HTH CENPB-type domain-containing protein

Overview
NameHTH CENPB-type domain-containing protein
Smed IDSMED30003654
Length (bp)3970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HTH CENPB-type domain-containing protein (SMED30003654) t-SNE clustered cells

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30003654) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HTH CENPB-type domain-containing protein (SMED30003654) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30003654) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003654

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30003654 dd_Smed_v4_10565_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 196.438 bits (498), Expect = 2.507e-52
Identity = 115/264 (43.56%), Postives = 166/264 (62.88%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICFV 1236
            R +LTL  K+E++K  + G    +I + L L   TV  + N     +KE  K+AT M + +  R R++++  ME  L +WI++Q  R +PLS+ +I+ KA ++++S++ +    + +  FE S GWF+RFK R++ HN+  + EAAS D  AAA +PE L  II +G Y  +QIFN  ET  +WK +P++T+I++  K+  GFKA K RLTLLLG N+AGD+K KP LIY SENPRALK   K  LPV Y+WN K  M    F 
Sbjct:   12 RTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKE-VKSATPM-NTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMKAERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFT 273          

HSP 2 Score: 151.754 bits (382), Expect = 1.661e-37
Identity = 97/288 (33.68%), Postives = 152/288 (52.78%), Query Frame = 3
Query: 1149 QSFKRYTKEKSSCILSME*KNLYDTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAA-----TEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAY----NSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSI 1985
            ++ K YTK     +     K     +LF  W +      + +Y  ++K+ FKIL+++DNA  HP  L ++ E I   ++P NTT+++QPMDQG IS  KSYYLR TF +  AA     ++G     +K FWK FTILD IK +  SW+EV   ++ G W+KL P  +++  E        V  +VV +   L++E +  ED+ ELL S+++ +T+ EL  ++    +     S   ++   IV    +T K L   I L+D     F++ D   ERS  V + + +SI
Sbjct:  245 RALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDD-YEGFKTSVEEVSADVVEIAKELELE-VEPEDVTELLQSHDKTLTDEELFLMDAQRKWFLEMESTPGEDAVNIV---EMTTKDLEYYINLVDKAAAGFERIDSNFERSSTVGKMLSNSI 527          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 124.79 bits (312), Expect = 7.927e-49
Identity = 80/272 (29.41%), Postives = 144/272 (52.94%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIR-NRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            M+GKRK  R  LT++ K++I+K+ + G  +  +A    +  TTV+ IR N++  I    + ++T +L+++ +  + ++  +++  +  W  +Q  +  P+S  I   +A+  + +L +       D  F PS GW  RFK R ++  ++++ E  +GD  A   F    ++ I       +QI+N  ETGLFWKCLP++  + K      G K+ ++R+T++   N+ G +K K  ++  ++ PR+ K T   NLPV Y   K   M L  F
Sbjct:    1 MSGKRK--RVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSM-KPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGM-------DGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIF 262          

HSP 2 Score: 91.6633 bits (226), Expect = 7.927e-49
Identity = 66/210 (31.43%), Postives = 108/210 (51.43%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFF--YLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQ-LENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEI 1838
            D ++FR W     + ++R Y   + L+ K +++LDN+  HPN+    S++ + F  YLPPN  +LIQP DQG I+  K  Y     +      EG D   +K FWK  T+LD +  +A++W+ V   +++  W+K+ P   E + L+ D  D I+V      L  T  +E +  E++E+ L     E+ ++E       P Y   +D EI
Sbjct:  258 DLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLE--EGND---LKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMVEEKESLDFDVED-ISVATVAAILQHTKGLENVTTENLEKWL-----EVDSTE-------PGYEVLTDSEI 449          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 107.457 bits (267), Expect = 9.340e-44
Identity = 71/259 (27.41%), Postives = 130/259 (50.19%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIK-ERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYY 1194
            M GKRK  R  LT++ K++I+K+ + G     ++    +  +TV+ I+     II    + + T  +S++ +  +S+   +++  +  W  +Q    +P+S  I   +AK  +D+L ++         F  S+GW  RFK R  +   + K     GD  AA  F    +  +       +QI+   +TGLFWKCLP++T   +  ++  G ++ ++R+ ++   N+ G +K    ++  ++ PRA KGT   NLPV Y
Sbjct:    1 MLGKRK--RVVLTIKDKLDIIKKLEEGISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSM-KSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQAKFFFDALGME-------GDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTY 249          

HSP 2 Score: 92.4337 bits (228), Expect = 9.340e-44
Identity = 71/247 (28.74%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPND--LDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEE-----MTNSELMEIEFHPAYNSNSDQEIE-EIVPEHTLTAKRLAQAIQLID*TLQIFDQDD 1934
            + ++FR W     + +++ +   + L  K +++LD     PN+  L      I   YLPPN T+LIQPM QG ++  K YY     ++     EG D    KIFWKN T+LD I  V+ +W+ V + ++   W+KL+P   EN   N     I   +    L  T + E + +E+I++  +S + +     +T+SE  E +   A    S +  + E+ PE  ++ K    A++  +  L   +Q D
Sbjct:  258 EQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYM--DEGNDP---KIFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEECEHVDIENIDQWFDSRSSDSSCQVLTDSESAEDQTKAAEQKPSSKSRKTELNPEKHISHK---AALEWTENLLDYLEQQD 496          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 107.457 bits (267), Expect = 9.340e-44
Identity = 71/259 (27.41%), Postives = 130/259 (50.19%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIK-ERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYY 1194
            M GKRK  R  LT++ K++I+K+ + G     ++    +  +TV+ I+     II    + + T  +S++ +  +S+   +++  +  W  +Q    +P+S  I   +AK  +D+L ++         F  S+GW  RFK R  +   + K     GD  AA  F    +  +       +QI+   +TGLFWKCLP++T   +  ++  G ++ ++R+ ++   N+ G +K    ++  ++ PRA KGT   NLPV Y
Sbjct:    1 MLGKRK--RVVLTIKDKLDIIKKLEEGISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSM-KSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQAKFFFDALGME-------GDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTY 249          

HSP 2 Score: 92.4337 bits (228), Expect = 9.340e-44
Identity = 71/247 (28.74%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPND--LDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEE-----MTNSELMEIEFHPAYNSNSDQEIE-EIVPEHTLTAKRLAQAIQLID*TLQIFDQDD 1934
            + ++FR W     + +++ +   + L  K +++LD     PN+  L      I   YLPPN T+LIQPM QG ++  K YY     ++     EG D    KIFWKN T+LD I  V+ +W+ V + ++   W+KL+P   EN   N     I   +    L  T + E + +E+I++  +S + +     +T+SE  E +   A    S +  + E+ PE  ++ K    A++  +  L   +Q D
Sbjct:  258 EQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYM--DEGNDP---KIFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEECEHVDIENIDQWFDSRSSDSSCQVLTDSESAEDQTKAAEQKPSSKSRKTELNPEKHISHK---AALEWTENLLDYLEQQD 496          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 110.923 bits (276), Expect = 3.022e-36
Identity = 80/256 (31.25%), Postives = 123/256 (48.05%), Query Frame = 1
Query:  430 KRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYR 1197
            KRK  R  LTL+ KI+I  R ++G     + +   +  +T+  IR   A +++  A + +    +Q     +  +  ++  L  W   +    +P+S  ++  KAK  Y+ ++L EP          S GW  RFK R  +  L    E  S D  AA  F    +++  +    A+Q++N  ETGLFW+CLP  T     G    G K GK RLT+L+  N+ G ++ KP  I     PRA KG Q  +LPV Y+
Sbjct:   14 KRK--RVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPCVF-------SGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPT---PEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKGIQ--HLPVAYK 255          

HSP 2 Score: 63.5438 bits (153), Expect = 3.022e-36
Identity = 37/138 (26.81%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKL--EFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWP 1625
            D  +F  W     +  +R +     L  + K +++LD++  HP + + +S N+   +LP +  +L+QPM+QG         +RR F   F        +P++     + + D I  VA +W+ V +      WRKLWP
Sbjct:  263 DKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVFTIFLPASVASLVQPMEQG---------IRRDFMRNFINPP----VPLQGPHARYNMNDAIFSVACAWNAVPSHVFRRAWRKLWP 387          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 97.0561 bits (240), Expect = 5.781e-34
Identity = 76/266 (28.57%), Postives = 136/266 (51.13%), Query Frame = 1
Query:  415 VNMNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIR-NRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKK 1209
            +  + KRK  R +L+++ K+ +L+  + G     +     +  +T+  ++  +D  +      +A ++++ + T ++ A  V ++  L  WI+++     PLS+ +I A+AK  +  L +  P        E S+GW+ +FK R  L  LS+  E AS +   A  F ++L  ++ D    A+Q++N  +  LFW+ LP K   +     + G +  K+RLT+L   N+AG +K +  +I  S NPRA KG   R  PV Y  NK+
Sbjct:  176 IPPDTKRK--RVSLSIKDKVTLLQDLENGASVKSLCDKYGIGTSTIYDLKKQKDKLLTFYSNSDAPDLMADRKTLHQ-AKNVSVDKVLMEWIRQRRRENFPLSRSLIMAQAKKFHVLLNISTP-------CEYSSGWYGKFKKRNGLSILSINGEKASEEYNVADNFVKKLNKLVSDEHLSAEQVYNAAKASLFWRHLPQKLVATAQKPPSSGLEDPKERLTVLACSNAAGTHKARLLVIGKSRNPRAFKGV--RVFPVTYTANKQ 429          

HSP 2 Score: 69.707 bits (169), Expect = 5.781e-34
Identity = 42/139 (30.22%), Postives = 69/139 (49.64%), Query Frame = 3
Query: 1227 LFRHWVSSCVISELRSYSDKEKL--EFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAI----SNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWP 1625
            +F+ W  +  + E R++     L  + K++++LD+   HP+    + +N+    LPP+ T+ IQP+DQG +    SN KS +L+R   E      G        F     I D I   AL+WD+V  +++   WR L P
Sbjct:  436 IFQDWFENHFVPEARAHCMSVGLSQDAKVMLILDHCPTHPSAEFLVKDNVFAVCLPPDCTSFIQPLDQGILRLFKSNYKSEFLQRMLTECNKGMAGAQ------FQAKANIKDAIWTAALAWDKVDKQALIHGWRNLCP 568          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000046714.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460367.1:582927:585046:-1 gene:ENSXETG00000018570.1 transcript:ENSXETT00000046714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 2.205e-18
Identity = 92/279 (32.97%), Postives = 130/279 (46.59%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKA-VDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQC---TRNRSAIMV----KMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            + GK+   RK+L+LE KI IL R D  H   V +AK L +  +T+        +IIK+RA  +TE  + +C    + R  +      +ME  L  W    +   +P+S I+++ KA  I   L +         +F  SNGW  RFK R N+   ++  E+ S D      +         +G Y  K IFN  ETGLF+  LP KT+  + G++  G K  K RLT+L   N+ G  K KP +I  S  PR  K      LP  Y  N K  M    F
Sbjct:    3 LTGKK---RKSLSLEEKIAILDRADSYHGTRVALAKELGIPVSTL-------GTIIKQRA--STEGSADKCGPQAKKRKYVTQSKYEQMEKLLQEWFAGLHASNVPISGIMLREKAVHIATRLGID--------NFTASNGWIDRFKKRYNVVYKAVCGESKSVDIDTVTNWKTNQLPCYLEG-YELKNIFNTDETGLFFNVLPGKTFCFR-GEDCHGGKLSKLRLTVLFTTNADGSEKLKPLVIGKSVKPRCFKNVN--TLPTNYTANTKAWMTTKLF 257          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: apmapl (adipocyte plasma membrane associated protein LIKE [Source:Xenbase;Acc:XB-GENE-5754317])

HSP 1 Score: 51.6026 bits (122), Expect = 6.994e-6
Identity = 36/130 (27.69%), Postives = 56/130 (43.08%), Query Frame = 3
Query: 1227 LFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHP--NDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFW 1610
            L R W     +  ++ Y  +  L+ K +++++   G P   DL     NI+  +L   T + I  MDQG IS+ K  Y R    EL       D+ P   F  +F + D I     SW+ +   S+   W
Sbjct:  228 LLREWFLEEFVPAVKRYLKRCCLQQKAVLLVNQCPGKPPEEDLQTADGNIRVLFLSKTTRSKIPSMDQGVISSFKQLYRR----ELLKLMVSCDSSPSD-FVTSFRLKDMIYLAGQSWNMIQAGSIEKCW 352          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 127.872 bits (320), Expect = 2.867e-49
Identity = 81/272 (29.78%), Postives = 143/272 (52.57%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIR-NRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            M+GKRK  R  LT++ K++I+K+ + G  +  +A    +  TTV+ IR N++  I    + ++T +L+++ +  + ++  +++  +  W  +Q  +  P+S  I   +A+  + +L +       D  F PS GW  RFK R ++  ++++ E  +GD  A   F    ++ I       +QI+N  ETGLFWKCLP++T + K      G   G++R+T++   N+ G +K K  ++  +  PR+ K T   NLPV Y   K   M L  F
Sbjct:    1 MSGKRK--RVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSM-KPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGM-------DGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIF 262          

HSP 2 Score: 89.7373 bits (221), Expect = 2.867e-49
Identity = 64/221 (28.96%), Postives = 116/221 (52.49%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFF--YLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEE-----MTNSELM-EIEFHPAYNSNSDQEIEEIVPE 1856
            D ++FR W     + ++R Y   + L+ K +++LDN+  HPN+    S++ + F  YLPPN  +LIQP+ QG I+  K  Y            EG D   +K FWK  T+LD +  +A++W+ V   +++  W+++ P  +E +   D ++ I+       L  T  +E +  E++E+ L   + E     +T+SE++   +     +S +D+E  E++PE
Sbjct:  258 DLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNYRAGLLHNNLE--EGND---LKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKQILP-AIEEKEGLDFDEDISGATVATILQHTKGLENVTPENLEKWLEIDSTEPGYEVLTDSEIIRRAQGQTDESSENDEERIELIPE 472          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 108.227 bits (269), Expect = 3.630e-43
Identity = 70/259 (27.03%), Postives = 130/259 (50.19%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIK-ERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYY 1194
            M GKRK  R  LT++ K++I+K+ + G+    ++    +  +TV+ I+     II    + + T  +S++ +  +S+   +++  +  W  +Q    +P+S  I   +A+  +D+L ++         F  S+GW  RFK R  +   + K     GD  AA+ F    +  +       +QI+   +TGLFWKCLPT+T      ++   ++  ++R+ ++   N+ G +K    ++  ++ PRA KGT   NLPV Y
Sbjct:    1 MLGKRK--RVVLTIKDKLDIIKKLEEGNSFKKLSVLYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSM-KSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQARFFFDALGME-------GDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTY 249          

HSP 2 Score: 88.9669 bits (219), Expect = 3.630e-43
Identity = 53/182 (29.12%), Postives = 91/182 (50.00%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPND--LDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNS 1757
            + ++ + W   C + +++ +   + L  K +++LD  + HP +  L      I   YLPPN T+LIQPM QG ++  K YY     ++     EG D    K FWKN T+LD I   + +W+++ + ++   W+KL+P   EN   +     I   +    L  T   E + +E+IE+  +S
Sbjct:  258 EPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLSSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYM--DEGNDP---KTFWKNLTVLDAIYEASRAWNQIRSNTITRAWKKLFPGNEENPSVSIDEGAILAANLATVLQNTEDCEHVNIENIEQWFDS 434          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 97.8265 bits (242), Expect = 1.729e-32
Identity = 73/256 (28.52%), Postives = 119/256 (46.48%), Query Frame = 1
Query:  430 KRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYR 1197
            KRK  R  LTL+ KI+I  R +RG     + +   +  +T+  I+   A +++  A + +    +Q     +  +  ++  L  W   +    +P+S  ++  KAK  Y  +RL EP          S GW  RFK R  +  L    E  + D  AA  F    +++  +     +Q+++  ETGL W+CLP     +        FK GK RLT+L+  N+ G ++ KP  I     PRA +G Q  +LP+ Y+
Sbjct:   14 KRK--RVVLTLKEKIDICTRLERGESRKALMQEYNVGMSTLYDIKAHKAQLLRFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRLTEPCVF-------SGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPNS---APDDGTVPHFKQGKDRLTVLMCANATGSHRIKPLAIGKGGGPRAFRGIQ--HLPIAYK 255          

HSP 2 Score: 63.1586 bits (152), Expect = 1.729e-32
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKL--EFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKI--FWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWP 1625
            D  +F  W     +  +R +     L  + K +++LD++  H  + + +SEN+   +LP + T+L+QP +QG         +RR F  LF       N P+    F     I D I  VA +W+ V ++     WRKLWP
Sbjct:  263 DKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHSQESELVSENVFTIFLPSSVTSLLQPTEQG---------IRRAFMRLFI------NPPVAFQGFPTRHNINDAIVNVARAWNAVPSQVFQRAWRKLWP 387          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Tigd4 (tigger transposable element derived 4 [Source:MGI Symbol;Acc:MGI:2685264])

HSP 1 Score: 78.9518 bits (193), Expect = 1.826e-14
Identity = 73/270 (27.04%), Postives = 119/270 (44.07%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEML--SQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSE---DASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRD--GEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            +K+L++E KI+I+   + G K  +IA    +   ++  I        K++   A E L    +  R R+A    +E  L  W +      +P++  +           LRL+    ++      F+ SNGW  RFK R   + L  + +      ++        +N++     +Y+ K +FN  ETGL ++ LPT T+  K G+     K  K R+TL LG N  G  K    +I  +  PR  KG   ++LPVYY  N+   M    F
Sbjct:   18 KKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKN-----KDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPM-----------LRLKANDFAQKLGHNDFKCSNGWLDRFKSR---YGLVFRAQPVEATGISIDPSTVWYQNVLPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFK-GETCSVGKLCKDRITLALGTNMDGSEKLPLLIIGKNRAPRCFKGI--KSLPVYYEANRTAWMTAAIF 265          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Tigd5 (tigger transposable element derived 5 [Source:MGI Symbol;Acc:MGI:2145902])

HSP 1 Score: 66.2402 bits (160), Expect = 2.403e-10
Identity = 62/274 (22.63%), Postives = 124/274 (45.26%), Query Frame = 1
Query:  442 LRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHN--------------LSLKEEAA--SGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKK----RLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWN 1203
             RKA +++ K++ ++R   G +   + +   + G T++G    +  +     +   E+ +Q+  + R A   +++  +  W        +PLS  +I+A+A++    +         + +F+ S+GWF R++ R  + +                +KEE A   G  +   G P  L +   +G Y  +QI+N   TGL+W+ LP +      G + +     ++    R+T+LL  N  G +K KP +I    +P +L+   +   P  YR++
Sbjct:   62 FRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLDQLGGEVGTQR-KKMRLANEEEIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQI------YGPECTFKASHGWFWRWQKRHGISSQRIYGEAESPVAGPAPVKEEPAQSPGAVLVPDGAPATLPH--SEGGYGDEQIYNANVTGLYWRLLPEQASTPGTGDSKEPGGCSRRWRSDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYS 326          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.204e-51
Identity = 115/264 (43.56%), Postives = 166/264 (62.88%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICFV 1236
            R +LTL  K+E++K  + G    +I + L L   TV  + N     +KE  K+AT M + +  R R++++  ME  L +WI++Q  R +PLS+ +I+ KA ++++S++ +    + +  FE S GWF+RFK R++ HN+  + EAAS D  AAA +PE L  II +G Y  +QIFN  ET  +WK +P++T+I++  K+  GFKA K RLTLLLG N+AGD+K KP LIY SENPRALK   K  LPV Y+WN K  M    F 
Sbjct:   12 RTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKE-VKSATPM-NTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMKAERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFT 273          

HSP 2 Score: 151.754 bits (382), Expect = 7.978e-37
Identity = 97/288 (33.68%), Postives = 152/288 (52.78%), Query Frame = 3
Query: 1149 QSFKRYTKEKSSCILSME*KNLYDTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAA-----TEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAY----NSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSI 1985
            ++ K YTK     +     K     +LF  W +      + +Y  ++K+ FKIL+++DNA  HP  L ++ E I   ++P NTT+++QPMDQG IS  KSYYLR TF +  AA     ++G     +K FWK FTILD IK +  SW+EV   ++ G W+KL P  +++  E        V  +VV +   L++E +  ED+ ELL S+++ +T+ EL  ++    +     S   ++   IV    +T K L   I L+D     F++ D   ERS  V + + +SI
Sbjct:  245 RALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDD-YEGFKTSVEEVSADVVEIAKELELE-VEPEDVTELLQSHDKTLTDEELFLMDAQRKWFLEMESTPGEDAVNIV---EMTTKDLEYYINLVDKAAAGFERIDSNFERSSTVGKMLSNSI 527          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.752e-48
Identity = 81/272 (29.78%), Postives = 143/272 (52.57%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIR-NRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            M+GKRK  R  LT++ K++I+K+ + G  +  +A    +  TTV+ IR N++  I    + ++T +L+++ +  + ++  +++  +  W  +Q  +  P+S  I   +A+  + +L +       D  F PS GW  RFK R ++  ++++ E  +GD  A   F    ++ I       +QI+N  ETGLFWKCLP++T + K      G   G++R+T++   N+ G +K K  ++  +  PR+ K T   NLPV Y   K   M L  F
Sbjct:    1 MSGKRK--RVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSM-KPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGM-------DGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIF 262          

HSP 2 Score: 89.7373 bits (221), Expect = 1.752e-48
Identity = 64/221 (28.96%), Postives = 116/221 (52.49%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFF--YLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEE-----MTNSELM-EIEFHPAYNSNSDQEIEEIVPE 1856
            D ++FR W     + ++R Y   + L+ K +++LDN+  HPN+    S++ + F  YLPPN  +LIQP+ QG I+  K  Y            EG D   +K FWK  T+LD +  +A++W+ V   +++  W+++ P  +E +   D ++ I+       L  T  +E +  E++E+ L   + E     +T+SE++   +     +S +D+E  E++PE
Sbjct:  258 DLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNYRAGLLHNNLE--EGND---LKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKQILP-AIEEKEGLDFDEDISGATVATILQHTKGLENVTPENLEKWLEIDSTEPGYEVLTDSEIIRRAQGQTDESSENDEERIELIPE 472          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 3.511e-48
Identity = 80/272 (29.41%), Postives = 144/272 (52.94%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIR-NRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            M+GKRK  R  LT++ K++I+K+ + G  +  +A    +  TTV+ IR N++  I    + ++T +L+++ +  + ++  +++  +  W  +Q  +  P+S  I   +A+  + +L +       D  F PS GW  RFK R ++  ++++ E  +GD  A   F    ++ I       +QI+N  ETGLFWKCLP++  + K      G K+ ++R+T++   N+ G +K K  ++  ++ PR+ K T   NLPV Y   K   M L  F
Sbjct:    1 MSGKRK--RVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSM-KPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGM-------DGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIF 262          

HSP 2 Score: 91.6633 bits (226), Expect = 3.511e-48
Identity = 66/210 (31.43%), Postives = 108/210 (51.43%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFF--YLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQ-LENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEI 1838
            D ++FR W     + ++R Y   + L+ K +++LDN+  HPN+    S++ + F  YLPPN  +LIQP DQG I+  K  Y     +      EG D   +K FWK  T+LD +  +A++W+ V   +++  W+K+ P   E + L+ D  D I+V      L  T  +E +  E++E+ L     E+ ++E       P Y   +D EI
Sbjct:  258 DLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLE--EGND---LKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMVEEKESLDFDVED-ISVATVAAILQHTKGLENVTTENLEKWL-----EVDSTE-------PGYEVLTDSEI 449          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4W5G0|TIGD2_HUMAN (Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 4.137e-43
Identity = 71/259 (27.41%), Postives = 130/259 (50.19%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIK-ERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYY 1194
            M GKRK  R  LT++ K++I+K+ + G     ++    +  +TV+ I+     II    + + T  +S++ +  +S+   +++  +  W  +Q    +P+S  I   +AK  +D+L ++         F  S+GW  RFK R  +   + K     GD  AA  F    +  +       +QI+   +TGLFWKCLP++T   +  ++  G ++ ++R+ ++   N+ G +K    ++  ++ PRA KGT   NLPV Y
Sbjct:    1 MLGKRK--RVVLTIKDKLDIIKKLEEGISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSM-KSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQAKFFFDALGME-------GDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTY 249          

HSP 2 Score: 92.4337 bits (228), Expect = 4.137e-43
Identity = 71/247 (28.74%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPND--LDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEE-----MTNSELMEIEFHPAYNSNSDQEIE-EIVPEHTLTAKRLAQAIQLID*TLQIFDQDD 1934
            + ++FR W     + +++ +   + L  K +++LD     PN+  L      I   YLPPN T+LIQPM QG ++  K YY     ++     EG D    KIFWKN T+LD I  V+ +W+ V + ++   W+KL+P   EN   N     I   +    L  T + E + +E+I++  +S + +     +T+SE  E +   A    S +  + E+ PE  ++ K    A++  +  L   +Q D
Sbjct:  258 EQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYM--DEGNDP---KIFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEECEHVDIENIDQWFDSRSSDSSCQVLTDSESAEDQTKAAEQKPSSKSRKTELNPEKHISHK---AALEWTENLLDYLEQQD 496          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VBL1|TIGD2_MOUSE (Tigger transposable element-derived protein 2 OS=Mus musculus OX=10090 GN=Tigd2 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.218e-42
Identity = 70/259 (27.03%), Postives = 130/259 (50.19%), Query Frame = 1
Query:  421 MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIK-ERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYY 1194
            M GKRK  R  LT++ K++I+K+ + G+    ++    +  +TV+ I+     II    + + T  +S++ +  +S+   +++  +  W  +Q    +P+S  I   +A+  +D+L ++         F  S+GW  RFK R  +   + K     GD  AA+ F    +  +       +QI+   +TGLFWKCLPT+T      ++   ++  ++R+ ++   N+ G +K    ++  ++ PRA KGT   NLPV Y
Sbjct:    1 MLGKRK--RVVLTIKDKLDIIKKLEEGNSFKKLSVLYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSM-KSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQARFFFDALGME-------GDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTY 249          

HSP 2 Score: 88.9669 bits (219), Expect = 2.218e-42
Identity = 53/182 (29.12%), Postives = 91/182 (50.00%), Query Frame = 3
Query: 1218 DTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPND--LDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNS 1757
            + ++ + W   C + +++ +   + L  K +++LD  + HP +  L      I   YLPPN T+LIQPM QG ++  K YY     ++     EG D    K FWKN T+LD I   + +W+++ + ++   W+KL+P   EN   +     I   +    L  T   E + +E+IE+  +S
Sbjct:  258 EPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLSSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYM--DEGNDP---KTFWKNLTVLDAIYEASRAWNQIRSNTITRAWKKLFPGNEENPSVSIDEGAILAANLATVLQNTEDCEHVNIENIEQWFDS 434          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A401T1F0 (HTH CENPB-type domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0014986 PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 1.487e-117
Identity = 132/290 (45.52%), Postives = 188/290 (64.83%), Query Frame = 1
Query:  397 FCSNCTVNMNGKR-----------KYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            F     +NM+ KR           K  RK +TL +K+E+LKR + G +AVDI + L L  TTV+ IR  +A+ IK+ A++ T + + + +R RS++M  ME  L++WI++Q+ R++PLS ++I+AKAKS+YD L+ ++   S+  SF  S GWF RFK R+ LH++ +  E    +T AA+ F   LK II +G Y  KQ+FN  ETGL+WK +P  TYIS+  K A GFKA K RLT+LLGGN++GD+KFKP ++Y SE PRAL+G  K + PV +R NKK  M    F
Sbjct:  318 FNFESPLNMSQKRPASDGSESAAAKKTRKTITLAMKLEVLKRLEAGERAVDIGRELGLPPTTVRTIRG-NANKIKQSAQSVTPLSAGRVSRTRSSLMENMERLLSVWIEDQSQRQVPLSLMVIQAKAKSLYDDLQNEQGENSQSESFNASRGWFERFKKRSYLHSIKVTGEVVGANTEAASEFSIYLKKIIEEGGYSPKQVFNVDETGLYWKRMPRSTYISREEKTAPGFKAAKDRLTVLLGGNASGDFKFKPLVVYQSETPRALRGHSKEH-PVIWRSNKKAWMTGALF 605          

HSP 2 Score: 224.557 bits (571), Expect = 1.487e-117
Identity = 111/255 (43.53%), Postives = 166/255 (65.10%), Query Frame = 3
Query: 1227 LFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIH-EVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSIN 1988
            LF+ W S   I   R Y  +E L FKIL++LDN  GHP +LD LSEN+K  +LPPNT +L+QPM QGA++  K+YYLRRTF +L   T+G +   ++ FW+ + IL+GI  +A SW+EVT+  +N  WRKLWPECV ++    + DT+  I  E++ L   +  + +   D+ ELL S+ EE++N +LM++E   A     +++  EI P   L+ KRL++A Q+++  ++IF +DDP +ERS KV+RA+   IN
Sbjct:  604 LFQEWFSVYAIPAWREYCARENLSFKILLLLDNCPGHPINLDDLSENVKVIFLPPNTASLLQPMVQGAVATFKAYYLRRTFSQLIYETDGENAPSVREFWRGYNILEGINNIADSWNEVTSSCLNSVWRKLWPECVSDK--GGSPDTVPEIQREIIALARAVGFDEVDETDVVELLESHGEELSNEDLMQLESQRA----EEEDRIEIPPPQILSTKRLSRAFQIMEEAMEIFTEDDPNRERSAKVNRAINDGIN 852          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: F7CP89 (HTH CENPB-type domain-containing protein OS=Ornithorhynchus anatinus OX=9258 GN=TIGD1 PE=4 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 8.235e-100
Identity = 117/273 (42.86%), Postives = 171/273 (62.64%), Query Frame = 1
Query:  415 VNMNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
             +M    K  RK+L+L +K+++LK  D G + +D+ KA  L+G+TV+ I  R+A+ I+E  K  T + + + +R R  IMV ME  L++WI+EQ  RR+PLS + I+AKA+S+++ L+   P+ S    F+ S GWF RF  RA LHN++   E A  +   A  F   L  +I +  Y  +Q+FN  ETGL+WK +P +TYIS   K   GFK  K RLTLL+GGN+AGD+K KP ++Y SENP AL+G  K  LPV ++ N+K  +  + F
Sbjct:    9 ASMASAEKKHRKSLSLAVKLDVLKCLDSGERQIDVCKAFGLAGSTVRTI-IRNAAKIREFGKTTTPLTAAKLSRARPPIMVDMERLLSIWIEEQTRRRIPLSFLSIQAKARSLHERLQRDLPKGSTVDEFKASQGWFDRFNRRAQLHNVAGSGEGAGLNAEGATAFKRTLAKLIAEEGYGPRQVFNVDETGLYWKRMPRRTYISVKEKMTPGFKVSKDRLTLLVGGNAAGDFKLKPLVVYHSENPVALRGFSKSFLPVLWKANRKARITRVVF 280          

HSP 2 Score: 182.956 bits (463), Expect = 8.235e-100
Identity = 88/255 (34.51%), Postives = 154/255 (60.39%), Query Frame = 3
Query: 1227 LFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHE-VVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSIN 1988
            +F +W +S     ++ Y  K  L  K L++LD++ GHP  LD LS+++K  +LPP+T +++QPMDQG I++ K+ Y  +TF++   A +G   + +  FWK++ I   ++ +A SWDE+T+++MNG W++LW +CV  + E   + T+  + E +V LG  L +  +   DI+EL+ S+ EE+++ +L+ ++   A         +E  P  TLT   L +A +L++    IF ++DP  +RS  V RA+ S++N
Sbjct:  279 VFENWFTSYFCPAVKMYCAKNNLAHKALLLLDSSPGHPTTLDDLSQDVKVIFLPPDTASILQPMDQGVIADFKARYTHQTFEQAVRAADGEKALSLPEFWKDYNIRHAVENIASSWDEITSRAMNGAWQRLWSDCVP-EFEG-FDQTLQAVRENIVALGKRLGMGDLEPSDIDELIESHQEELSDEDLVSMDQQRALEEGRPSHSDEEAPARTLTTAHLGRAFELLEEACSIFSENDPNVDRSAAVIRALHSAVN 531          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A4X2L2R9 (HTH CENPB-type domain-containing protein OS=Vombatus ursinus OX=29139 GN=LOC114040919 PE=4 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.378e-97
Identity = 124/264 (46.97%), Postives = 176/264 (66.67%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIR-NRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            RK++TL +K+E+L+RF+ G K   IAK L L+ +TV  IR NR+   IK  ++ AT + + Q TR R  +M  ME  L+LWI++Q  + +P++ ++I+ KAKS++++L+ +   +++  +F  SNGWF RFK+R   HN+ L +E A  DT AA  +P+ L+ II DG Y  +Q+FN  ETGLFWK LP +T++S   K   GFKA K  LTLLLGGN+AGD K KP L+Y SENPRALKG  K NLPV +R N+   + +  F
Sbjct:   22 RKSITLHVKLEVLRRFEEGQKLTQIAKTLGLATSTVASIRVNREK--IKANSQAATPISATQLTRCRGVVMGNMERLLSLWIEDQKQQHLPINTMLIQEKAKSLFETLKREHGESAQTETFGASNGWFARFKVR---HNVLLTDEPAVADTEAARRYPDVLRKIIEDGGYTPQQVFNIDETGLFWKRLPERTFVSLEDKAGPGFKASKDHLTLLLGGNAAGDCKLKPLLVYPSENPRALKGCSKPNLPVIWRSNRNDWVTMSIF 280          

HSP 2 Score: 157.147 bits (396), Expect = 1.378e-97
Identity = 84/255 (32.94%), Postives = 140/255 (54.90%), Query Frame = 3
Query: 1224 NLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSIN 1988
            ++F+ W ++     +  +  +  L  K L++LD+A  HP  LD LS N++  +LP NT+ALIQPM+QG I+  K++YL+RT  +L   T+G +   ++ FW+++ I+  +  +A +W E+   +MN  W+K+WPECV    E +       + ++VG G    +EG+  ED+  LL S  E+++   L         +S    +   +     L+ + LA+A+   D  LQI   +DP +ERS KV R V S I+
Sbjct:  278 SIFQEWFTNFFCPAVERHCAENHLPNKALLILDSAPCHPVYLDDLSANVRVEFLPKNTSALIQPMNQGVITTFKAFYLKRTLCQLIQETDGEERPTIREFWRSYNIMTAVDNIAEAWQELKPSTMNAVWKKIWPECVRASSEAE------ALPQIVGHGG---LEGVVEEDVVHLLQSQGEDLSGEGL-------GMSSPGTGQDNTLATPPELSTRHLAEALSHFDQGLQILSDNDPNRERSLKVCRGVNSVIS 516          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A3P8SAK2 (HTH CENPB-type domain-containing protein OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 2.789e-97
Identity = 121/263 (46.01%), Postives = 176/263 (66.92%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            RKA+++E+K++I++R ++G +  +I + L L+ TTV  I   D   I E  + +  M S   T+ RS ++++ME  L LW+++Q  R +P+S  + + KA+S+++ L+ ++   SE   F  S GWF+RFK RANLHN  ++ EAASGD  A + FP  L  IIR+G Y A+Q+FN  ETGLFWK +P +TYI+K  + A G+KA K+RLTLLLG N+AGD+K KP L+Y +ENPRALKG  K  LP+ +R NKK  + L  F
Sbjct:   18 RKAISMEVKLDIIRRSEKGERPTNIGRLLGLNRTTVSTIIG-DKKRILEHVRRSAPMKSTVITKQRSGLILEMERLLVLWLEDQQQRCIPVSLRLTQEKARSLFEKLKREKGEGSEREEFGASKGWFMRFKARANLHNFKVQREAASGDYKARSDFPSALAEIIREGGYCAEQVFNVDETGLFWKRMPARTYIAKEEETASGYKASKERLTLLLGANAAGDFKLKPLLVYLTENPRALKGIWKGQLPIIWRSNKKAWVTLEIF 279          

HSP 2 Score: 155.606 bits (392), Expect = 2.789e-97
Identity = 88/255 (34.51%), Postives = 142/255 (55.69%), Query Frame = 3
Query: 1227 LFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHE-VVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSIN 1988
            +F  W ++  + E+  Y     L FK+L++LD A GH   LD  + N++  YLPP+TT+L+QPMDQG I++ K+YYLR TF     ATE   ++ +  FWK++ IL  +K ++ SWDEV   ++NG W+ + P+ V N   N   +++  + E +V L   L +E +  +D++ELL S+ EE++  +L+++E             E        T+K LA    LI+  L  F+ +DP   R  KV+R V+  + 
Sbjct:  278 IFEDWFTNHFVPEVERYCALTGLPFKVLLLLDTAPGHSAHLDDFNPNVRVVYLPPDTTSLLQPMDQGVIASFKAYYLRTTFAMAVRATEKDKDLTLMNFWKSYDILTAVKNISDSWDEVQQTNLNGMWKNVCPQFVNNF--NGFEESVEAVTENIVDLSKQLHLE-VEADDVKELLASHEEELSAEDLIQLEKQMIEEEEETSTPE----PRGFTSKGLADGFALIEEGLAKFEAEDPNIARHTKVARKVMDCLQ 525          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: K7EX90 (HTH CENPB-type domain-containing protein OS=Pelodiscus sinensis OX=13735 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.835e-96
Identity = 103/260 (39.62%), Postives = 158/260 (60.77%), Query Frame = 3
Query: 1224 NLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSEL-----MEIEFHPAYNSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSIN 1988
            ++F  ++ + + +EL+ Y  +E L FKIL++LDNA GHP  L  LSENI+  +LPPNTT LIQP+DQG I+  K+YYLRR F  L   T+G +   +K FW+ F I D I  +A +W EV++  +N  WR++WP CV    E DT +      ++V L     +E +   D++ELL+S+ EE++  EL       +E  P Y        E ++   TL+ K +A+A +LI   + IFD++DP +ERS KV++++ S+I+
Sbjct:  270 SIFTDYLCNRLTAELKDYCLQEDLAFKILLLLDNAPGHPPCLTDLSENIRVLFLPPNTTPLIQPLDQGVIAAFKAYYLRRMFARLIRETDGENKPTIKEFWRKFNIKDAIDIIAEAWAEVSSSCLNAVWRRIWPACVHEFREFDT-EIAEAKKQIVALAHEAGLEEVDANDVQELLHSHGEELSIEELKLLDEQRLENEPEYT-------EPVI--RTLSMKVMAEAFKLISDAINIFDENDPDRERSSKVAKSLESAIS 519          

HSP 2 Score: 189.504 bits (480), Expect = 2.835e-96
Identity = 106/253 (41.90%), Postives = 164/253 (64.82%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWN 1203
            RK+ TLE K+E++KR ++G +  DI++ L +  ++V+ IR + A  IKE  KNAT +  ++  R RS +M  ME  L++WI++Q  R+MP+S  +I+ KAK++YD++++ E   ++   F  S+GWF RFK R+NLHN+ +   AA+ D  AA  FP   + II++G Y +KQ+FN  +TGLFWK +P +TY+S     A  FKA K  +T++L  N+ GD K K  +++ S NPRAL    K +LP ++R N
Sbjct:   12 RKSFTLEEKLEVIKRIEKGERNCDISRTLNMHESSVRTIRAQ-AEKIKESCKNATPVSVKKVVRTRSNLMENMERLLSMWIEDQTQRKMPMSLAVIQEKAKALYDAVKI-ELNETDAKPFNASHGWFERFKKRSNLHNIKITGGAAAADMEAAESFPAIFEAIIKEGGYSSKQVFNLDKTGLFWKRMPARTYLSHDEAYAPSFKAAKDHITVMLCTNANGDCKLKLIVVHCSANPRALASYSKDHLPGFWRSN 262          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003283.1 (pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gene:ENSPMAG00000003000.1 transcript:ENSPMAT00000003283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 7.058e-60
Identity = 89/264 (33.71%), Postives = 135/264 (51.14%), Query Frame = 3
Query: 1224 NLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVEN--QLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEI--EFHPAYNSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSINPIFSL 2003
             +F  +V   +  ELR Y  ++  +FKIL+V+DNA  HP  +  LSE IK  +LPP+TT+L+QPM QG I+  K+YYLRRTF  L  AT+G +N    + W++F I   I  +  +W ++T   +NG  RKL P  V +    E        +  + V L         G E +E    S+ EE++  EL ++  E   A   + D    E  P   LTA  L+ A+Q  +  +Q  + +D   +RS K+  A+ + + P   L
Sbjct:  241 QMFTDYVLETLQDELRRYCKRKNQDFKILLVVDNAPSHPPYIVDLSEQIKVVFLPPHTTSLLQPMGQGVIAAFKAYYLRRTFAMLIEATDG-ENSQASVTWRSFNIKQAIDIIVEAWTDITQPCLNGVCRKL-PHVVRDFRAFEAQQEQLKKIQIQCVALA-----RRAGFEKVEGAEESHREELSTEELQKLTAEVVAAIEEDDDDGDPEEAPPRELTAAILSSALQDFERGMQKLEDNDCNAKRSAKILPAIKAQLAPYVEL 497          

HSP 2 Score: 111.694 bits (278), Expect = 7.058e-60
Identity = 87/258 (33.72%), Postives = 137/258 (53.10%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCM 1218
            RKA+TLE K++++KR++R  +  DI +   L+ +T+     R +S  +++ + A  + + +  R R  I+ + E  L+LWI+ Q  RR   S + IK KA SIY+ L+ ++ +      F  S+ W   FK R +LHN  L  EAAS D   AA FP+ L  +I +G Y                        S     A G +A K RLT++LG N++G Y+ KP +++ S NPR LKG  + +L V++R +K+  M
Sbjct:   12 RKAITLEQKLDVIKRYERNERTHDIIRTTGLTESTL-----RTSSRCRKKLRKAN-ISASRSVRARPKIVEETERLLSLWIESQTKRRSGPSFLTIKQKALSIYEDLK-KKCKPDNVQPFNASSEWLAGFKKRFDLHNAKLTVEAASADAAVAANFPDALNRVIDEGGY------------------------SPDRATAPGLRAAKDRLTVMLGANASGGYRLKPVVVHHSANPRTLKGFVRADLGVHFRSSKRGWM 238          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 8.887e-57
Identity = 113/261 (43.30%), Postives = 163/261 (62.45%), Query Frame = 1
Query:  454 LTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICFV 1236
            LT+ +K  I++R++ G    DI+K+L L+ +TV GI ++ +  IK RA+  T +++ + TR RS +M  ME  L +WI+ QN  RMPLS  +I+AKA  +++  + +   ++ + +F  S GW+ +FK R NL +L +  E A  D  AA  F   LK II  G Y  +Q+FN  ETGLFWK +P  T++S+  K A GFKA K RL LL+G N+AGD K KP L+Y S+ PRALKG  K +LPV +R NKK  +    F+
Sbjct:   15 LTINMKKYIIRRYEGGETVRDISKSLGLATSTVCGI-HKASENIKARAQRMTPLVAAKLTRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQAKALRLFNDFKKRAGESAANETFGASTGWYAKFKGRYNLRHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETGLFWKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGCIKADLPVIWRSNKKGWITASVFL 274          

HSP 2 Score: 88.9669 bits (219), Expect = 2.051e-18
Identity = 66/261 (25.29%), Postives = 115/261 (44.06%), Query Frame = 3
Query: 1206 KNLYDTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQVEGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEIEEIVPEHTLTAKRLAQAIQLID*TLQIFDQDDPTQERSFKVSRAVISSIN 1988
            K     ++F  W+ +     +  Y  K+ L+ K L++L+NA GHP  L +LSE++                             R T +++ A T+  D   ++ FW+++ I+D I  +  +W+EV   ++N  W KLW EC  +       D +N IH +V L         G  ++E+             L+ +E         D       P  T T + LA+A + I+  L I+ ++DP QERS +V+R +  +++
Sbjct:  265 KGWITASVFLDWLKNHFCPAIEKYCKKKNLDHKALLLLNNAPGHPPTLSELSEHV-----------------------------RGTMEQIVANTDK-DVQTIREFWRSYNIMDAIDNINEAWNEVAQTTLNACWGKLWKECKHDL--TGLQDPVNDIHRIVEL-----ARNAGFHEVEQ----------RKGLVSVE-------EDDGAEATKTPTPTFTLRNLAEANRRIEEGLAIYARNDPNQERSSEVNRVIRKAMS 471          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 9.999e-54
Identity = 111/261 (42.53%), Postives = 157/261 (60.15%), Query Frame = 1
Query:  454 LTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICFV 1236
            LT+ +   I+++++ G    DI+K+L L+ +TV GIR + +  I+ +A+  T  ++    R RS +M  ME  L +WI+ QN  RMPLS  +I+ KA     +LRL+E R +E  +F  S GW+ +FK R NLH+L +  E A  D  AA  F   LK II  G Y  +Q+FN  ET LFWK +P  T++S+  K A GFKA K RL LL+G N AGD + KP L+Y S+ PR LKG  K +LP+ +R NKK  +    F+
Sbjct:   14 LTINMTKYIIRQYEGGETVRDISKSLGLATSTVCGIR-KASENIEAKAQRMTPFVAATLMRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQVKALIQAKALRLEESRQAE--TFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFL 270          

HSP 2 Score: 60.8474 bits (146), Expect = 1.011e-9
Identity = 40/165 (24.24%), Postives = 69/165 (41.82%), Query Frame = 3
Query: 1206 KNLYDTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLG 1700
            K     ++F  W+ +     +  Y  K+ L+ K L++ +NA GHP    +LSE++K      NT   +Q + +                                FW ++ I+D I  +  +W+EV   ++N +W KLW EC  +       + +N IH +V L 
Sbjct:  261 KGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPGHPPTPSELSEHVKIV---ANTDKDVQIIRE--------------------------------FWHSYNIMDAIDNINEAWNEVAQTTLNAYWGKLWKECKCDL--TGLQEPVNDIHRIVELA 388          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 1.044e-53
Identity = 111/261 (42.53%), Postives = 157/261 (60.15%), Query Frame = 1
Query:  454 LTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICFV 1236
            LT+ +   I+++++ G    DI+K+L L+ +TV GIR + +  I+ +A+  T  ++    R RS +M  ME  L +WI+ QN  RMPLS  +I+ KA     +LRL+E R +E  +F  S GW+ +FK R NLH+L +  E A  D  AA  F   LK II  G Y  +Q+FN  ET LFWK +P  T++S+  K A GFKA K RL LL+G N AGD + KP L+Y S+ PR LKG  K +LP+ +R NKK  +    F+
Sbjct:   15 LTINMTKYIIRQYEGGETVRDISKSLGLATSTVCGIR-KASENIEAKAQRMTPFVAATLMRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQVKALIQAKALRLEESRQAE--TFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFL 271          

HSP 2 Score: 60.8474 bits (146), Expect = 1.032e-9
Identity = 40/165 (24.24%), Postives = 69/165 (41.82%), Query Frame = 3
Query: 1206 KNLYDTNLFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLG 1700
            K     ++F  W+ +     +  Y  K+ L+ K L++ +NA GHP    +LSE++K      NT   +Q + +                                FW ++ I+D I  +  +W+EV   ++N +W KLW EC  +       + +N IH +V L 
Sbjct:  262 KGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPGHPPTPSELSEHVKIV---ANTDKDVQIIRE--------------------------------FWHSYNIMDAIDNINEAWNEVAQTTLNAYWGKLWKECKCDL--TGLQEPVNDIHRIVELA 389          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004972.1 (pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 gene:ENSPMAG00000004517.1 transcript:ENSPMAT00000004972.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 3.764e-50
Identity = 98/263 (37.26%), Postives = 139/263 (52.85%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCMILICF 1233
            RKA+TLE K++I+ + + G     IA+   LS +T+  I        K+R   A+ ++S    R R+  + +ME  L  W++++  +RMPLS + I+AKA+ ++  L+    +  +DA++  + G+ V  K   N H++ +   AAS D   A  F   L  II +  Y  +QIFN  ETG                K   GFKA K RLTLLLGGN A  YK KPF+IY S N RAL    K  LPV+YR NKK  M  + F
Sbjct:    6 RKAITLEQKMKIINQHEAGKAVTVIARDNQLSQSTISAIVKD-----KKRIMEASTIIS----RKRTEPLEEMEQLLVTWMEDRIQKRMPLSLLTIQAKARMLFYDLK----KRYDDATYNVTAGFSVS-KTCHNFHSIKISGAAASADAEGAERFKGELHKIIVEENYLPEQIFNVDETG-------------TDAKTMAGFKAFKDRLTLLLGGNVAV-YKLKPFMIYHSTNARALARISKNMLPVHYRHNKKAWMTAVLF 240          

HSP 2 Score: 98.9821 bits (245), Expect = 3.764e-50
Identity = 47/131 (35.88%), Postives = 74/131 (56.49%), Query Frame = 3
Query: 1227 LFRHWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKL 1619
            LF  W  +C I E++ +  K  + FKI+++LDNA GH   +     N+  F LPPNTT++IQPMDQGA++ S+          L +     +   +++ WK   +L+ I+ +  +W EVT + MNG W+ L
Sbjct:  239 LFEDWFVNCFIPEVKEHCRKNGIPFKIMLILDNAPGHLQYIGDNDPNVVVF-LPPNTTSIIQPMDQGAVATSQG---------LLSEKHATEEKELRMIWKESNVLNAIRNIGRAWKEVTKECMNGIWKNL 359          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 59.3066 bits (142), Expect = 4.187e-17
Identity = 67/263 (25.48%), Postives = 112/263 (42.59%), Query Frame = 1
Query:  445 RKALTLEIKIEILKRFDRGHKAV-DIAKALTLSGTTVKGIRNRDASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDA-----SFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVA--AAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKK 1209
            R+ L+L  KI+++     G K+   +A    +  TTV  I  +   I+K   +N      + CTR+  + + ++      W   Q Y RM            +      LQE   +  A      F  SNGW   F+ R   H +S     +  +T       + E++  +  DG Y +  I+N VETGL+++ LP K  + +    +       +RLT+ L  N  G+++ KP +I  + NP          LPV +R N++
Sbjct:    3 RRELSLSEKIQLIHESQTGTKSQRKLADIYQIGKTTVHEILKKKDDILKAYEQNVDGGRKRVCTRSAYSDINRLA-----W---QWYERM--------RAQGNQISGPMLQEKARTFAAELDMKDFRASNGWLEGFRRR---HGISFGASFSGYETSVNVTTEWTEKIMEVT-DG-YRSTDIYNLVETGLYYRALPDKNLVPETESTS------TERLTVTLCCNMDGEFE-KPLVIGPTANPPCFAKLDSECLPVIWRANRR 237          

HSP 2 Score: 48.521 bits (114), Expect = 4.187e-17
Identity = 37/129 (28.68%), Postives = 64/129 (49.61%), Query Frame = 3
Query: 1233 RHWVSSCVISE-LRSYSDK-EKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTA-LIQPMDQGAISNSKSYYLRRTFKELFAATEGID--NIP--MKIFWKNFTILDGIKFVALSWDEVTTKSM 1598
            R W+++ + ++ LR+   K  + + +IL+ LDN+  HP  L   +  + F   P N T   +QP+ QG +   +  Y R   K LF+    +D  N P   K   +  T LD   ++A + DE++  +M
Sbjct:  237 RAWITTSIFADWLRTLDRKMRQKDRRILLFLDNSPPHPPTLQLTNVKLVFLIKPSNNTVNQLQPLTQGIVEAFRMAYRR---KVLFSTLAKLDDSNSPRSAKQLMQEITELDACFWIAATLDEISGSTM 362          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 3.571e-53
Identity = 72/234 (30.77%), Postives = 131/234 (55.98%), Query Frame = 3
Query: 1236 HWVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDT-INVIHEVVGLGATLQVEG---MGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEIEE--------IVPEHTLTAKRLAQAIQLI 1901
            +W   C I E++ Y  ++ L+FK+L+++DNA G  +DL    + ++  +LPPNT++LIQPMDQG I   K+ Y R T + L  A +   N   K +W+ +TI   ++ +  +  E+ ++++NG W KLWPE V N  E+  ++   +V+   V L   L+ +G   +  +D+  L++++++ +T+ +L E+   P     S+ E+EE        +  E  LT   LA  ++++
Sbjct:  240 NWFKGCFIPEVKGYLTEKGLDFKVLLLIDNAGGFADDLS--HDGVQIEFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWREYTIASCLQHIQRAHQEMKSETLNGCWEKLWPEAVHNPTESRLDEIHRSVVETAVSLAKRLRGDGFDEITSDDVNSLIDAHSQPLTDEDLAEMTKPP-----SEGEVEEDKKAPSVDVDKEDGLTIDHLATMVRML 466          

HSP 2 Score: 97.8265 bits (242), Expect = 3.571e-53
Identity = 82/269 (30.48%), Postives = 131/269 (48.70%), Query Frame = 1
Query:  427 GKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNRDASIIKERA----KNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLXXXXXXXXXXXXYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPE-RLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCM 1218
            G  K  RK LT+  K+ +L     G     + +   L+ +TV+ I+  + +I +  A    K+A  +++    RN++  +++MES       + +    P +  +                   SE + F  S GWF +F+ R  L ++SL+ EA   D   A  + + + K II++G Y  +Q+FN  ETGLFWK +P++         A GF+  K R+TL++ GN+AG +  KP LI   +NPRALK      LPVY+  N    M
Sbjct:    3 GPPKRQRKMLTVTQKVGLLDMLKEGRSYSAVGRHYGLNESTVRYIKKEENNIRRTAAISFNKDAKRVVT---VRNKT--IIRMES-------QGDVEPSPSTSALH------------------SEPSPFYASKGWFDKFQKRFGLKSVSLQGEATPADAAGAEAYAKTKFKTIIKEGTYKPEQVFNMGETGLFWKQIPSQA-------KASGFRGQKDRVTLVMCGNAAG-FMIKPGLISRLKNPRALKNKNMSALPVYWMHNTMAWM 233          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 5.027e-50
Identity = 56/149 (37.58%), Postives = 90/149 (60.40%), Query Frame = 3
Query: 1239 WVSSCVISELRSYSDKEKLEFKILIVLDNASGHPNDLDKLSENIKFFYLPPNTTALIQPMDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVALSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHE 1685
            W  +C I +++ Y   + L+FK+L+++DNA GH +DL      IKF  LPPNTT+LIQPMDQG I   K+ Y R T + L  A +   +  +K +W+ +TI   ++ +  +  E+ T+++N  W+KLWPE V    +N T  +++ +H 
Sbjct:  202 WFKNCFIPQVKCYLRGKGLDFKVLLLVDNAGGHADDLAYDCVQIKF--LPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRGYTIASCLQNIQRAIQEMKTETLNACWKKLWPEAV----QNPTGGSLDEVHR 344          

HSP 2 Score: 102.834 bits (255), Expect = 5.027e-50
Identity = 61/144 (42.36%), Postives = 81/144 (56.25%), Query Frame = 1
Query:  787 SEDASFEPSNGWFVRFKIRANLHNLSLKEEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTYISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQKRNLPVYYRWNKKTCM 1218
            +E  +F  S GWF  FK +A ++N                    + K II +G Y  +QIFN  ETGLFWK +P++T+I +    A GFKA K RLTL+  GN+AG +  KP LIY S+NPRALK   K +L V + +N K  M
Sbjct:   72 AEPCAFNASKGWFENFKKQAFVNN--------------------KFKAIIEEGGYKPEQIFNIDETGLFWKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAG-FMIKPGLIYRSKNPRALKNKNKDDLHVCWMYNAKAWM 194          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000026733.1 (SMESG000026733.1)

HSP 1 Score: 128.642 bits (322), Expect = 2.491e-36
Identity = 67/110 (60.91%), Postives = 76/110 (69.09%), Query Frame = -2
Query: 2380 DDDRVTIRVDPGMAAKYRQSLWDAGYSLAVVGDNSWSIRASSRDDEIELPSFA-------NLAHETRQRTEFSLYRIEELEFIFHWKLSIV-RHFDPVNAAITNGEIPST 2685
            D+DRVTI+V P MAA+YRQSLWD  YSLA +GDNSW IR  SRD+EIEL S A       NLA E  QR EFSLYR+EEL   F WK+ +  RH   +NA I  GEIPST
Sbjct:    7 DEDRVTIKVTPDMAAQYRQSLWDVSYSLATLGDNSWPIRDKSRDNEIELLSLAIKREPDRNLAREPCQRAEFSLYRLEELVRKFQWKVRMTQRHLKQINATIATGEIPST 116          

HSP 2 Score: 45.0542 bits (105), Expect = 2.491e-36
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = -3
Query: 2253 PAQDVHAPKYGVSFE*NDPALTPMRAPTTMVLPAKLFDEPIRSRM 2387
            P+ D +A  YG+ FE NDP LT M   T  +LPA+LF+E IR ++
Sbjct:  114 PSTDGYAQDYGLLFELNDPVLTQMH--TNAILPAQLFNERIRHQI 156          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000026563.1 (SMESG000026563.1)

HSP 1 Score: 92.8189 bits (229), Expect = 6.263e-31
Identity = 51/119 (42.86%), Postives = 69/119 (57.98%), Query Frame = -2
Query: 2380 KRQEAGTCIDDDRVTIRVDPGMAAKYRQSLWDAGYSLAVVGDNSWSIRASSRDDEIELPSFA-------NLAHETRQRTEFSLYRIEELEFIFHWKLSIVRH-FDPVNAAITNGEIPST 2712
            +R   G   D+ RVT+++    AA+YRQ LWD GY L+  GD+SW  R+  + +EIELPS A       N A E RQR E++  ++EELE  +H K  + R     VN  I +G IPST
Sbjct:  619 RRDPHGNWSDNSRVTLQIPSASAARYRQVLWDNGYLLSTYGDSSWPRRSEYQAEEIELPSIAIKREPGHNPAREARQRAEYAAMKMEELERKYHRKAVLARQRLAQVNRDIASGAIPST 737          

HSP 2 Score: 62.3882 bits (150), Expect = 6.263e-31
Identity = 34/78 (43.59%), Postives = 44/78 (56.41%), Query Frame = -3
Query: 2154 PAQDVHAPKYGVSFE*NDPALTPMRAPTTMVLPAKLFDEPIRSRMDSRRCKDEH*YQRRHPMRTDKGDRMRPLYYKRR 2387
            P+ D   P+YGVSFE +DP LT M APT MV+P  L    +R+R+ SR+  D H Y  RHP    K +  R   +  R
Sbjct:  735 PSTDGFPPEYGVSFELDDPRLTQMTAPTKMVIPENLVQSTLRNRLGSRQTGD-HTYASRHPQWNSKHNNRRSERFNGR 811          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000027782.1 (SMESG000027782.1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.154e-30
Identity = 54/136 (39.71%), Postives = 75/136 (55.15%), Query Frame = -2
Query: 2380 CIKVNGTSNFSVFSANVKRQEAGTCIDDDRVTIRVDPGMAAKYRQSLWDAGYSLAVVGDNSWSIRASSRDDEIELPSFA-------NLAHETRQRTEFSLYRIEELEFIFHWKLSIVRH-FDPVNAAITNGEIPST 2763
             ++ NG         N +R   G+  D+ RVT+++    AA+YRQ LWD GY L+  GD+SW  R+  + +EIELPS A       N A E RQR E++  ++EELE  +H K  + R     VN  I +G IPST
Sbjct:   13 TLEENGELRIHFVREN-RRDPHGSWSDNSRVTLQIPSASAARYRQVLWDNGYLLSTYGDSSWPRRSKYQAEEIELPSIAIKREPGHNPAREARQRAEYAAMKMEELERKYHRKAVLARQRLAQVNRDIASGAIPST 147          

HSP 2 Score: 59.6918 bits (143), Expect = 2.154e-30
Identity = 31/61 (50.82%), Postives = 39/61 (63.93%), Query Frame = -3
Query: 2205 PAQDVHAPKYGVSFE*NDPALTPMRAPTTMVLPAKLFDEPIRSRMDSRRCKDEH*YQRRHP 2387
            P+ D   P+YGVSFE +DP L  M APT +VLP KL    +R+R+ SR+  D H Y  RHP
Sbjct:  145 PSTDGFPPEYGVSFELDDPRLMQMTAPTKLVLPEKLIQSTLRNRLGSRQTGD-HTYASRHP 204          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000077847.1 (SMESG000077847.1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.806e-30
Identity = 49/114 (42.98%), Postives = 67/114 (58.77%), Query Frame = -2
Query: 2380 GTCIDDDRVTIRVDPGMAAKYRQSLWDAGYSLAVVGDNSWSIRASSRDDEIELPSFA-------NLAHETRQRTEFSLYRIEELEFIFHWKLSIVRH-FDPVNAAITNGEIPST 2697
            G   D+ R+T+++    AA+YRQ LWD GY L+  GD+SW  R+  + +EIELPS A       N A E RQR E++  ++EELE  +H K  + R     VN  I +G IPST
Sbjct:  677 GNWSDNSRMTLQIPSASAARYRQVLWDNGYLLSTYGDSSWPRRSEYQAEEIELPSIAIKREPGHNPAREARQRAEYAAMKMEELERKYHRKAVLARQRLAQVNRDIASGAIPST 790          

HSP 2 Score: 62.7734 bits (151), Expect = 2.806e-30
Identity = 33/71 (46.48%), Postives = 42/71 (59.15%), Query Frame = -3
Query: 2175 PAQDVHAPKYGVSFE*NDPALTPMRAPTTMVLPAKLFDEPIRSRMDSRRCKDEH*YQRRHPMRTDKGDRMR 2387
            P+ D   P+YGVSFE +DP LT M APT MV+P  L    +R+R+ SR+  D H Y  RHP    K +  R
Sbjct:  788 PSTDGFPPEYGVSFELDDPRLTQMTAPTKMVIPENLVQSTLRNRLGSRQTGD-HTYASRHPQWNSKHNNRR 857          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000035366.1 (SMESG000035366.1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.449e-30
Identity = 51/119 (42.86%), Postives = 72/119 (60.50%), Query Frame = -2
Query: 2380 KRQEAGTCIDDDRVTIRVDPGMAAKYRQSLWDAGYSLAVVGDNSWSIRASSRDDEIELPSFA-------NLAHETRQRTEFSLYRIEELEFIFHWKLSIVRH-FDPVNAAITNGEIPST 2712
            +R + G+  D+ RVT+R+    AA+YRQ LWD GY L++ GD+SW  R+  + +E+ELPS A       N A E RQR EFS  ++E++E  +H K  + R     VN  I +G IPST
Sbjct:  660 RRDQYGSWNDNSRVTLRIPSASAARYRQVLWDNGYLLSIYGDSSWPRRSEYQAEEVELPSIAIKCEPGKNPAREARQRAEFSAMKMEQMEQKYHRKAVLARQRLAQVNWDIASGAIPST 778          

HSP 2 Score: 57.3806 bits (137), Expect = 3.449e-30
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = -3
Query: 2205 PAQDVHAPKYGVSFE*NDPALTPMRAPTTMVLPAKLFDEPIRSRMDSRRCKDEH*YQRRHP 2387
            P+ D   P+YGVSFE +DP L  M APT +VLP ++    +R+R+ SR+  D H Y  RHP
Sbjct:  776 PSTDGFPPEYGVSFELDDPRLLQMSAPTKLVLPERIIQSTLRNRLGSRQTGD-HMYTSRHP 835          
The following BLAST results are available for this feature:
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIGD12.507e-5243.56tigger transposable element derived 1 [Source:HGNC... [more]
JRKL7.927e-4929.41JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
TIGD29.340e-4427.41tigger transposable element derived 2 [Source:HGNC... [more]
TIGD29.340e-4427.41tigger transposable element derived 2 [Source:HGNC... [more]
JRK3.022e-3631.25Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kif65.781e-3428.57kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000046714.12.205e-1832.97pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
apmapl6.994e-627.69adipocyte plasma membrane associated protein LIKE ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jrkl2.867e-4929.78Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Tigd23.630e-4327.03tigger transposable element derived 2 [Source:MGI ... [more]
Jrk1.729e-3228.52jerky [Source:MGI Symbol;Acc:MGI:106214][more]
Tigd41.826e-1427.04tigger transposable element derived 4 [Source:MGI ... [more]
Tigd52.403e-1022.63tigger transposable element derived 5 [Source:MGI ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN1.204e-5143.56Tigger transposable element-derived protein 1 OS=H... [more]
sp|B2RRL2|JERKL_MOUSE1.752e-4829.78Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
sp|Q9Y4A0|JERKL_HUMAN3.511e-4829.41Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|Q4W5G0|TIGD2_HUMAN4.137e-4327.41Tigger transposable element-derived protein 2 OS=H... [more]
sp|Q0VBL1|TIGD2_MOUSE2.218e-4227.03Tigger transposable element-derived protein 2 OS=M... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A401T1F01.487e-11745.52HTH CENPB-type domain-containing protein OS=Chilos... [more]
F7CP898.235e-10042.86HTH CENPB-type domain-containing protein OS=Ornith... [more]
A0A4X2L2R91.378e-9746.97HTH CENPB-type domain-containing protein OS=Vombat... [more]
A0A3P8SAK22.789e-9746.01HTH CENPB-type domain-containing protein OS=Amphip... [more]
K7EX902.835e-9639.62HTH CENPB-type domain-containing protein OS=Pelodi... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003283.17.058e-6033.71pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gen... [more]
ENSPMAT00000005656.18.887e-5743.30pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000010132.19.999e-5442.53pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
ENSPMAT00000001313.11.044e-5342.53pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
ENSPMAT00000004972.13.764e-5037.26pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO447384.187e-1725.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000036785.13.571e-5330.77pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000031980.15.027e-5037.58pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026733.12.491e-3660.91SMESG000026733.1[more]
SMESG000026563.16.263e-3142.86SMESG000026563.1[more]
SMESG000027782.12.154e-3039.71SMESG000027782.1[more]
SMESG000077847.12.806e-3042.98SMESG000077847.1[more]
SMESG000035366.13.449e-3042.86SMESG000035366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003654 ID=SMED30003654|Name=HTH CENPB-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3970bp
ATAGGATATTTTAGAGTCTTAATTATTTTGAGGATTTTTTAAGAAACTTT
AAGCAAACAACTTTACATTTACAATGGGATATTATCAAATGTCAACTTTA
CTATAGGGAAATTATCCCAAAATTTAAAATCCCTAAAAAATTTTCCGCAA
AATTTATTTTCTATAAAAAATATTTCCCAACTCAAAATTTAAAAACCAAA
TGCTCGCTTTGCGTCGATTTCTCGTTGTGCGTAGTTATTTGTTTTTTTTA
TTTTGCCTTCAAACTCATTAAAAAAACTGTATATTCTAGATGTTTTCTTT
CACTTTCTGTGAATAATCTTATGAGAGTAAACTTAAATTAAAAGATATGG
ATGGATTTTAAATTTATTTATTTATTTTCAATTATGAAATTAAAATTTTT
GTAGTAATTGTACCGTTAATATGAACGGTAAACGTAAATATTTAAGAAAA
GCTTTAACGCTAGAAATAAAAATTGAGATACTTAAGCGCTTCGATCGTGG
ACATAAGGCAGTAGATATTGCAAAGGCTCTTACTTTATCAGGAACAACCG
TTAAAGGTATTCGGAACAGGGATGCTTCAATAATAAAAGAAAGGGCTAAA
AATGCTACAGAAATGTTATCTCAACAATGTACACGTAATAGATCCGCTAT
AATGGTCAAAATGGAATCATTTCTAACATTGTGGATACAAGAACAAAATT
ACCGTAGGATGCCTCTAAGTAAAATAATCATCAAAGCAAAAGCAAAATCT
ATCTATGACAGTCTAAGGTTACAAGAACCAAGAACAAGTGAGGATGCGAG
TTTTGAACCTAGCAATGGTTGGTTTGTTCGATTCAAAATCAGAGCAAATT
TGCATAATTTAAGCCTTAAAGAGGAAGCTGCAAGTGGAGATACTGTTGCA
GCAGCAGGTTTTCCAGAAAGATTAAAAAATATAATTCGAGACGGAGAATA
CTACGCGAAACAAATTTTTAATGAAGTTGAAACAGGCTTATTTTGGAAAT
GCCTGCCTACCAAAACATACATTTCAAAAATGGGAAAAAATGCACAGGGA
TTTAAAGCTGGTAAAAAGCGACTAACACTTCTATTAGGTGGAAATTCTGC
TGGTGATTATAAATTTAAACCATTTTTAATTTATGCTTCTGAAAATCCCA
GAGCTTTAAAAGGTACACAAAAGAGAAATCTTCCTGTATATTATCGATGG
AATAAAAAAACCTGTATGATACTAATTTGTTTCGTCATTGGGTGTCCTCT
TGTGTCATTTCAGAGTTGAGATCATATAGCGATAAAGAAAAGTTGGAGTT
TAAAATTCTAATTGTATTGGATAATGCATCAGGTCACCCAAATGATTTAG
ATAAACTTTCAGAGAATATTAAATTTTTTTATTTACCACCAAACACAACT
GCATTAATACAACCTATGGATCAAGGAGCTATATCTAATTCTAAATCATA
TTATCTTCGCCGAACTTTTAAGGAACTCTTCGCAGCAACTGAAGGAATTG
ATAATATTCCTATGAAAATCTTTTGGAAAAATTTCACTATATTAGATGGA
ATTAAATTTGTTGCATTATCTTGGGATGAAGTAACCACTAAAAGCATGAA
CGGATTTTGGCGTAAATTGTGGCCAGAATGTGTAGAGAACCAATTGGAAA
ATGACACGAATGATACAATAAATGTAATTCATGAAGTAGTTGGCTTAGGG
GCCACATTGCAAGTTGAAGGAATGGGTGTCGAAGATATAGAAGAATTATT
GAACTCATACAATGAAGAGATGACAAATTCCGAATTAATGGAAATTGAAT
TTCATCCAGCATACAATAGTAATTCTGACCAAGAAATTGAAGAAATTGTT
CCAGAACATACTCTTACAGCGAAACGTTTAGCGCAAGCTATACAATTAAT
TGATTAGACTTTGCAGATTTTTGATCAAGATGATCCTACACAGGAACGAA
GTTTTAAGGTAAGTAGAGCAGTAATTAGTAGCATAAATCCTATTTTTTCT
CTTGCATATCATTATAATTTTTCGCTATGCGTCGAAATCCACTTTGCCTC
TCTACTTGTGGAAACCGAATAGTGACGCAAAGCGGGGCCCTGTTGTATTA
CACAATAATTAAATTTCACTAATAACAGAGAATAAATGGTTAATAAGTCC
TCCTCGTCGTTTATAATAAAGTGGTCGCATGCGATCGCCTTTGTCAGTCC
TCATTGGATGTCGGCGTTGGTACTAGTGTTCATCTTTACATCTTCTGCTA
TCCATTCGACTTCGAATCGGTTCATCGAATAGTTTTGCAGGAAGTACCAT
GGTAGTGGGTGCTCTCATCGGAGTTAGAGCAGGATCATTTCATTCAAAAG
AGACACCATACTTCGGTGCATGCACATCTTGTGCTGGGTATCTCTCCATT
GGTGATTGCGGCATTTACAGGATCGAAATGCCTGACTATGCTCAGTTTCC
AGTGAAATATAAACTCCAGCTCCTCTATTCGATACAGAGAGAACTCTGTG
CGTTGACGCGTCTCATGGGCCAAGTTCGCGAAACTTGGCAGCTCGATCTC
GTCATCTCTCGAACTTGCTCGGATTGACCAACTATTATCCCCGACCACAG
CCAAACTGTATCCAGCGTCCCAAAGCGATTGTCGATACTTCGCTGCCATT
CCAGGATCCACTCTGATCGTTACTCGGTCATCGTCGATACAAGTTCCCGC
TTCTTGACGCTTAACGTTAGCTGAAAATACAGAGAAATTACTGGTTCCAT
TGACTTTAATACAATGAATAGTAAATATGCATATAAATACTAAAATCGTT
CCACCGTGTCGCCAGCAAAATTTAATTATAATCAATTATTGTCAGTATGT
AGATTTCTTATTAGTAACAGTTATATACATTTGCTATTGGAATGCTGAGT
GTAGCTGTGATTATGTGATTTGAAAGCTGACGTATAACATATGTTCATCA
CCAGCTCGACTTGTTATGTCAACTGACTGTGACCCATTCAGTGTTTCTAT
GGTTATGTGTGTAGTGGAATTCTTTTCAATTTAGGTTCAAATGCTATGAG
TAAGTTCTTACTTTGATCCGGTACGACTGTCATGCAGGCATTCCGTTTGA
CCTTAGGCTCCTGATCTACTGGATTGGTACTTTGACTGACCTTACTCAAA
GGTCAGATGAATTGGAAATTCTCAGTGTTTGATAGTCTCATAAGTGCGAA
ATGAATTGAAATTTTACAAAGTCAATGCGCTATATAACCACTAGTCGGAA
TGAGTCATATTTTAAGCCAGTGAACATTATATTATTTGTCTATCAGTCAC
AGAATTAATTTTTCATGATTTGTTTTTATTACAAATCACCAGTAGAAAGT
CAAGGTAATTCGTATAATTATTTATCCTTATTCCGCATTTCCTGAGGTGA
TAGATATTGTTAATTTATTGACCTTAAAGTTACGAATTTAAATTTCTTCT
ATTTCTGTGGTATGCGTCAGAGTTATCAAGAGAATTTCATTGGAGATAAT
CAACTGTCTTAACTGGATTTGCATTATAATTGGATTCTAATTTGCATTGT
TGATTCTAGAAAAACAATGTTTCATTATATTCCAGTTCAACGGCAAATTT
AGGGTAATATGCAGTTGAGGATTTCTAAATTTTTCAATTATCAGTGAAGT
AATTGACGTTGACTCCGAGCGATTATTCGAACTGTCGTCATCTAGATTGA
TAACGAAATCCGGGTCTTCGATGTCATAGTTCCGTTGAATTCATTCTTGA
TAATGCCTCCGGATTTTCGGTCTGTTGGGTACTATGTAATTTTTTATTTT
GTTTTTTAGATAAATTTAAATTCACTGTTGAGAAAAGATCATATCTCCTT
GTTATTTGGCCTATCGCCGCCACTGAACGAGGTCGTCCAGCGTCAGTATT
ACTAACGTGACTGTCAAATATCAGTTACACCGGCATCTGCTTTTGTGATT
GATCAAATAAATTGTTGTAC
back to top

protein sequence of SMED30003654-orf-1

>SMED30003654-orf-1 ID=SMED30003654-orf-1|Name=SMED30003654-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=283bp
MNGKRKYLRKALTLEIKIEILKRFDRGHKAVDIAKALTLSGTTVKGIRNR
DASIIKERAKNATEMLSQQCTRNRSAIMVKMESFLTLWIQEQNYRRMPLS
KIIIKAKAKSIYDSLRLQEPRTSEDASFEPSNGWFVRFKIRANLHNLSLK
EEAASGDTVAAAGFPERLKNIIRDGEYYAKQIFNEVETGLFWKCLPTKTY
ISKMGKNAQGFKAGKKRLTLLLGGNSAGDYKFKPFLIYASENPRALKGTQ
KRNLPVYYRWNKKTCMILICFVIGCPLVSFQS*
back to top

protein sequence of SMED30003654-orf-2

>SMED30003654-orf-2 ID=SMED30003654-orf-2|Name=SMED30003654-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MAAKYRQSLWDAGYSLAVVGDNSWSIRASSRDDEIELPSFANLAHETRQR
TEFSLYRIEELEFIFHWKLSIVRHFDPVNAAITNGEIPSTRCACTEVWCL
F*
back to top

protein sequence of SMED30003654-orf-3

>SMED30003654-orf-3 ID=SMED30003654-orf-3|Name=SMED30003654-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MDQGAISNSKSYYLRRTFKELFAATEGIDNIPMKIFWKNFTILDGIKFVA
LSWDEVTTKSMNGFWRKLWPECVENQLENDTNDTINVIHEVVGLGATLQV
EGMGVEDIEELLNSYNEEMTNSELMEIEFHPAYNSNSDQEIEEIVPEHTL
TAKRLAQAIQLID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004875DDE_SF_endonuclease_dom
IPR006600HTH_CenpB_DNA-bd_dom
IPR007889HTH_Psq
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006600HTH CenpB-type DNA-binding domainSMARTSM00674cenpbcoord: 75..148
e-value: 6.3E-11
score: 52.3
IPR006600HTH CenpB-type DNA-binding domainPFAMPF03221HTH_Tnp_Tc5coord: 81..146
e-value: 3.9E-9
score: 36.4
IPR006600HTH CenpB-type DNA-binding domainPROSITEPS51253HTH_CENPBcoord: 69..148
score: 13.515
IPR004875DDE superfamily endonuclease domainPFAMPF03184DDE_1coord: 211..262
e-value: 8.2E-8
score: 32.1
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 78..142
e-value: 2.0E-11
score: 45.8
NoneNo IPR availablePANTHERPTHR19303TRANSPOSONcoord: 8..262
NoneNo IPR availablePANTHERPTHR19303:SF27coord: 8..262
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 71..142