENE-081104-144])

HSP 1 Score: 107.457 bits (267), Expect = 3.250e-29
Identity = 59/102 (57.84%), Postives = 76/102 (74.51%), Query Frame = 2
Query:   23 RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            R+PCPWRI+ D GGA+ MGAIGGG+F  + G +NAP G   +F S I+  K + P  GGSFA+WGG+FS +DC L+ +R KEDPWNSI +GA TGA+LA R+
Sbjct:    6 REPCPWRIVDDCGGAFTMGAIGGGIFQSIKGFRNAPVGVGHRFHSSISAVKLRGPQIGGSFAVWGGLFSTIDCGLVKIRGKEDPWNSISSGALTGAVLAARS 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Sea Lamprey
Match: timm17b (translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:ZFIN;Acc:ZDB-GENE-081104-144])

HSP 1 Score: 95.9005 bits (237), Expect = 8.183e-25
Identity = 54/98 (55.10%), Postives = 72/98 (73.47%), Query Frame = 2
Query:   35 PWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            PWRI+ D GGA+ MGAIGGG+F  + G +NAP G  ++    ++  K ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    8 PWRIVDDCGGAFTMGAIGGGIFQCIKGFRNAPVGMRQRMRGSMSAMKLRAPQIGGSFAVWGGLFSTIDCGLVKLRGKEDPWNSITSGALTGAVLASRS 105          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Yeast
Match: TIM17 (Essential component of the TIM23 complex; with Tim23p, contributes to the architecture and function of the import channel; may link the import motor to the core Translocase of the Inner Mitochondrial membrane (TIM23 complex) [Source:SGD;Acc:S000003679])

HSP 1 Score: 86.2705 bits (212), Expect = 1.666e-21
Identity = 52/105 (49.52%), Postives = 75/105 (71.43%), Query Frame = 2
Query:   14 DAYRDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            D  RDPCP  IL+D GGA+AMGAIGG ++  + G +N+P G  ++    ++  KA++PV GG+F +WGG+FS  DC++  +R++EDPWN+I+AG  TG  LAVR 
Sbjct:    4 DHSRDPCPIVILNDFGGAFAMGAIGGVVWHGIKGFRNSPLG--ERGSGAMSAIKARAPVLGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGALAVRG 106          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Nematostella
Match: EDO48095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK29])

HSP 1 Score: 102.064 bits (253), Expect = 2.644e-27
Identity = 62/107 (57.94%), Postives = 79/107 (73.83%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCP+RI+ D GGA+AMGAIGGG+FS V G +N+P G   +F   I   K ++PV GG+FA+WGG+FS  DC L+ LR KEDPWNSI +GA TGA+LA R 
Sbjct:    1 MEEYAREPCPYRIVDDCGGAFAMGAIGGGIFSLVKGWRNSPVG--HRFYGSIAAVKTRAPVLGGNFAVWGGLFSTFDCCLMGLRGKEDPWNSIGSGAITGAVLAARG 105          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Medaka
Match: timm17a (translocase of inner mitochondrial membrane 17A [Source:NCBI gene;Acc:101167282])

HSP 1 Score: 112.849 bits (281), Expect = 1.012e-30
Identity = 62/107 (57.94%), Postives = 79/107 (73.83%), Query Frame = 2
Query:   11 MDAY-RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            M+ Y R+PCPWRI+ D GGA+ MGAIGGG+F  V G +NAP G S +    +T  K ++P  GGSFA+WGG+FS +DC L+ +R KEDPWNSI +GA TGA+LA RN
Sbjct:    1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNAPSGMSHRMRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARN 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Medaka
Match: timm17b (translocase of inner mitochondrial membrane 17B [Source:NCBI gene;Acc:101171666])

HSP 1 Score: 103.605 bits (257), Expect = 2.630e-27
Identity = 57/102 (55.88%), Postives = 74/102 (72.55%), Query Frame = 2
Query:   23 RDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            R+PCPWRI+ D GGA+ MGAIGGG+F  V G +NAP G + +        + ++P  GGSFA+WGG+FS +DC L+ LR KEDPWNSI +GA TGA+LA R+
Sbjct:    6 REPCPWRIVDDCGGAFTMGAIGGGVFQAVKGFRNAPAGVAHRLKGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARS 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Medaka
Match: timm17a (translocase of inner mitochondrial membrane 17A [Source:NCBI gene;Acc:101167282])

HSP 1 Score: 102.834 bits (255), Expect = 1.307e-26
Identity = 57/98 (58.16%), Postives = 72/98 (73.47%), Query Frame = 2
Query:   35 PWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRN 328
            PWRI+ D GGA+ MGAIGGG+F  V G +NAP G S +    +T  K ++P  GGSFA+WGG+FS +DC L+ +R KEDPWNSI +GA TGA+LA RN
Sbjct:   30 PWRIVDDCGGAFTMGAIGGGIFQAVKGFRNAPSGMSHRMRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARN 127          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Planmine SMEST
Match: SMESG000027783.1 (SMESG000027783.1)

HSP 1 Score: 234.187 bits (596), Expect = 2.245e-78
Identity = 157/157 (100.00%), Postives = 157/157 (100.00%), Query Frame = 2
Query:   11 MDAYRDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNXXXXXXXXXXXXXXXXXXXXXXXXXFQRFSTPMIEEIAQDNQSVSQPLGFQ 481
            MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTPMIEEIAQDNQSVSQPLGFQ
Sbjct:    1 MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTPMIEEIAQDNQSVSQPLGFQ 157          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Planmine SMEST
Match: SMESG000027783.1 (SMESG000027783.1)

HSP 1 Score: 229.565 bits (584), Expect = 1.350e-76
Identity = 157/158 (99.37%), Postives = 157/158 (99.37%), Query Frame = 2
Query:   11 MDAYRDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNXXXXXXXXXXXXXXXXXXXXXXXXXFQRFSTP-MIEEIAQDNQSVSQPLGFQ 481
            MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTP MIEEIAQDNQSVSQPLGFQ
Sbjct:    1 MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTPAMIEEIAQDNQSVSQPLGFQ 158          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Planmine SMEST
Match: SMESG000027783.1 (SMESG000027783.1)

HSP 1 Score: 227.254 bits (578), Expect = 9.426e-76
Identity = 156/157 (99.36%), Postives = 156/157 (99.36%), Query Frame = 2
Query:   11 MDAYRDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNXXXXXXXXXXXXXXXXXXXXXXXXXFQRFSTP-MIEEIAQDNQSVSQPLGF 478
            MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTP MIEEIAQDNQSVSQPLGF
Sbjct:    1 MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTPAMIEEIAQDNQSVSQPLGF 157          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Planmine SMEST
Match: SMESG000027783.1 (SMESG000027783.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.258e-58
Identity = 138/158 (87.34%), Postives = 139/158 (87.97%), Query Frame = 2
Query:   11 MDAYRDPCPWRILSDXXXXXXXXXXXXXLFSFVSGCKNAPPGFSKKFVSGITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNXXXXXXXXXXXXXXXXXXXXXXXXXFQRFSTP-MIEEIAQDNQSVSQPLGFQ 481
            MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSK                  +FAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTP MIEEIAQDNQSVSQPLGFQ
Sbjct:    1 MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSK------------------NFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTPAMIEEIAQDNQSVSQPLGFQ 140          
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Planmine SMEST
Match: SMESG000027783.1 (SMESG000027783.1)

HSP 1 Score: 131.339 bits (329), Expect = 9.186e-39
Identity = 94/95 (98.95%), Postives = 94/95 (98.95%), Query Frame = 2
Query:  200 SFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNXXXXXXXXXXXXXXXXXXXXXXXXXFQRFSTP-MIEEIAQDNQSVSQPLGFQ 481
            SFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTP MIEEIAQDNQSVSQPLGFQ
Sbjct:   10 SFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGALLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTPAMIEEIAQDNQSVSQPLGFQ 104          
The following BLAST results are available for this feature:
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIMM17A3.535e-2954.21translocase of inner mitochondrial membrane 17A [S... [more]
TIMM17B6.369e-2753.27translocase of inner mitochondrial membrane 17B [S... [more]
TIMM17B1.215e-1736.31translocase of inner mitochondrial membrane 17B [S... [more]
TIMM17B1.215e-1736.31translocase of inner mitochondrial membrane 17B [S... [more]
TIMM17B1.002e-1650.77translocase of inner mitochondrial membrane 17B [S... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
timm-17B.11.948e-2150.47Probable mitochondrial import inner membrane trans... [more]
timm-17B.21.105e-1150.00Translocase, Inner Mitochondrial Membrane [Source... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tim17b3.348e-3156.07gene:FBgn0263977 transcript:FBtr0113895[more]
Tim17b3.348e-3156.07gene:FBgn0263977 transcript:FBtr0345179[more]
Tim17b28.440e-3056.07gene:FBgn0020371 transcript:FBtr0089699[more]
Tim17b28.440e-3056.07gene:FBgn0020371 transcript:FBtr0343734[more]
CG17241.236e-2854.21gene:FBgn0031164 transcript:FBtr0077257[more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
timm17a4.523e-2955.14translocase of inner mitochondrial membrane 17 hom... [more]
timm17a4.523e-2955.14translocase of inner mitochondrial membrane 17 hom... [more]
timm17b4.666e-2855.14translocase of inner mitochondrial membrane 17 hom... [more]
timm17a9.964e-2048.61translocase of inner mitochondrial membrane 17 hom... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pth1r5.688e-2953.27parathyroid hormone 1 receptor [Source:Xenbase;Acc... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Timm17a4.954e-2954.21translocase of inner mitochondrial membrane 17a [S... [more]
Timm17b2.647e-2854.21translocase of inner mitochondrial membrane 17b [S... [more]
Timm17b2.092e-2454.08translocase of inner mitochondrial membrane 17b [S... [more]
Timm17a3.667e-2350.00translocase of inner mitochondrial membrane 17a [S... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99595|TI17A_HUMAN1.698e-2854.21Mitochondrial import inner membrane translocase su... [more]
sp|Q9Z0V8|TI17A_MOUSE3.465e-2854.21Mitochondrial import inner membrane translocase su... [more]
sp|O35092|TI17A_RAT1.604e-2753.27Mitochondrial import inner membrane translocase su... [more]
sp|Q9Z0V7|TI17B_MOUSE1.852e-2754.21Mitochondrial import inner membrane translocase su... [more]
sp|Q2HJE9|TI17B_BOVIN5.836e-2753.27Mitochondrial import inner membrane translocase su... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1E1WKI13.692e-3457.32Uncharacterized protein OS=Pectinophora gossypiell... [more]
A0A2A4J4456.722e-3464.49Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A0L7LUX67.374e-3464.49Mitochondrial import inner membrane translocase OS... [more]
A0A212EI539.515e-3464.49Mitochondrial import inner membrane translocase OS... [more]
A0A2H1WZD12.124e-3362.62SFRICE_009093 OS=Spodoptera frugiperda OX=7108 GN=... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
timm17a2.790e-2955.14translocase of inner mitochondrial membrane 17A [S... [more]
timm17b3.854e-2754.21translocase of inner mitochondrial membrane 17 hom... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
timm17b3.250e-2957.84translocase of inner mitochondrial membrane 17 hom... [more]
timm17b8.183e-2555.10translocase of inner mitochondrial membrane 17 hom... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TIM171.666e-2149.52Essential component of the TIM23 complex; with Tim... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO480952.644e-2757.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
timm17a1.012e-3057.94translocase of inner mitochondrial membrane 17A [S... [more]
timm17b2.630e-2755.88translocase of inner mitochondrial membrane 17B [S... [more]
timm17a1.307e-2658.16translocase of inner mitochondrial membrane 17A [S... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027783.12.245e-78100.00SMESG000027783.1[more]
SMESG000027783.11.350e-7699.37SMESG000027783.1[more]
SMESG000027783.19.426e-7699.36SMESG000027783.1[more]
SMESG000027783.11.258e-5887.34SMESG000027783.1[more]
SMESG000027783.19.186e-3998.95SMESG000027783.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003672 ID=SMED30003672|Name=Mitochondrial import inner membrane translocase subunit TIM17|organism=Schmidtea mediterranea sexual|type=transcript|length=775bp
TTCACATTAAATGGATGCATATAGAGATCCTTGTCCTTGGCGAATTTTAA
GCGACGCTGGAGGAGCTTATGCAATGGGCGCAATAGGAGGGGGATTGTTC
AGTTTTGTATCAGGTTGTAAAAATGCACCACCAGGATTCTCAAAAAAATT
TGTCAGTGGAATTACAAAATTTAAAGCTAAAAGTCCTGTTTTTGGAGGTA
GTTTTGCGATGTGGGGTGGAATGTTTTCATGCATGGATTGCTCGCTCATA
TTTCTTCGTCAAAAAGAAGATCCGTGGAATTCAATTATGGCTGGAGCTTC
TACTGGTGCGCTATTAGCAGTTCGAAATGGCGTTCCTGCAATAATTGGGC
AAGCTATTGTGGGTGGCGTGCTACTCGGTATTATTGAAGGCTGTGGAATT
TTATTTCAGCGATTCAGTACACCGATGATTGAAGAAATAGCTCAAGATAA
TCAATCTGTTTCTCAGCCACTAGGGTTTCAATAATATCTCATTTTTAAAG
ATCAAATAATAGAGTATCTTTAGTTTTTAATCAGAAAAAAGTTGAATAAA
ATACTAAATTTTATTTCTAATGCGTAATTACAATTACAGTGTTATATTAA
GTGAAATGTAGTAACTGGACTCTCCATGTCTCTTGAATGCATTGAATTTT
CTCTATATTGATTCCATATTTTTTGATTGAATTTTTGCGACAGATTGTTC
CTTAAAAATTTGCTTTATTTCGCTTTTACTTTTAATACTTACTGAATAGT
TACTTCTAAAAATTATAAAATTGCG
back to top

protein sequence of SMED30003672-orf-1

>SMED30003672-orf-1 ID=SMED30003672-orf-1|Name=SMED30003672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=158bp
MDAYRDPCPWRILSDAGGAYAMGAIGGGLFSFVSGCKNAPPGFSKKFVSG
ITKFKAKSPVFGGSFAMWGGMFSCMDCSLIFLRQKEDPWNSIMAGASTGA
LLAVRNGVPAIIGQAIVGGVLLGIIEGCGILFQRFSTPMIEEIAQDNQSV
SQPLGFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005744mitochondrial inner membrane presequence translocase complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0015031protein transport
GO:0071806protein transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015450P-P-bond-hydrolysis-driven protein transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR003397Tim17/Tim22/Tim23/PMP24
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF02466Tim17coord: 13..121
e-value: 1.7E-27
score: 96.0
NoneNo IPR availablePANTHERPTHR10485:SF0AT05822P-RELATEDcoord: 2..142
NoneNo IPR availablePANTHERPTHR10485MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM-17coord: 2..142
NoneNo IPR availableTMHMMTMhelixcoord: 60..82
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 103..125