WIF domain-containing protein

Overview
NameWIF domain-containing protein
Smed IDSMED30003669
Length (bp)852
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WIF domain-containing protein (SMED30003669) t-SNE clustered cells

Violin plots show distribution of expression levels for WIF domain-containing protein (SMED30003669) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WIF domain-containing protein (SMED30003669) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WIF domain-containing protein (SMED30003669) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003669

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003669SMESG000004981.1 SmedASXL_008514SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30003669SMESG000004981.1 dd_Smed_v6_25158_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30003669SMESG000004981.1 OX_Smed_1.0.11087ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30003669SMESG000004983.1 SMESG000004982.1 SMESG000004981.1 Contig44648newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003669SMESG000004983.1 SMESG000004982.1 SMESG000004981.1 Contig44648uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WIF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0340090)

HSP 1 Score: 69.3218 bits (168), Expect = 4.709e-13
Identity = 41/146 (28.08%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  253 SKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFY-YVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCG----CKKH 675
            S+  Y IH  +V T  +    L NF  IPS+++ +N  WK+G +  FY + + ++ +++IL  P L+I   G +P +  +  + LPC+G  SG    ++     +  ++        L F K+C   +     S+KCG    C +H
Sbjct:  139 SERLYAIHNSRV-TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRAPDPECSLKCGKNGYCNEH 283          
BLAST of WIF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0340089)

HSP 1 Score: 69.3218 bits (168), Expect = 4.761e-13
Identity = 42/146 (28.77%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  253 SKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFY-YVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCG----CKKH 675
            S+  Y IH  +V T  +    L NF  IPS+++ +N  WK+G +  FY + + ++ +++IL  P L+I   G +P +  +  + LPC+G  SG    ++     +  ++        L F K+C      R  S+KCG    C +H
Sbjct:  139 SERLYAIHNSRV-TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECA----HRECSLKCGKNGYCNEH 279          
BLAST of WIF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0070978)

HSP 1 Score: 64.6994 bits (156), Expect = 1.874e-11
Identity = 45/161 (27.95%), Postives = 75/161 (46.58%), Query Frame = 1
Query:  253 SKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFY-YVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQC---------------LTTSQRRRLSIKCG----CKKH 675
            S+  Y IH  +V T  +    L NF  IPS+++ +N  WK+G +  FY + + ++ +++IL  P L+I   G +P +  +  + LPC+G  SG    ++     +  ++        L F K+C               LTT Q    S+KCG    C +H
Sbjct:  139 SERLYAIHNSRV-TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQ--ECSLKCGKNGYCNEH 296          
BLAST of WIF domain-containing protein vs. Ensembl Fly
Match: shf (gene:FBgn0003390 transcript:FBtr0340088)

HSP 1 Score: 64.3142 bits (155), Expect = 2.463e-11
Identity = 35/124 (28.23%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  253 SKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFY-YVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQC 621
            S+  Y IH  +V T  +    L NF  IPS+++ +N  WK+G +  FY + + ++ +++IL  P L+I   G +P +  +  + LPC+G  SG    ++     +  ++        L F K+C
Sbjct:  139 SERLYAIHNSRV-TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKEC 261          
BLAST of WIF domain-containing protein vs. Ensembl Fly
Match: dnt (gene:FBgn0024245 transcript:FBtr0336820)

HSP 1 Score: 47.7506 bits (112), Expect = 7.537e-6
Identity = 27/103 (26.21%), Postives = 54/103 (52.43%), Query Frame = 1
Query:  250 ISKETYVIHKGKVDTTSIAKAGLSNF-YPIPSQLDVINAQWKA-GSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSF 552
            +S E Y + +G ++  ++      NF  P+P+ +  I+  W++   +G+ Y +   S +Q +L +P +N+S  G +P    +  + L CSG  + +V V +S 
Sbjct:   62 VSAEVYYVREGHINNYAL------NFIVPVPANVKDISFTWQSLAGRGLPYSINVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKCSGLKAAEVDVTVSL 158          
BLAST of WIF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W3W5|WIF1_DROME (Protein shifted OS=Drosophila melanogaster OX=7227 GN=shf PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 1.879e-10
Identity = 45/161 (27.95%), Postives = 75/161 (46.58%), Query Frame = 1
Query:  253 SKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFY-YVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQC---------------LTTSQRRRLSIKCG----CKKH 675
            S+  Y IH  +V T  +    L NF  IPS+++ +N  WK+G +  FY + + ++ +++IL  P L+I   G +P +  +  + LPC+G  SG    ++     +  ++        L F K+C               LTT Q    S+KCG    C +H
Sbjct:  139 SERLYAIHNSRV-TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQ--ECSLKCGKNGYCNEH 296          
BLAST of WIF domain-containing protein vs. TrEMBL
Match: A0A1S6KMJ2 (WIF domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 2.287e-152
Identity = 247/249 (99.20%), Postives = 248/249 (99.60%), Query Frame = 1
Query:   46 MSFFDKSCLVILMVVSAISLDDDQFNDLNMWXXXXXXXXXXXXXXXPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCXXXXXXXXXXXXXXXXXDCMRHCRKKVQLLGLKNALKQ 792
            MSFFDKSCLVILMVVSAISLDDDQFNDLNMWIERQQIIEIINLISIPKANQTYNPKRCPQNKKEAVKDI KETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHC+RVKIKRIKSKRSLRRKDCMRHCRKKVQLLGLKNALKQ
Sbjct:    1 MSFFDKSCLVILMVVSAISLDDDQFNDLNMWIERQQIIEIINLISIPKANQTYNPKRCPQNKKEAVKDILKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCKRVKIKRIKSKRSLRRKDCMRHCRKKVQLLGLKNALKQ 249          
BLAST of WIF domain-containing protein vs. TrEMBL
Match: A0A1S8X7A9 (WIF domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01478 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 5.276e-27
Identity = 56/181 (30.94%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  214 RCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCXXXXXXXXXXXXXXXXXDCMRHCRKK 756
            +CP+ + +    I ++ Y++  G + T  + K  LS   PIP ++DV+ A+W AG + + Y ++  S N  +L +PLLNI+P GFVP  +S +++TLPC+GK +G     +        +    +   +   YK CL+ +++ +  IKC C+  C R++ +     R      C+RHCR++
Sbjct:   72 KCPKTRPDIQNQIPEQLYLVFNGMLLTEVLEKISLSERRPIPPRIDVLRAKWLAGYERLTYNIELASLNHTLLHKPLLNIAPSGFVPESTSDVRITLPCTGKATGIAPFHVQLDIRREFEGLRKIPRISFIVYKYCLSAAKQNQFIIKCECRSRCSRMRPRSRGENRKA----CIRHCRRQ 248          
BLAST of WIF domain-containing protein vs. TrEMBL
Match: A0A075A0F7 (WIF domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10637 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 7.673e-27
Identity = 56/181 (30.94%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  214 RCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCXXXXXXXXXXXXXXXXXDCMRHCRKK 756
            +CP+ + +    I ++ Y++  G + T  + K  LS   PIP ++DV+ A+W AG + + Y ++  S N  +L +PLLNI+P GFVP  +S +++TLPC+GK +G     +        +    +   +   YK CL+ +++ +  IKC C+  C R++ +     R      C+RHCR++
Sbjct:   73 KCPKTRPDIQNQIPEQLYLVFNGMLLTEVLEKISLSERRPIPPRIDVLRAKWLAGYERLTYNIELASLNHTLLHKPLLNIAPSGFVPESTSDVRITLPCTGKATGIAPFHVQLDIRREFEGLRKIPRISFIVYKYCLSAAKQNQFIIKCECRSRCSRMRPRSRGENRKA----CIRHCRRQ 249          
BLAST of WIF domain-containing protein vs. TrEMBL
Match: A0A4S2MFV6 (WIF domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000243 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.169e-26
Identity = 59/185 (31.89%), Postives = 105/185 (56.76%), Query Frame = 1
Query:  214 RCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISG----KVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCXXXXXXXXXXXXXXXXXDCMRHCRKK 756
            +CP+ + +    I ++ Y++  G + T  + K  LS   PIP ++DV+ A+W AG + + Y ++  S N  +L +PLLNI+P GFVP  +S +++TLPC+GK +G    +V++D+   F   +     +   +   YK CL+ +++ +  IKC C+  C R++ +     R      C+RHCR++
Sbjct:   78 KCPKTRPDIQDQIPEQLYLVFNGMLLTEVLEKISLSERRPIPPRIDVLRAKWLAGYERLTYNIELASLNHTLLHKPLLNIAPSGFVPESTSDVRITLPCTGKATGIAPFQVQLDIRREFEGLRK----IPRISFIVYKYCLSAAKQNQFIIKCECRSKCARMRPRSRGENRKA----CIRHCRRQ 254          
BLAST of WIF domain-containing protein vs. TrEMBL
Match: A0A4S2MFV3 (WIF domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000243 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.295e-26
Identity = 59/185 (31.89%), Postives = 105/185 (56.76%), Query Frame = 1
Query:  214 RCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISG----KVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCXXXXXXXXXXXXXXXXXDCMRHCRKK 756
            +CP+ + +    I ++ Y++  G + T  + K  LS   PIP ++DV+ A+W AG + + Y ++  S N  +L +PLLNI+P GFVP  +S +++TLPC+GK +G    +V++D+   F   +     +   +   YK CL+ +++ +  IKC C+  C R++ +     R      C+RHCR++
Sbjct:   73 KCPKTRPDIQDQIPEQLYLVFNGMLLTEVLEKISLSERRPIPPRIDVLRAKWLAGYERLTYNIELASLNHTLLHKPLLNIAPSGFVPESTSDVRITLPCTGKATGIAPFQVQLDIRREFEGLRK----IPRISFIVYKYCLSAAKQNQFIIKCECRSKCARMRPRSRGENRKA----CIRHCRRQ 249          
BLAST of WIF domain-containing protein vs. Ensembl Cavefish
Match: ryk (receptor like tyrosine kinase [Source:NCBI gene;Acc:103023728])

HSP 1 Score: 48.1358 bits (113), Expect = 5.714e-6
Identity = 28/90 (31.11%), Postives = 47/90 (52.22%), Query Frame = 1
Query:  313 GLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFT 582
             LS   P+PS+ + ++  W + S+ V Y +    +N A + QP  NIS  G VP   S  ++ L CSGK+ G+  + +  + +   + FT
Sbjct:   97 ALSFILPVPSETNSLHFTWHSKSK-VDYKLGFHVENPAAMDQPQSNISTQGEVPRTRSVFRVDLFCSGKVDGEAVLTVQLNLTIHANNFT 185          
BLAST of WIF domain-containing protein vs. Planmine SMEST
Match: SMESG000004981.1 (SMESG000004981.1)

HSP 1 Score: 437.958 bits (1125), Expect = 4.337e-157
Identity = 249/249 (100.00%), Postives = 249/249 (100.00%), Query Frame = 1
Query:   46 MSFFDKSCLVILMVVSAISLDDDQFNDLNMWXXXXXXXXXXXXXXXPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCXXXXXXXXXXXXXXXXXDCMRHCRKKVQLLGLKNALKQ 792
            MSFFDKSCLVILMVVSAISLDDDQFNDLNMWIERQQIIEIINLISIPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCRRVKIKRIKSKRSLRRKDCMRHCRKKVQLLGLKNALKQ
Sbjct:    1 MSFFDKSCLVILMVVSAISLDDDQFNDLNMWIERQQIIEIINLISIPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCRRVKIKRIKSKRSLRRKDCMRHCRKKVQLLGLKNALKQ 249          
BLAST of WIF domain-containing protein vs. Planmine SMEST
Match: SMESG000004981.1 (SMESG000004981.1)

HSP 1 Score: 414.461 bits (1064), Expect = 5.205e-148
Identity = 237/237 (100.00%), Postives = 237/237 (100.00%), Query Frame = 1
Query:   82 MVVSAISLDDDQFNDLNMWXXXXXXXXXXXXXXXPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCXXXXXXXXXXXXXXXXXDCMRHCRKKVQLLGLKNALKQ 792
            MVVSAISLDDDQFNDLNMWIERQQIIEIINLISIPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCRRVKIKRIKSKRSLRRKDCMRHCRKKVQLLGLKNALKQ
Sbjct:    1 MVVSAISLDDDQFNDLNMWIERQQIIEIINLISIPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTSIAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLNISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFTLTFYKQCLTTSQRRRLSIKCGCKKHCRRVKIKRIKSKRSLRRKDCMRHCRKKVQLLGLKNALKQ 237          
The following BLAST results are available for this feature:
BLAST of WIF domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shf4.709e-1328.08gene:FBgn0003390 transcript:FBtr0340090[more]
shf4.761e-1328.77gene:FBgn0003390 transcript:FBtr0340089[more]
shf1.874e-1127.95gene:FBgn0003390 transcript:FBtr0070978[more]
shf2.463e-1128.23gene:FBgn0003390 transcript:FBtr0340088[more]
dnt7.537e-626.21gene:FBgn0024245 transcript:FBtr0336820[more]
back to top
BLAST of WIF domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9W3W5|WIF1_DROME1.879e-1027.95Protein shifted OS=Drosophila melanogaster OX=7227... [more]
back to top
BLAST of WIF domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMJ22.287e-15299.20WIF domain-containing protein OS=Schmidtea mediter... [more]
A0A1S8X7A95.276e-2730.94WIF domain-containing protein (Fragment) OS=Opisth... [more]
A0A075A0F77.673e-2730.94WIF domain-containing protein OS=Opisthorchis vive... [more]
A0A4S2MFV61.169e-2631.89WIF domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2MFV31.295e-2631.89WIF domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of WIF domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ryk5.714e-631.11receptor like tyrosine kinase [Source:NCBI gene;Ac... [more]
back to top
BLAST of WIF domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WIF domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000004981.14.337e-157100.00SMESG000004981.1[more]
SMESG000004981.15.205e-148100.00SMESG000004981.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003669 ID=SMED30003669|Name=WIF domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=852bp
ATGATTATATTTCAGAATTTATCAGAAATTTCTGAGAAGATTTCAATGAG
TTTCTTTGATAAAAGTTGTCTGGTCATTTTGATGGTAGTCAGTGCCATTT
CTTTGGACGATGATCAGTTCAATGATCTCAATATGTGGATTGAACGGCAA
CAGATTATTGAAATTATCAATTTGATCTCGATTCCTAAAGCCAACCAAAC
TTATAATCCTAAACGTTGCCCGCAAAATAAAAAGGAAGCAGTAAAAGATA
TTTCAAAAGAAACATATGTGATACATAAAGGCAAAGTTGATACAACATCT
ATTGCTAAAGCTGGACTAAGTAATTTTTATCCGATTCCAAGCCAACTTGA
TGTCATCAACGCCCAATGGAAGGCTGGATCTCAAGGGGTATTTTATTATG
TGAAATCGGAAAGTGACAACCAAGCGATCCTTTTTCAACCACTTCTGAAC
ATTTCACCATTCGGTTTTGTTCCGCCAAAATCTTCAAGTATAAAACTGAC
TCTTCCTTGCTCTGGAAAGATTTCAGGAAAAGTCAAAGTTGATTTAAGTT
TTTCGTTCAGTTCTCCAAAAGACAGATTCACTCCGGTCAAGGCGTTTACG
TTAACATTTTATAAGCAATGTCTGACAACAAGTCAAAGACGCCGATTAAG
CATCAAATGTGGTTGCAAAAAACATTGCAGAAGAGTCAAAATTAAAAGAA
TAAAATCTAAAAGATCGTTAAGACGAAAAGATTGTATGAGGCATTGTCGT
AAAAAGGTTCAATTGCTTGGATTGAAAAATGCTCTGAAGCAATAAATTTT
TATTCAAACTTTCACATATTTCAGTTTGATGAGTTTAACTTAATCGCTTT
TC
back to top

protein sequence of SMED30003669-orf-1

>SMED30003669-orf-1 ID=SMED30003669-orf-1|Name=SMED30003669-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=265bp
MIIFQNLSEISEKISMSFFDKSCLVILMVVSAISLDDDQFNDLNMWIERQ
QIIEIINLISIPKANQTYNPKRCPQNKKEAVKDISKETYVIHKGKVDTTS
IAKAGLSNFYPIPSQLDVINAQWKAGSQGVFYYVKSESDNQAILFQPLLN
ISPFGFVPPKSSSIKLTLPCSGKISGKVKVDLSFSFSSPKDRFTPVKAFT
LTFYKQCLTTSQRRRLSIKCGCKKHCRRVKIKRIKSKRSLRRKDCMRHCR
KKVQLLGLKNALKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038677WIF_sf
IPR003306WIF
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003306WIF domainSMARTSM00469WIF_1coord: 76..209
e-value: 9.6E-5
score: 30.1
IPR003306WIF domainPFAMPF02019WIFcoord: 78..196
e-value: 3.4E-18
score: 65.6
IPR003306WIF domainPROSITEPS50814WIFcoord: 71..207
score: 21.837
IPR038677WIF domain superfamilyGENE3DG3DSA:2.60.40.2170coord: 39..211
e-value: 3.1E-22
score: 80.6
NoneNo IPR availablePRODOMPD013948coord: 85..207
e-value: 5.0E-10
score: 154.0