slc35a-3

Overview
Nameslc35a-3 (AKN21639.1)
Smed IDSMED30003645
Length (bp)1089
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc35a-3 (SMED30003645) t-SNE clustered cells

Violin plots show distribution of expression levels for slc35a-3 (SMED30003645) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc35a-3 (SMED30003645) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc35a-3 (SMED30003645) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003645

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30003645h1SMcG0017952 dd_Smed_v4_8149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003645h1SMcG0017952 dd_Smed_v4_8149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc35a-3 vs. Ensembl Human
Match: SLC35A2 (solute carrier family 35 member A2 [Source:HGNC Symbol;Acc:HGNC:11022])

HSP 1 Score: 237.654 bits (605), Expect = 2.595e-74
Identity = 138/313 (44.09%), Postives = 204/313 (65.18%), Query Frame = 2
Query:   53 PKMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            P  + +K +SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   58 PAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 367          
BLAST of slc35a-3 vs. Ensembl Human
Match: SLC35A2 (solute carrier family 35 member A2 [Source:HGNC Symbol;Acc:HGNC:11022])

HSP 1 Score: 234.187 bits (596), Expect = 2.276e-73
Identity = 139/312 (44.55%), Postives = 204/312 (65.38%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. Ensembl Human
Match: SLC35A2 (solute carrier family 35 member A2 [Source:HGNC Symbol;Acc:HGNC:11022])

HSP 1 Score: 234.187 bits (596), Expect = 2.276e-73
Identity = 139/312 (44.55%), Postives = 204/312 (65.38%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. Ensembl Human
Match: SLC35A2 (solute carrier family 35 member A2 [Source:HGNC Symbol;Acc:HGNC:11022])

HSP 1 Score: 234.187 bits (596), Expect = 2.583e-73
Identity = 139/312 (44.55%), Postives = 204/312 (65.38%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. Ensembl Human
Match: SLC35A2 (solute carrier family 35 member A2 [Source:HGNC Symbol;Acc:HGNC:11022])

HSP 1 Score: 234.572 bits (597), Expect = 3.026e-73
Identity = 139/312 (44.55%), Postives = 204/312 (65.38%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   47 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 352          
BLAST of slc35a-3 vs. Ensembl Celegans
Match: nstp-4 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:O16658])

HSP 1 Score: 220.32 bits (560), Expect = 5.224e-69
Identity = 132/326 (40.49%), Postives = 207/326 (63.50%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYHETFNDI---GDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSA-SDGSKGVA-DGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXX-HTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKE 1003
            +K +SL++L +Q  + +L +RY +T+ +E   + +S+ ++  EI+KL+    V    +G      + +L  E F       DS+KV VPA +YVIQNNLL+ AL  LD+A +QV+YQLK+LTTA+FSV +L +S+ +  W++L LL +GVALVQ  S  S  SK  A +    + ++G+GAVL AC  SGFAG+YFEK LK S +SLW RN+ +AF  +  +    W Y++++I++ GF  G++ ++ I++ LQ+ GGL++A+VVKYA+ +LKGFA S SI++S   S  +     ++  F +GA++V+ +  LY    P     E
Sbjct:   11 LKLISLVVLIVQTTALVLTLRYSQTQKSEGPRYLSSTAVVCAEIIKLITCFFVIYRNNGYRFSGMLNELNREIFASPQTRADSLKVAVPAIMYVIQNNLLFFALKKLDAATYQVTYQLKILTTAIFSVTMLGKSLHRYNWMALILLTAGVALVQYPSGDSTTSKSTAAEHDASDNILGLGAVLAACFSSGFAGVYFEKILKTSKVSLWIRNIQLAFFSVFGALLVCWLYDWQAISDDGFLRGYNGVIWIVVLLQAYGGLVIALVVKYADNILKGFAVSLSIILSSFTSWLVLGDLTITTTFAIGATVVIFATFLYGH-EPKSTPAE 335          
BLAST of slc35a-3 vs. Ensembl Celegans
Match: nstp-3 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:O01879])

HSP 1 Score: 220.32 bits (560), Expect = 6.645e-69
Identity = 124/310 (40.00%), Postives = 193/310 (62.26%), Query Frame = 2
Query:   71 KELSLILLTIQNASHILMMRYCRTRT-TELFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFS 982
            K   ++LLTIQ AS  LM RY R R  + +FFT+  + + EI+K+++ + +  Y +      I +L    F    +++KV +PA IY +QNNL Y+ALS+L++  F +SYQ+K+ TTA+F  F L + +   QW +L LL  GVA +Q   +   +   ++ + QN + G  AVLT C  S FAG+Y EK LK S  S+W +N+ +A IG+ ISF   W+Y++E INE+G F G+D++V  L    S GG+L++VV+KYA+ +LK +A S +I+ + + S  +F      +FL+G  MV+VSI++Y+ F 
Sbjct:   11 KYFGILLLTIQQASMPLMARYSRAREDSNVFFTTVNVFMMEIIKVVVCSAIMIYTTKSVMKYINELKLAIFEHRSETLKVCIPALIYTLQNNLYYIALSHLEATTFCISYQMKIFTTAIFMYFFLGKKLSTKQWWALVLLVLGVADIQYVYSPPPA---SEDVEQNPMYGFMAVLTMCFTSAFAGVYLEKVLKSSNASIWVQNIRLALIGLPISFLSMWYYDWEKINEQGAFRGWDFVVVCLTVTNSVGGILISVVIKYADNILKAYAQSMAIIGAAVGSWILFDFAPGFMFLLGTFMVIVSIIIYTAFP 317          
BLAST of slc35a-3 vs. Ensembl Celegans
Match: nstp-5 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:E5QCI0])

HSP 1 Score: 219.935 bits (559), Expect = 2.584e-68
Identity = 140/374 (37.43%), Postives = 212/374 (56.68%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQS-----GIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDS--ASDGSKGVADGIV----------------------------------QNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKG---------FFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFS--------PTKIKKE 1003
            K + IK  SL++L +QN S +L MRY  T+    F  +  ++  EI K  +S ++ C +      G++K++HE F +  D++KV+VP+AIY +QN LLYVA+ NL +A + V+YQLK+LTTA F+V +L + +   QW+SLF+LF+GV +VQ D   +++  K  A  ++                                  +N V+G  AVL ACV+SGFAGIYFEK LKGS +S+W RN+ +AF  I  +F      +  S+ + G            GFD+ V + + + + GGL+VAVV+KYA+ +LK FA S +IV++ + + F+F+   S LFLVGAS V+ ++  YS +         PT   KE
Sbjct:    5 KAETIKYSSLVVLVVQNCSLVLFMRYAMTKDRPKFLKTITVLFGEIFKCTVSLLLACIEEKSIAKGLRKIHHEFFVNWRDTLKVLVPSAIYTVQNFLLYVAVDNLPAATYMVTYQLKILTTAAFTVLVLHRRLTIQQWISLFVLFAGVVVVQYDQKMSNEREKAAAAAVLSSTLAPTTTVSPFSNLTTTLTTVVTTASLASSKTENSVLGFIAVLIACVLSGFAGIYFEKILKGSNVSIWIRNIQLAFPSIFFAFLFASVKDNSSLYQDGPNPIEIWNNMLQGFDWAVWVTVAINAFGGLVVAVVIKYADNILKAFATSLAIVLNCIAAYFLFNFRPSILFLVGASGVIAAVFAYSMYPYKASHQALPTDAPKE 378          
BLAST of slc35a-3 vs. Ensembl Celegans
Match: srf-3 (UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93890])

HSP 1 Score: 207.994 bits (528), Expect = 2.418e-64
Identity = 131/308 (42.53%), Postives = 194/308 (62.99%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVII-VTEIVKLLISTVVFCYQSGIKKLYH----ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGS-TISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            +K   LI LT+QN+ H L++RY R R  +  F S+V + +TE++K  I   +   +   ++  H    +      D++KV +PA IY++QNNL YVA S+LD+A F ++ QLK+ T A+F+V IL++S+ + QW +L +LF GV+LVQL     G+K   +   ++  +G  AV+ AC +SGFAGIYFEK LKGS  +SLW RNV MA   I  SF   +  + +++NE G  YGFD +V + +     GGL VAV +KYA+ + K FA S +I++S + S+F+F    S  FL+GAS+V+ SI LYS
Sbjct:    1 MKTAILIWLTLQNSIHTLLIRYSRAREVDAMFVSTVAVWLTEVIKCFICLFLVAQEETPRRFIHALRTQILEQPYDTLKVCIPAMIYIVQNNLFYVAASHLDAATFMITSQLKIFTAAIFTVIILRRSLNRTQWFALAVLFVGVSLVQL----QGTKA-KESSGESPFVGFVAVVVACCLSGFAGIYFEKILKGSAPVSLWMRNVQMAVFSIPASFSAIYMQDSKTVNEYGLLYGFDSIVWLTVLWYGVGGLSVAVCIKYADNIAKNFATSVAIILSTIGSIFLFDFIPSFTFLLGASLVIFSIFLYS 303          
BLAST of slc35a-3 vs. Ensembl Celegans
Match: srf-3 (UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93890])

HSP 1 Score: 208.379 bits (529), Expect = 4.629e-64
Identity = 131/308 (42.53%), Postives = 194/308 (62.99%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVII-VTEIVKLLISTVVFCYQSGIKKLYH----ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGS-TISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            +K   LI LT+QN+ H L++RY R R  +  F S+V + +TE++K  I   +   +   ++  H    +      D++KV +PA IY++QNNL YVA S+LD+A F ++ QLK+ T A+F+V IL++S+ + QW +L +LF GV+LVQL     G+K   +   ++  +G  AV+ AC +SGFAGIYFEK LKGS  +SLW RNV MA   I  SF   +  + +++NE G  YGFD +V + +     GGL VAV +KYA+ + K FA S +I++S + S+F+F    S  FL+GAS+V+ SI LYS
Sbjct:   41 MKTAILIWLTLQNSIHTLLIRYSRAREVDAMFVSTVAVWLTEVIKCFICLFLVAQEETPRRFIHALRTQILEQPYDTLKVCIPAMIYIVQNNLFYVAASHLDAATFMITSQLKIFTAAIFTVIILRRSLNRTQWFALAVLFVGVSLVQL----QGTKA-KESSGESPFVGFVAVVVACCLSGFAGIYFEKILKGSAPVSLWMRNVQMAVFSIPASFSAIYMQDSKTVNEYGLLYGFDSIVWLTVLWYGVGGLSVAVCIKYADNIAKNFATSVAIILSTIGSIFLFDFIPSFTFLLGASLVIFSIFLYS 343          
BLAST of slc35a-3 vs. Ensembl Fly
Match: Ugalt (gene:FBgn0024994 transcript:FBtr0345710)

HSP 1 Score: 219.55 bits (558), Expect = 2.157e-68
Identity = 135/328 (41.16%), Postives = 207/328 (63.11%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIV--------------QNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTK 991
            +K +SL+ LT+QNA   L MRY RTR  ++F +S+ +++ E  KL+    +   + G      ++ L+     +  D++KV VP+ +Y++QNNLLYV+ S+LD+A +QV+YQLK+LTTA+F+V IL++ +L  QW +L LL  G+ LVQL + ++G    + G                QN+++G+ A L AC +SGFAGIYFEK LKG+ IS+W RNV ++ + I       +  +   I ++GFF G+D  V  L+ LQ+ GGL+VAVVVKYA+ +LKGFA S +I+IS + S++IF   ++  F  GA +V+ SI LY  + P +
Sbjct:   11 LKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQL-AQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYG-YDPAR 336          
BLAST of slc35a-3 vs. Ensembl Fly
Match: Ugalt (gene:FBgn0024994 transcript:FBtr0070501)

HSP 1 Score: 219.55 bits (558), Expect = 2.157e-68
Identity = 135/328 (41.16%), Postives = 207/328 (63.11%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIV--------------QNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTK 991
            +K +SL+ LT+QNA   L MRY RTR  ++F +S+ +++ E  KL+    +   + G      ++ L+     +  D++KV VP+ +Y++QNNLLYV+ S+LD+A +QV+YQLK+LTTA+F+V IL++ +L  QW +L LL  G+ LVQL + ++G    + G                QN+++G+ A L AC +SGFAGIYFEK LKG+ IS+W RNV ++ + I       +  +   I ++GFF G+D  V  L+ LQ+ GGL+VAVVVKYA+ +LKGFA S +I+IS + S++IF   ++  F  GA +V+ SI LY  + P +
Sbjct:   11 LKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQL-AQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYG-YDPAR 336          
BLAST of slc35a-3 vs. Ensembl Fly
Match: Ugalt (gene:FBgn0024994 transcript:FBtr0273276)

HSP 1 Score: 219.55 bits (558), Expect = 2.608e-68
Identity = 135/328 (41.16%), Postives = 207/328 (63.11%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIV--------------QNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTK 991
            +K +SL+ LT+QNA   L MRY RTR  ++F +S+ +++ E  KL+    +   + G      ++ L+     +  D++KV VP+ +Y++QNNLLYV+ S+LD+A +QV+YQLK+LTTA+F+V IL++ +L  QW +L LL  G+ LVQL + ++G    + G                QN+++G+ A L AC +SGFAGIYFEK LKG+ IS+W RNV ++ + I       +  +   I ++GFF G+D  V  L+ LQ+ GGL+VAVVVKYA+ +LKGFA S +I+IS + S++IF   ++  F  GA +V+ SI LY  + P +
Sbjct:   22 LKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQL-AQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYG-YDPAR 347          
BLAST of slc35a-3 vs. Ensembl Fly
Match: senju (gene:FBgn0031676 transcript:FBtr0079009)

HSP 1 Score: 83.5741 bits (205), Expect = 1.813e-17
Identity = 71/268 (26.49%), Postives = 125/268 (46.64%), Query Frame = 2
Query:  164 TSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLD------SASDGSKGVADGIVQNKVIGMGAVLTACV------MSGF------------------AGIYFEKTL--KGSTISLWARNVLMAFIGIIIS-----FGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFA 856
            T +V+++TE+ KL++ST ++C  + ++ L  +   D       +VPA +Y + NNL +V L+  D   + +  QL+++ T +    I K+ + + QW+SL LL  G  + Q+D       A+D S+  A   +Q ++       +A        MSGF                  AG+Y E  L  KG+ ++++ +NV M    I+ +       G+    F   N         + V I+I   +A G++ +  +KY N +LK FA
Sbjct:   46 TVTVVLLTEVFKLIVSTCLYCRDNNLRSLVRDVQKDRNVLGLYMVPAFLYCLYNNLAFVNLATFDPTTYYLLLQLRVVVTGILFQIIFKKYLSQRQWISLILLTLGCMMKQVDFGSFYSDANDDSESAA---IQQQLQSHNKTTSAETHAHGKNMSGFDFSLSAVFILAQTICSCLAGVYNEYLLKDKGADVNIFVQNVFMYLDSIVCNAVILLLRGELLDAFSPQNLGSI---MRFSVLIIIVNNAAIGIVTSFFLKYMNSILKTFA 307          
BLAST of slc35a-3 vs. Ensembl Zebrafish
Match: slc35a2 (solute carrier family 35 member 2 [Source:ZFIN;Acc:ZDB-GENE-030616-62])

HSP 1 Score: 241.891 bits (616), Expect = 1.068e-76
Identity = 139/310 (44.84%), Postives = 209/310 (67.42%), Query Frame = 2
Query:   62 KYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQ------SGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            K +K  SL +L IQNAS IL +RY RT   + F+T+S +++ E++K++    +   Q      S +  LY        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L++S+ ++QW+SL LLF+GVA+VQ++  S   K       QN   G+ +V+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G ++   G W+ +  +I EKGF +G+  MV  +IF Q+ GGLLVAVVVKYA+ +LKGFA S SI++S + SV++F  +V  +F +GA +V+ ++ +YS
Sbjct:   30 KKLKYTSLAILVIQNASLILSIRYVRTLPGDHFYTTSAVVMAEVLKVITCLFIILIQKRGNVKSFVSLLYDSIVIQYWDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLRKSLSRIQWISLVLLFAGVAIVQVEQESGKQKEAVTAANQNYFKGLLSVIISCLSSGFAGVYFEKILKGSSASVWMRNIQLGIFGTVLGLLGMWWNDGAAIAEKGFLFGYTPMVWGVIFNQAFGGLLVAVVVKYADNILKGFATSFSIIVSTITSVYLFGFHVDLVFTLGAGLVIGAVYMYS 339          
BLAST of slc35a-3 vs. Ensembl Zebrafish
Match: slc35a1 (solute carrier family 35 member A1 [Source:ZFIN;Acc:ZDB-GENE-080716-17])

HSP 1 Score: 217.238 bits (552), Expect = 1.290e-67
Identity = 127/313 (40.58%), Postives = 198/313 (63.26%), Query Frame = 2
Query:   83 LILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLY--SKFSPTKIKK 1000
            L ++T+  A++ + +RY RT +TEL+F+++ + + EI+KLL+S ++   ++G        L    F    + +K+ VP+ +Y IQNN+ +VALSNLD+AV+QV+YQLK+  TA+ +V +L +S+ ++QW S+F+L +GV LVQ          V     QN  +G  A+  A + SGFAG+YFEK LK S  SLW RN+ M   GI ++  G +  +   + EKGFFYG+   VC+++FL S GG+  +VVVKY + ++KGF+ +A+IV+S + SV +F   ++  F+ GA +V VSI LY   K   TK+ K
Sbjct:   15 LTVMTLIAATYTVALRYTRTVSTELYFSTTAVCLAEIIKLLLSLIMLVRETGDVGRCRAALVTHIFRSPKELLKLSVPSVVYAIQNNMAFVALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSRLQWFSVFMLCAGVTLVQWTPPHSTKVQVE----QNPFLGFMAIAVAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLMGVYMTDGARVLEKGFFYGYTPWVCLVVFLASVGGMYTSVVVKYTDNIMKGFSAAAAIVLSTVASVLLFGLQITLTFISGALLVCVSIYLYGLPKQDTTKVMK 323          
BLAST of slc35a-3 vs. Ensembl Zebrafish
Match: slc35a3b (solute carrier family 35 member A3b [Source:ZFIN;Acc:ZDB-GENE-050417-460])

HSP 1 Score: 212.231 bits (539), Expect = 1.537e-65
Identity = 131/310 (42.26%), Postives = 195/310 (62.90%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVV------FCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTY-VSGLFLVGASMVVVSIVLY 970
            +K  SL +L  Q  S +L MRY RT  TE  L+  SS ++  E++K++   ++      F  +S    L  E  N    ++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L + +   QWLSL +L  G+ALVQ  +    S G  D    +++IG+ AVL AC  SGFAG+YFEK LK S  S+W RN+ +   G++  FGG + Y+ E + E G F G++ +   ++ LQ+ GGL++A V+KYA+ +LKGFA S SI++S L S F+   +  + +F +GA +V+ +  LY
Sbjct:   31 LKYASLGVLVFQTTSLVLTMRYSRTLHTEEPLYLASSAVVCAELLKIVACILLVFRDHSFSVRSLNLVLKEEIINRPLLTLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKRLGIYQWLSLVILMFGIALVQWPTEVSSSTGEKDLTASSQLIGLLAVLVACFSSGFAGVYFEKILKESKQSVWVRNIQLGLFGLVFGFGGVFTYDRERVLENGLFQGYNNVTWSVVALQALGGLVIAAVIKYADNILKGFATSISIILSTLISYFLLDDFDPTSVFFLGAMLVIAATFLY 340          
BLAST of slc35a-3 vs. Ensembl Zebrafish
Match: slc35a3b (solute carrier family 35 member A3b [Source:ZFIN;Acc:ZDB-GENE-050417-460])

HSP 1 Score: 212.231 bits (539), Expect = 2.223e-65
Identity = 131/310 (42.26%), Postives = 195/310 (62.90%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVV------FCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTY-VSGLFLVGASMVVVSIVLY 970
            +K  SL +L  Q  S +L MRY RT  TE  L+  SS ++  E++K++   ++      F  +S    L  E  N    ++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L + +   QWLSL +L  G+ALVQ  +    S G  D    +++IG+ AVL AC  SGFAG+YFEK LK S  S+W RN+ +   G++  FGG + Y+ E + E G F G++ +   ++ LQ+ GGL++A V+KYA+ +LKGFA S SI++S L S F+   +  + +F +GA +V+ +  LY
Sbjct:   42 LKYASLGVLVFQTTSLVLTMRYSRTLHTEEPLYLASSAVVCAELLKIVACILLVFRDHSFSVRSLNLVLKEEIINRPLLTLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKRLGIYQWLSLVILMFGIALVQWPTEVSSSTGEKDLTASSQLIGLLAVLVACFSSGFAGVYFEKILKESKQSVWVRNIQLGLFGLVFGFGGVFTYDRERVLENGLFQGYNNVTWSVVALQALGGLVIAAVIKYADNILKGFATSISIILSTLISYFLLDDFDPTSVFFLGAMLVIAATFLY 351          
BLAST of slc35a-3 vs. Ensembl Zebrafish
Match: slc35a3a (solute carrier family 35 member A3a [Source:ZFIN;Acc:ZDB-GENE-081105-80])

HSP 1 Score: 201.83 bits (512), Expect = 7.902e-62
Identity = 126/314 (40.13%), Postives = 193/314 (61.46%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLIST-VVFCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTY-VSGLFLVGASMVVVSIVLY 970
            K+KY   LSL +L  Q  S +L MRY RT   +   +  SS ++V E +K+L    +VF   S   +     +  E  +   +++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L + +   QWLSL +L +GVA VQ  + S            ++ +G+ AVL AC  SGFAG+YFEK LK +  S+W RN+ +   G++    G   Y+ + + E G F G++ +  I++ LQ+ GGL++A V+KYA+ +LKGFA S SI++S L S F+   +  + +F +GA +V+++  LY
Sbjct:    5 KLKY---LSLGVLVFQTTSLVLTMRYSRTLQGDGPRYLASSAVVVAEFLKILTCVGLVFKENSYSGRALSSIMRQEIIHKPVETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGVYQWLSLLILMAGVAFVQWPTDSPADPQKEHLTAGSQFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGLFGLVFGVFGMLAYDGDRVREHGMFQGYNTLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFLLEDFEPTSVFFLGAILVIMATFLY 315          
BLAST of slc35a-3 vs. Ensembl Xenopus
Match: crabp1 (cellular retinoic acid binding protein 1 [Source:Xenbase;Acc:XB-GENE-962771])

HSP 1 Score: 220.32 bits (560), Expect = 1.187e-68
Identity = 131/314 (41.72%), Postives = 207/314 (65.92%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYH-ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQL--DSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYV-SGLFLVGASMVVVSIVLY 970
            ++K +SL +L  Q  + +L MR+ RT   E   + +S+ ++  E++K+ ++ V+  Y+        +K++ H E  N   +++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L++ + K QW+SL +L +GVALVQ   DS++  +K V+ G   +  +G+ AVLTAC  SGFAG+YFEK LK +  S+W RN+ + F G I    G + Y+ E ++  GFF G++ +   ++ LQ+ GGL++A V+KYA+ +LKGFA S SI++S L S F    +V + +F VGA +V+ +  LY
Sbjct:   11 HLKYISLGVLVFQTTTLVLTMRFSRTLKEEGPRYLSSTAVVAAEVLKI-VACVLLVYKDNSYSLRSLKRVLHDEIVNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLQRKLTKHQWMSLLILMAGVALVQWPDDSSNAPNKEVSVG---SGFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGWIFGLMGVYIYDGERVSNGGFFQGYNNLTWAVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFVGALLVIAATFLY 320          
BLAST of slc35a-3 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 219.55 bits (558), Expect = 1.887e-68
Identity = 132/326 (40.49%), Postives = 210/326 (64.42%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYH-ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQL--DSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYV-SGLFLVGASMVVVSIVLY---SKFSPTKIK 997
            +IK +SL +L +Q  S +L MRY RT+  E   + +S+ ++  E++K+ ++ ++  Y+        +K++ H E  N   D++K+ +P+ IY +QNN+LY+ALSNLD+A +QV+YQLK+LTTA+F+V +L++ + K QW+SL +L +GVALVQ   DS+   +K +  G   +  +G+ AV+TAC  SGFAG+YFEK LK +  SLW RN+ +   G +    G   Y+ + +++ GFF G++ +  I++ LQ+ GGL+VA V+KYA+ +LK FA S SI++S L S F    +V + +F VGA +V+ +  LY    K S   IK
Sbjct:    4 HIKYISLGVLVLQTTSLVLTMRYSRTQQEEGPRYLSSTAVVSAEVLKI-VACILLVYKDNKYNLRSLKRVLHDEIINKPKDTLKLAIPSGIYTLQNNVLYIALSNLDAATYQVTYQLKILTTALFTVSMLQRKLTKHQWVSLLILMAGVALVQWPADSSKTPNKALPTG---SGFVGLVAVITACFSSGFAGVYFEKILKETKQSLWIRNIQLGLFGWLFGLMGVLIYDGQRVSKGGFFQGYNNLTWIVVALQALGGLVVATVIKYADNILKSFAASISIILSTLISYFWLKDFVPTSVFFVGALLVIAATFLYGYVPKASANPIK 325          
BLAST of slc35a-3 vs. Ensembl Xenopus
Match: crabp1 (cellular retinoic acid binding protein 1 [Source:Xenbase;Acc:XB-GENE-962771])

HSP 1 Score: 214.927 bits (546), Expect = 2.322e-66
Identity = 116/276 (42.03%), Postives = 184/276 (66.67%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYH-ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQL--DSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFAC 859
            ++K +SL +L  Q  + +L MR+ RT   E   + +S+ ++  E++K+ ++ V+  Y+        +K++ H E  N   +++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L++ + K QW+SL +L +GVALVQ   DS++  +K V+ G   +  +G+ AVLTAC  SGFAG+YFEK LK +  S+W RN+ + F G I    G + Y+ E ++  GFF G++ +   ++ LQ+ GGL++A V+KYA+ +LKGFA 
Sbjct:    4 HLKYISLGVLVFQTTTLVLTMRFSRTLKEEGPRYLSSTAVVAAEVLKI-VACVLLVYKDNSYSLRSLKRVLHDEIVNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLQRKLTKHQWMSLLILMAGVALVQWPDDSSNAPNKEVSVG---SGFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGWIFGLMGVYIYDGERVSNGGFFQGYNNLTWAVVALQALGGLVIAAVIKYADNILKGFAT 275          
BLAST of slc35a-3 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 190.66 bits (483), Expect = 2.900e-54
Identity = 101/256 (39.45%), Postives = 166/256 (64.84%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYH-ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQL--DSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAG 799
            +IK +SL +L +Q  S +L MRY RT+  E   + +S+ ++  E++K+ ++ ++  Y+        +K++ H E  N   D++K+ +P+ IY +QNN+LY+ALSNLD+A +QV+YQLK+LTTA+F+V +L++ + K QW+SL +L +GVALVQ   DS+   +K +  G   +  +G+ AV+TAC  SGFAG+YFEK LK +  SLW RN+ +   G +    G   Y+ + +++ GFF G++ +  I++ LQ  G
Sbjct:    4 HIKYISLGVLVLQTTSLVLTMRYSRTQQEEGPRYLSSTAVVSAEVLKI-VACILLVYKDNKYNLRSLKRVLHDEIINKPKDTLKLAIPSGIYTLQNNVLYIALSNLDAATYQVTYQLKILTTALFTVSMLQRKLTKHQWVSLLILMAGVALVQWPADSSKTPNKALPTG---SGFVGLVAVITACFSSGFAGVYFEKILKETKQSLWIRNIQLGLFGWLFGLMGVLIYDGQRVSKGGFFQGYNNLTWIVVALQPQG 255          
BLAST of slc35a-3 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 190.274 bits (482), Expect = 6.390e-54
Identity = 101/256 (39.45%), Postives = 166/256 (64.84%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYH-ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQL--DSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAG 799
            +IK +SL +L +Q  S +L MRY RT+  E   + +S+ ++  E++K+ ++ ++  Y+        +K++ H E  N   D++K+ +P+ IY +QNN+LY+ALSNLD+A +QV+YQLK+LTTA+F+V +L++ + K QW+SL +L +GVALVQ   DS+   +K +  G   +  +G+ AV+TAC  SGFAG+YFEK LK +  SLW RN+ +   G +    G   Y+ + +++ GFF G++ +  I++ LQ  G
Sbjct:    4 HIKYISLGVLVLQTTSLVLTMRYSRTQQEEGPRYLSSTAVVSAEVLKI-VACILLVYKDNKYNLRSLKRVLHDEIINKPKDTLKLAIPSGIYTLQNNVLYIALSNLDAATYQVTYQLKILTTALFTVSMLQRKLTKHQWVSLLILMAGVALVQWPADSSKTPNKALPTG---SGFVGLVAVITACFSSGFAGVYFEKILKETKQSLWIRNIQLGLFGWLFGLMGVLIYDGQRVSKGGFFQGYNNLTWIVVALQPQG 255          
BLAST of slc35a-3 vs. Ensembl Mouse
Match: Slc35a2 (solute carrier family 35 (UDP-galactose transporter), member A2 [Source:MGI Symbol;Acc:MGI:1345297])

HSP 1 Score: 229.95 bits (585), Expect = 8.522e-72
Identity = 137/312 (43.91%), Postives = 203/312 (65.06%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A        D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  ++  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHLDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. Ensembl Mouse
Match: Slc35a2 (solute carrier family 35 (UDP-galactose transporter), member A2 [Source:MGI Symbol;Acc:MGI:1345297])

HSP 1 Score: 229.95 bits (585), Expect = 8.522e-72
Identity = 137/312 (43.91%), Postives = 203/312 (65.06%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A        D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  ++  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHLDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. Ensembl Mouse
Match: Slc35a2 (solute carrier family 35 (UDP-galactose transporter), member A2 [Source:MGI Symbol;Acc:MGI:1345297])

HSP 1 Score: 229.565 bits (584), Expect = 9.667e-72
Identity = 137/312 (43.91%), Postives = 203/312 (65.06%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A        D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  ++  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHLDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. Ensembl Mouse
Match: Slc35a1 (solute carrier family 35 (CMP-sialic acid transporter), member 1 [Source:MGI Symbol;Acc:MGI:1345622])

HSP 1 Score: 223.016 bits (567), Expect = 7.991e-70
Identity = 130/320 (40.62%), Postives = 203/320 (63.44%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGI-----KKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLY--SKFSPTKIKKE 1003
            + K   L ++T+  A++ + +RY RT   EL+F+++ + +TE++KLLIS  +   ++G        L         +  K+ VP+ +Y +QNN+ ++ALSNLD+AV+QV+YQLK+  TA+ +V +L +++ K+QW+S+F+L  GV LVQ   A   +K V   + QN ++G GA+  A + SGFAG+YFEK LK S  SLW RN+ M   GI+++  G +  +   I EKGFFYG+ Y V  +IFL S GGL  +VVVKY + ++KGF+ +A+IV+S + SV +F   ++  F +GA +V VSI LY   +   T I++E
Sbjct:   11 FFKLYCLTVMTLVAAAYTVALRYTRTTAEELYFSTTAVCITEVIKLLISVGLLAKETGSLGRFKASLSENVLGSPKELAKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWISVFMLCGGVTLVQWKPA-QATKVV---VAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIVVTLAGTYLSDGAEIQEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVLLFGLQITLSFALGALLVCVSIYLYGLPRQDTTSIQQE 326          
BLAST of slc35a-3 vs. Ensembl Mouse
Match: Slc35a3 (solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3 [Source:MGI Symbol;Acc:MGI:1917648])

HSP 1 Score: 215.698 bits (548), Expect = 3.528e-67
Identity = 135/324 (41.67%), Postives = 204/324 (62.96%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKL-----LISTVVFCYQSGIKKLYH-ETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASD--GSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYV-SGLFLVGASMVVVSIVLY-----SKFSPTK 991
            +K LSL +L  Q  S +L MRY RT   E   + +S+ ++V E +K+     L+     C    + ++ H E  N   +++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L + +   QWLSL +L +GVA VQ  S S    SK ++ G   ++ +G+ AVLTAC  SGFAG+YFEK LK +  S+W RN+ + F G I    G + Y+ E +++ GFF G++ +  I++ LQ+ GGL++A V+KYA+ +LKGFA S SI++S + S F    +V + +F +GA +V+ +  LY        +PTK
Sbjct:    5 LKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTG---SQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAGNPTK 325          
BLAST of slc35a-3 vs. UniProt/SwissProt
Match: sp|Q58DA6|S35A2_BOVIN (UDP-galactose translocator OS=Bos taurus OX=9913 GN=SLC35A2 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 2.300e-73
Identity = 138/312 (44.23%), Postives = 205/312 (65.71%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL Y+A+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN  +G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYMDTLKLAVPSLIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGVGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVTHRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. UniProt/SwissProt
Match: sp|P78381|S35A2_HUMAN (UDP-galactose translocator OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.240e-72
Identity = 139/312 (44.55%), Postives = 204/312 (65.38%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. UniProt/SwissProt
Match: sp|Q8WMS0|S35A2_CANLF (UDP-galactose translocator OS=Canis lupus familiaris OX=9615 GN=SLC35A2 PE=2 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 1.390e-72
Identity = 138/312 (44.23%), Postives = 204/312 (65.38%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SN+ +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A  G     D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  +V  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLALFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNMPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVARRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. UniProt/SwissProt
Match: sp|Q9R0M8|S35A2_MOUSE (UDP-galactose translocator OS=Mus musculus OX=10090 GN=Slc35a2 PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 5.961e-71
Identity = 137/312 (43.91%), Postives = 203/312 (65.06%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV-FCYQSGIKK-----LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KYI   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K L   ++ F  + G  K     L+        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ ++QW SL LLF+GVA+VQ   A        D   QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RN+ +   G  +   G W+ E  ++  +GFF+G+   V  ++  Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+ +F  ++  LF +GA +V+ ++ LYS
Sbjct:   34 RLKYI---SLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLD---QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHLDPLFALGAGLVIGAVYLYS 339          
BLAST of slc35a-3 vs. UniProt/SwissProt
Match: sp|Q61420|S35A1_MOUSE (CMP-sialic acid transporter OS=Mus musculus OX=10090 GN=Slc35a1 PE=1 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 5.589e-69
Identity = 130/320 (40.62%), Postives = 203/320 (63.44%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGI-----KKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLY--SKFSPTKIKKE 1003
            + K   L ++T+  A++ + +RY RT   EL+F+++ + +TE++KLLIS  +   ++G        L         +  K+ VP+ +Y +QNN+ ++ALSNLD+AV+QV+YQLK+  TA+ +V +L +++ K+QW+S+F+L  GV LVQ   A   +K V   + QN ++G GA+  A + SGFAG+YFEK LK S  SLW RN+ M   GI+++  G +  +   I EKGFFYG+ Y V  +IFL S GGL  +VVVKY + ++KGF+ +A+IV+S + SV +F   ++  F +GA +V VSI LY   +   T I++E
Sbjct:   11 FFKLYCLTVMTLVAAAYTVALRYTRTTAEELYFSTTAVCITEVIKLLISVGLLAKETGSLGRFKASLSENVLGSPKELAKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWISVFMLCGGVTLVQWKPA-QATKVV---VAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIVVTLAGTYLSDGAEIQEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVLLFGLQITLSFALGALLVCVSIYLYGLPRQDTTSIQQE 326          
BLAST of slc35a-3 vs. TrEMBL
Match: A0A0H3YJH4 (Slc35a-3 OS=Schmidtea mediterranea OX=79327 GN=slc35a-3 PE=2 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 2
Query:   59 MKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 1006
            MKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE
Sbjct:    1 MKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 316          
BLAST of slc35a-3 vs. TrEMBL
Match: A0A210PPQ3 (UDP-galactose translocator OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11573 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 2.684e-88
Identity = 155/315 (49.21%), Postives = 226/315 (71.75%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVV------FCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADG---IVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSP 985
            +K +SL+LLT+QNA+ IL+MRY R R  ++F  ++ +IV+E +K L +  +      F  ++ +K LY+  F+   D I V VP+ IYV+QNNLLYVA+SNLD+A FQV+YQLK+LTTA+FSV +LK+ + ++QW+SL +LF GVA+VQ+   +  +K  +     +VQN  +G+ AV+ +C+MSGFAG+YFEK LKG+  S+W RNV +  +G +I     +  + E + EKGFF+G+DY+V I+IF+Q+ GGLLVAVVVKYA+ +LKGFA SA+I+IS + S++ F  +VS  F  GAS+V+ SI +YSKF P
Sbjct:   49 LKTVSLVLLTLQNAALILVMRYVRIRQGDMFMATTAVIVSEALKCLTALGIVFWEEKFSVKNWMKHLYNNIFSQPMDCINVSVPSLIYVLQNNLLYVAVSNLDAATFQVTYQLKILTTALFSVVMLKKQLSRLQWVSLVVLFIGVAIVQMQPDNTPAKAASTATTEVVQNPTLGLVAVIISCLMSGFAGVYFEKILKGTKQSVWVRNVQLGSLGGVIGLIAMYLKDGEKVAEKGFFFGYDYVVFIVIFIQAFGGLLVAVVVKYADNILKGFATSAAIIISCILSMYFFDFHVSFQFTCGASLVMASIYMYSKFVP 363          
BLAST of slc35a-3 vs. TrEMBL
Match: V4AN80 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_174946 PE=4 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 9.990e-87
Identity = 150/307 (48.86%), Postives = 224/307 (72.96%), Query Frame = 2
Query:   80 SLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSP 985
            SL+ L +QNA+ IL+MRY RT+  +++ +S+ ++++E+ KLL   V+  YQ G     +K L  +  +   D +KV VP+ IY IQNNLLY+A+SNLD+A FQV+YQLK+LTTA+FSVF+L++++ K+QWLSL +LF GV++VQL   +   K V+  + QN  +G+ AV+ +CV+SGFAG+YFEK LKG+  S+W RN+ ++ +GI+I        +   + EKGFF+G+ + V ++IFLQS GGL+VAVVVKYA+ +LKGFA SASIV+S + SV+ F  ++S  F++GAS+V+V++ +YSKF P
Sbjct:   10 SLVALILQNAALILVMRYTRTQHGDMYLSSTAVVMSEMCKLLTCCVIIIYQEGGVGQFVKMLKTDIIDCPLDCVKVSVPSIIYTIQNNLLYLAVSNLDAATFQVTYQLKILTTAIFSVFMLEKAVAKLQWLSLVVLFVGVSIVQLQPKTS-EKSVSQNLAQNPFVGLVAVIISCVLSGFAGVYFEKILKGTRQSVWIRNIQLSVLGIVIGLITMELKDGAKVTEKGFFFGYTWFVWLVIFLQSFGGLIVAVVVKYADNILKGFATSASIVLSCIVSVYFFDFHLSIQFVIGASLVMVAVYMYSKFVP 315          
BLAST of slc35a-3 vs. TrEMBL
Match: A0A2T7NSS3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14678 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 8.663e-86
Identity = 150/326 (46.01%), Postives = 225/326 (69.02%), Query Frame = 2
Query:   62 KYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVAD----------GIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTKI 994
            +++K +SL+LLT+QNA  IL+MRY RTR  ++FF +S ++ +E++K + S  +  Y+       ++ LY        D +KV VP+ IYV+QNNLLY+A+SNL++A FQV+YQLK+LTTAVFSV +L++ +  +QW+SL +LF GV++VQL ++ D  K   D           + QN V G  AV  +CV+SGFAG+YFEK LKG++ S+W RNV +  +G++I     +    + + EKG  YGFDY V I++FLQS GGL+VAVVVKYA+ +LKGFA SA+I++S + S++ F  +++ LF VGAS+V++++ +YSKF P  +
Sbjct:   42 EFLKYVSLVLLTLQNALLILIMRYVRTRKGDMFFATSAVVWSELIKAVTSLFIILYEERSVWKWLRHLYENIILQPVDCLKVSVPSFIYVLQNNLLYIAVSNLEAATFQVTYQLKILTTAVFSVIMLRKQLASLQWVSLVILFVGVSVVQLQASGDDDKKHTDEAKATIQKEGAVEQNPVKGFIAVCVSCVLSGFAGVYFEKILKGTSQSVWLRNVQLGVLGVLIGVITMFIKNGQEVQEKGMLYGFDYAVWIVVFLQSFGGLVVAVVVKYADNILKGFATSAAIILSCIASMYFFDFHLTILFSVGASLVILAVYMYSKFVPQPV 367          
BLAST of slc35a-3 vs. TrEMBL
Match: K1P7Y3 (UDP-galactose translocator OS=Crassostrea gigas OX=29159 GN=CGI_10007487 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 3.049e-84
Identity = 145/314 (46.18%), Postives = 219/314 (69.75%), Query Frame = 2
Query:   65 YIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFND-----IGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTK 991
            ++K  SL+ L +QNA  ILMMRY RTR  ++F +++ +I++E++K L   ++  Y+ G  + +    N+       D +K+ VP+ IY +QNNLL+VA+SNLD+AVFQV+YQLK+LTTA+FSV +L + + ++QWL+LF+LF GVALVQ+  ++     VA  + Q  ++G+ AVL  C +SGFAG+YFEK LKG+  S+W RNV +  IG +I        +   + EKGFF+G+DY+V  +I LQS GGL+VAVVVKYA+ +LKGFA S +I+IS + +++ F  ++S  F VGA++V++S+ +YSK+ P K
Sbjct:   14 HLKYFSLVTLMLQNAVFILMMRYVRTRPGDMFMSTTAVIMSEVLKFLACFIIIFYKEGSVRAFLSHLNENIIQQPMDCLKISVPSIIYTVQNNLLFVAVSNLDAAVFQVTYQLKILTTALFSVLMLGKPLSRLQWLALFILFCGVALVQVQPSNSSQSKVA--VEQRPLLGLVAVLVQCCLSGFAGVYFEKILKGTNQSIWLRNVQLGIIGSVIGLITMEINDGPKVTEKGFFFGYDYVVWTVICLQSFGGLVVAVVVKYADNILKGFATSGAIIISCIAAIYFFDFHLSLQFFVGATLVIISVFMYSKYVPMK 325          
BLAST of slc35a-3 vs. Ensembl Cavefish
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:103035724])

HSP 1 Score: 243.817 bits (621), Expect = 1.927e-77
Identity = 140/313 (44.73%), Postives = 211/313 (67.41%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG------IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSK-GVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            K+KYI   SL +L IQNAS IL +RY RT   + FF +S +++ E++K++   ++  ++        +  LY        D++K+ VP+ IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L++S+ ++QW+SL LLF+GVA+VQ+   S   K  +     QN   G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RNV +   G ++   G W+ +  +I EKGF +G+  MV  +IF Q+ GGLLVAVVVKYA+ +LKGFA S SI++S + S+++F  +V  +F +GA +V+ ++ +YS
Sbjct:   28 KLKYI---SLAVLVIQNASLILSIRYVRTLPGDRFFATSAVVMAEVLKVITCLIILLFEKKGNIRDFVALLYDSIVVQYRDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLRKSLSRVQWVSLLLLFAGVAIVQVQQDSSKQKEAITSSTNQNYAKGLVAVVVSCLSSGFAGVYFEKILKGSSASVWLRNVQLGIFGTVLGLLGMWWNDGAAIAEKGFTFGYTSMVWGVIFNQAFGGLLVAVVVKYADNILKGFATSFSIIVSTVMSIYLFGFHVDLMFTLGAGLVIGAVYMYS 337          
BLAST of slc35a-3 vs. Ensembl Cavefish
Match: slc35a3a (UDP-N-acetylglucosamine transporter-like [Source:NCBI gene;Acc:103041649])

HSP 1 Score: 214.157 bits (544), Expect = 1.227e-66
Identity = 128/322 (39.75%), Postives = 197/322 (61.18%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG--IKKLY----HETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTY-VSGLFLVGASMVVVSIVLYS-KFSPTKIKKE 1003
            +K LSL +L  Q  S +L MRY RT  ++   +  SS ++V E++K+L    + C +    ++ L+     E  +   +++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L + +   QWLSL +L +GVALVQ  + S G+         +  +G+ AVL AC  SGFAG+YFEK LK +  S+W RN+ +   G++    G   Y+ E + E G F G++ +   ++ LQ+ GGL++A V+KYA+ +LKGFA S SI++S L S F    +  + +F +GA +V+V+  LY  +  P  I   
Sbjct:    6 LKYLSLGVLVFQTTSLVLTMRYSRTLQSDGPRYLASSAVVVAELLKILTCIGLVCKEHSYSVRALHSVLRQEILHKPIETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGLYQWLSLLILMAGVALVQWPTDSPGTPEKEQPASGSPFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGMFGLVFGLFGMVLYDGERVREHGMFQGYNSITWTVVSLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFEPTSIFFLGAVLVIVATFLYGYESKPASIPSR 327          
BLAST of slc35a-3 vs. Ensembl Cavefish
Match: slc35a3a (UDP-N-acetylglucosamine transporter-like [Source:NCBI gene;Acc:103041649])

HSP 1 Score: 213.772 bits (543), Expect = 2.747e-66
Identity = 128/322 (39.75%), Postives = 197/322 (61.18%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVFCYQSG--IKKLY----HETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTY-VSGLFLVGASMVVVSIVLYS-KFSPTKIKKE 1003
            +K LSL +L  Q  S +L MRY RT  ++   +  SS ++V E++K+L    + C +    ++ L+     E  +   +++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L + +   QWLSL +L +GVALVQ  + S G+         +  +G+ AVL AC  SGFAG+YFEK LK +  S+W RN+ +   G++    G   Y+ E + E G F G++ +   ++ LQ+ GGL++A V+KYA+ +LKGFA S SI++S L S F    +  + +F +GA +V+V+  LY  +  P  I   
Sbjct:   26 LKYLSLGVLVFQTTSLVLTMRYSRTLQSDGPRYLASSAVVVAELLKILTCIGLVCKEHSYSVRALHSVLRQEILHKPIETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGLYQWLSLLILMAGVALVQWPTDSPGTPEKEQPASGSPFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGMFGLVFGLFGMVLYDGERVREHGMFQGYNSITWTVVSLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFEPTSIFFLGAVLVIVATFLYGYESKPASIPSR 347          
BLAST of slc35a-3 vs. Ensembl Cavefish
Match: slc35a3b (UDP-N-acetylglucosamine transporter [Source:NCBI gene;Acc:103042800])

HSP 1 Score: 209.92 bits (533), Expect = 1.172e-64
Identity = 128/314 (40.76%), Postives = 196/314 (62.42%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTE--LFFTSSVIIVTEIVKLLISTVVF-----CYQSGIKK-LYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDS---ASDGSKGVADGIVQ-NKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYV-SGLFLVGASMVVVSIVLY 970
            +K +SL +L +Q  S +L MRY RT   E   +  S+ ++ TE++K+++  ++      C   G+ + L  E  N   +++K+ +P+ IY +QNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L++ +   QWLSL +L  GVALVQ  S    S   KG+   +   ++ +G+ AVL AC  SGFAG+YFEK LK +  S+W RN+ +   G++    G   Y+ + I E G F G++ +   ++ LQ+ GGL++A V+KYA+ +LKGFA S SI+ S   S F    +V + LF +GA +V+ +  LY
Sbjct:   25 LKYVSLGVLVLQTTSLVLTMRYSRTLQDEGPRYLASTAVVFTEVIKIIVCVILVFRDHNCSMRGLNQVLKEEIVNKPLETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLRKGLGVYQWLSLVILMMGVALVQWPSDPQKSPEEKGMEQEMPTGSQFVGLLAVLVACFSSGFAGVYFEKILKETKQSVWIRNIQLGLFGLVFGVMGMLAYDGKRIKENGIFQGYNKVTYAVVLLQALGGLVIAAVIKYADNILKGFATSLSIIFSTFISYFWLADFVPTSLFFLGAVLVITATFLY 338          
BLAST of slc35a-3 vs. Ensembl Cavefish
Match: slc35a1 (solute carrier family 35 member A1 [Source:ZFIN;Acc:ZDB-GENE-080716-17])

HSP 1 Score: 204.142 bits (518), Expect = 9.163e-63
Identity = 125/313 (39.94%), Postives = 193/313 (61.66%), Query Frame = 2
Query:   92 LTIQNASHILMMRYCRT-RTTELFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLY--SKFSPTKIKKEE 1006
            +T+  A++ + +RY RT  +++L+F+++ + +TEI+KL +S  +   +SG        L         + +K+ VP+ +Y IQNN+ ++ALSNLD+AV+QV+YQLK+  TA+ +V +L +S+ ++QW S+F+L +GV LVQ   A      V     QN  +G  AV  A + SGFAG+YFEK LK S  SLW RN+ M   GI+++  G    +   + EKGFFYG+   VC ++FL S GGL  +VVVKY + ++KGF+ +A+IV+S + SV +F   ++  F  GA +V VSI LY   K   T + K +
Sbjct:    1 MTLVAAAYTVALRYTRTVSSSDLYFSTTAVCLTEIIKLFLSLGMLTRESGGFSRLRSTLMEHVCRSPKELLKLSVPSVVYAIQNNMAFIALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSRLQWFSVFMLCAGVTLVQWKPAELTKVQVE----QNPFVGFVAVAVAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIVVTLAGVCMTDGPQVMEKGFFYGYTPWVCFVVFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVTLFGLQITLTFASGALLVCVSIYLYGLPKLDTTVLPKAD 309          
BLAST of slc35a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001949.1 (pep scaffold:Pmarinus_7.0:GL478223:154121:174070:1 gene:ENSPMAG00000001752.1 transcript:ENSPMAT00000001949.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 8.142e-57
Identity = 132/313 (42.17%), Postives = 190/313 (60.70%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQ------SGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESIN-EKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            ++KY+   SL +L +QNAS IL +RY RT   + FF ++ +++ E++K+L   V+   Q        ++ LY        D++K+ VPA IY +QNNL YVA+SNL +A FQV+YQLK+LTTA+FSV +L +S+ + QW SL LLF GVA VQ+     G    A G  Q+ +IG+ AV+ +CV SGFAG+YFEK LK S  +   R + M          G W  +F  I   K +F+  + +   +I       LLVAVVVKYA+ +LKGFA S SI++S   +VF+F  +V  LF  GA+MV+ ++ +YS
Sbjct:    1 RLKYV---SLAVLVVQNASLILSIRYVRTLPGDKFFYTTAVVLAELLKMLTCLVLLLLQHRGNVCEWLRYLYESIVLQPADTLKLGVPAVIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLHRSLSRAQWGSLLLLFCGVAAVQVQQVGGGESSTAGGD-QSYLIGLVAVIISCVSSGFAGVYFEKILKVSHGTASLRVMTMVCAATRWGATGVWRRQFILIKIIKIYFHKNNQIWSTVIGRGFGNILLVAVVVKYADNILKGFATSLSILVSTAAAVFLFDFHVDWLFATGAAMVIGAVYIYS 309          
BLAST of slc35a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010664.1 (pep scaffold:Pmarinus_7.0:GL477367:216292:219753:1 gene:ENSPMAG00000009655.1 transcript:ENSPMAT00000010664.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 3.584e-29
Identity = 66/170 (38.82%), Postives = 107/170 (62.94%), Query Frame = 2
Query:  500 DSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYV-SGLFLVGASMVVVSIVLY---SKFSPTKIK 997
            D+A  G + ++ G   ++V+G+ AVL ACV SGFAG+YFEK LKGS  S+W RN+ +   G +    G   Y+ + + ++GF  G++ +  +++ LQ+ GGL+VA V+KYA+ +LKGFA S SI++S   S      ++ + +F VGA++V+++  LY    K  P  +K
Sbjct:    6 DAAPSGRQSLSVG---SQVVGLVAVLIACVSSGFAGVYFEKILKGSRQSVWVRNIQLGLFGTLFGLIGVIVYDGDKVWQQGFLQGYNSITWVVVILQAVGGLVVAAVIKYADNILKGFAASFSIILSSFISYMWLQDFIPTSVFFVGATLVILATFLYGYEPKALPVPMK 172          
BLAST of slc35a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005236.1 (pep scaffold:Pmarinus_7.0:GL479281:30128:33541:1 gene:ENSPMAG00000004758.1 transcript:ENSPMAT00000005236.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 7.615e-18
Identity = 35/103 (33.98%), Postives = 70/103 (67.96%), Query Frame = 2
Query:   83 LILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQV 376
            L ++T+  A++I+ +RY RT T +++F ++ + +TE+ KL++S  +   ++G      K ++ +   +  +++K+ +P+ +Y +QNN+ YVALSNLD+AV+QV
Sbjct:   17 LTVMTLVAAAYIVGLRYTRTTTGDMYFATTAVCLTEVAKLIVSFAMLTRETGSVRGMAKSVWEDVIVNRKETLKLAIPSLVYALQNNMGYVALSNLDAAVYQV 119          
BLAST of slc35a-3 vs. Ensembl Nematostella
Match: EDO43895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX29])

HSP 1 Score: 261.151 bits (666), Expect = 1.315e-85
Identity = 150/307 (48.86%), Postives = 214/307 (69.71%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            IK LSL +L IQNAS IL +RY RT   EL+  S+V+ +TE+VK ++S VV  ++       +K +Y  TF    D + + VPA IY +QNNL YVA+SNLD+AVFQV+YQLK+L+TA+ SV +LK+ + KMQW SL LLF GV++VQL    +  K     I QN ++G+ AV+ +C+ SGFAG+YFEKTLK +   LWARN+ +AF G II+  G  + +  ++ +KGFF+G+  +V  ++F Q  GGLLV +VVKYA+ +LKGFA + +IV+S + SV++F   +S  F+ GAS+V+++IVLYS
Sbjct:    1 IKYLSLAILAIQNASLILTIRYSRTIPGELYIASTVVAITEVVKGIVSLVVMLWEKKDPIEWLKYVYSSTFGQTKDMMLMAVPALIYTVQNNLQYVAISNLDAAVFQVTYQLKILSTALMSVLMLKKHLSKMQWFSLMLLFVGVSIVQLQDNGNQLK-THHSIKQNSLLGLAAVVASCICSGFAGVYFEKTLKATQTPLWARNLQLAFFGAIIALLGVAYNDGAAVKQKGFFFGYGPLVYGIVFSQVFGGLLVGIVVKYADNILKGFAAAVAIVLSCIMSVYMFGFKLSVEFVSGASLVIIAIVLYS 306          
BLAST of slc35a-3 vs. Ensembl Nematostella
Match: EDO34876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN25])

HSP 1 Score: 211.846 bits (538), Expect = 5.717e-66
Identity = 125/323 (38.70%), Postives = 199/323 (61.61%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTRTT-ELFFTSSVIIVTEIVKLLISTVVFCYQSGIK------KLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTY-VSGLFLVGASMVVVSIVLYSKFS----PTKIKK 1000
            +K + L +L +Q ++ +L MRY RT +   ++ +S+ +++ E+ K+     V  +Q+G        ++  E F    +++K+ VP+ +Y IQNNLLYVALSNLD+A +QV+YQLK+LTTA+FSV +L + +  ++W +L LL +GVA +Q  S  + S    D     K +G+ AVL+AC  SGFAG+YFEK LKG++ ++W RN+ +   GI+      +  + + +   GFF G++Y+  I++FLQ+ GGL+VA VVKYA+ +LKGFA S SI+ S L S +    +  + LF +G   V+ +  LY K      P+ + K
Sbjct:   22 LKYVCLGILVLQTSTLVLTMRYSRTVSVGPVYISSTAVVLAEVFKVFACLCVMFHQAGYNWRVFATEIDSEIFKKPLETLKLAVPSGLYTIQNNLLYVALSNLDAATYQVTYQLKILTTALFSVAMLSKKLSSIKWFALILLMAGVAAIQWPSGENKSSR-KDLSTSAKFVGLVAVLSACCSSGFAGVYFEKILKGTSATIWLRNIQLGSFGIVFGLAAVFVNDGKKVQNGGFFQGYNYITWIVVFLQAFGGLIVAAVVKYADNILKGFATSVSIIFSSLVSYYFLKDFNPTSLFFLGTCAVLTATYLYGKPEAQAKPSTVPK 343          
BLAST of slc35a-3 vs. Ensembl Nematostella
Match: EDO34874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN21])

HSP 1 Score: 202.986 bits (515), Expect = 6.392e-63
Identity = 126/299 (42.14%), Postives = 192/299 (64.21%), Query Frame = 2
Query:  155 LFFTSSVIIVTEIVKLLISTVVFCYQSG-----IKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSA---------SDGSKGVADGIV--QNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKE 1003
            ++ +S+ +I+ E+ K+    V+     G     ++ LY        D++K+ VPA IY IQNNL YVA+SNLD+A FQV+YQLK+LTTA+FSV +L +S+ ++QWLSL +LF+GV++VQL S+          + +   +  +   QN ++G GAV+ + + SGFAG+YFEK LKG++ S+W RNV +     +I   G    +   I EKGFF G+  +V  +I +Q+ GGLLVAVVVKYA+ +LKGFA S SIV+S + S+++F  + S  F+VGA++V  +I LYS     ++ ++
Sbjct:    1 MYVSSTAVIMAEVFKVATCLVILLVMQGGVLSWLRHLYDSIIGQPIDTLKLSVPALIYTIQNNLQYVAISNLDAATFQVTYQLKILTTALFSVLMLNKSLGRLQWLSLVMLFAGVSIVQLQSSSTKSSSTSQPNATMAPSANLATKQNALLGFGAVVMSSLCSGFAGVYFEKILKGTSGSVWLRNVQLGAYSTVIGLIGMQLNDGAKIAEKGFFQGYSSLVWSVICMQAFGGLLVAVVVKYADNILKGFATSFSIVLSCIVSIYLFAFHASLQFVVGAALVCTAIYLYSTPPQQQLPQK 299          
BLAST of slc35a-3 vs. Ensembl Nematostella
Match: EDO43955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX28])

HSP 1 Score: 120.939 bits (302), Expect = 8.447e-33
Identity = 84/204 (41.18%), Postives = 134/204 (65.69%), Query Frame = 2
Query:  371 QVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLD----SASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLY 970
            Q++ QLK++TTA+FS+ +L +SI + +W  L +L  GVA+V+++     A+  +K  AD   ++ +IG  +VL A V+SGFAG++ EK +K  + SLW  NV +   G+ +   G    +   I++ GFFYG+D +V  ++ L SAGG+LV++V+KYA+ + KGFA S +IV+S L SV IF    S  F++GA +VV +++LY
Sbjct:    1 QITNQLKIMTTALFSILLLNKSISRKRWFYLLMLMIGVAVVEIELHRKIAAKMNKKEADAASKSFLIGFLSVLAASVISGFAGVFLEKIVKHKSTSLWIMNVHLYSWGVCLGVLGVVLKDGYQISQLGFFYGYDSVVWTVVALASAGGILVSLVLKYASTITKGFATSCAIVLSSLASVIIFGFDPSIYFILGAFLVVFAVILY 204          
BLAST of slc35a-3 vs. Ensembl Nematostella
Match: EDO36570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIC2])

HSP 1 Score: 71.633 bits (174), Expect = 6.272e-14
Identity = 76/292 (26.03%), Postives = 143/292 (48.97%), Query Frame = 2
Query:  164 TSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVI----VPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGST--ISLWARNVLMAFIGI-----IISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 1006
            T++V++ TE+VKL  +    C+    +    E    I D+IKV+    +PA +Y + NNL +V L   D   + +  Q +++ T V    +  + + ++QW+SL LL +G  + QL+  +  S G++  +  N V+ +  V  +C    FAG+Y E  LKG +    +  +NV M    I     ++ +GG      E+  ++       + V  +I   +  G++ ++ +K  N +LK FA +  ++ + + +  IF   ++ L  V   +V  + +LYS+ +P    K E
Sbjct:   54 TTTVVLFTEVVKLFAA----CFLQLQESTPREFLTHIKDNIKVLGLYLIPAFLYCLYNNLAFVNLGAYDPTTYYLLLQFRVVVTGVIFQCLFSKQLSRIQWVSLLLLTAGCIVKQLN-FNTMSSGLSLKLDYNLVLILVQVFCSC----FAGVYNEYLLKGRSGDAPIMVQNVFMYVDSILCNILVLVYGGSL---QEAFTKESLLSIMQFKVLGIIANNAGIGIVTSLFLKRLNSILKTFASALELMFTAVLAWIIFGIPINILTFVAIVIVSYATILYSQ-NPVDNTKPE 332          
BLAST of slc35a-3 vs. Ensembl Medaka
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:101172226])

HSP 1 Score: 247.284 bits (630), Expect = 5.469e-79
Identity = 142/312 (45.51%), Postives = 214/312 (68.59%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQS--GIKKLYHETFNDI----GDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            K+KYI   SL +L +QNAS IL +RY RT   E FF++S +++ E++K+    V+   Q    +K+  H   N I     D++K+ +PA IY +QNNL Y+A+SNL +A FQV+YQLK+LTTA+FSV +LK+S+ ++QW+SL LLF+GVA+VQ+    +    +A+   QN ++G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RNV +   G  +   G W+ +  ++ E+GF +G+  MV  +IF Q+ GGLLVA+VVKYA+ +LKGFA S SI++S + S+F+F  +V  LF  GA +V+ ++ +YS
Sbjct:   25 KLKYI---SLAVLVVQNASLILSIRYVRTLPGERFFSTSAVVMAEVLKVCTCLVIILLQKRFNLKETLHLLLNSIVFQYRDTLKLAIPALIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLKKSLSRVQWISLLLLFAGVAIVQVQQEGNKEASMAN---QNYMVGVVAVVISCLSSGFAGVYFEKILKGSSASVWIRNVQLGIFGTALGLLGLWWNDGAAVAERGFLFGYTGMVWCVIFNQAFGGLLVAMVVKYADNILKGFATSFSIIVSTVMSIFLFSFHVDLLFTAGAGLVIGAVYMYS 330          
BLAST of slc35a-3 vs. Ensembl Medaka
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:101172226])

HSP 1 Score: 246.899 bits (629), Expect = 9.040e-79
Identity = 142/312 (45.51%), Postives = 214/312 (68.59%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQS--GIKKLYHETFNDI----GDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            K+KYI   SL +L +QNAS IL +RY RT   E FF++S +++ E++K+    V+   Q    +K+  H   N I     D++K+ +PA IY +QNNL Y+A+SNL +A FQV+YQLK+LTTA+FSV +LK+S+ ++QW+SL LLF+GVA+VQ+    +    +A+   QN ++G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RNV +   G  +   G W+ +  ++ E+GF +G+  MV  +IF Q+ GGLLVA+VVKYA+ +LKGFA S SI++S + S+F+F  +V  LF  GA +V+ ++ +YS
Sbjct:   25 KLKYI---SLAVLVVQNASLILSIRYVRTLPGERFFSTSAVVMAEVLKVCTCLVIILLQKRFNLKETLHLLLNSIVFQYRDTLKLAIPALIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLKKSLSRVQWISLLLLFAGVAIVQVQQEGNKEASMAN---QNYMVGVVAVVISCLSSGFAGVYFEKILKGSSASVWIRNVQLGIFGTALGLLGLWWNDGAAVAERGFLFGYTGMVWCVIFNQAFGGLLVAMVVKYADNILKGFATSFSIIVSTVMSIFLFSFHVDLLFTAGAGLVIGAVYMYS 330          
BLAST of slc35a-3 vs. Ensembl Medaka
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:101172226])

HSP 1 Score: 246.514 bits (628), Expect = 1.459e-78
Identity = 142/312 (45.51%), Postives = 214/312 (68.59%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQS--GIKKLYHETFNDI----GDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYS 973
            K+KYI   SL +L +QNAS IL +RY RT   E FF++S +++ E++K+    V+   Q    +K+  H   N I     D++K+ +PA IY +QNNL Y+A+SNL +A FQV+YQLK+LTTA+FSV +LK+S+ ++QW+SL LLF+GVA+VQ+    +    +A+   QN ++G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RNV +   G  +   G W+ +  ++ E+GF +G+  MV  +IF Q+ GGLLVA+VVKYA+ +LKGFA S SI++S + S+F+F  +V  LF  GA +V+ ++ +YS
Sbjct:   25 KLKYI---SLAVLVVQNASLILSIRYVRTLPGERFFSTSAVVMAEVLKVCTCLVIILLQKRFNLKETLHLLLNSIVFQYRDTLKLAIPALIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLKKSLSRVQWISLLLLFAGVAIVQVQQEGNKEASMAN---QNYMVGVVAVVISCLSSGFAGVYFEKILKGSSASVWIRNVQLGIFGTALGLLGLWWNDGAAVAERGFLFGYTGMVWCVIFNQAFGGLLVAMVVKYADNILKGFATSFSIIVSTVMSIFLFSFHVDLLFTAGAGLVIGAVYMYS 330          
BLAST of slc35a-3 vs. Ensembl Medaka
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:101172226])

HSP 1 Score: 225.328 bits (573), Expect = 9.016e-71
Identity = 121/269 (44.98%), Postives = 181/269 (67.29%), Query Frame = 2
Query:   56 KMKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQS--GIKKLYHETFNDI----GDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLL 844
            K+KYI   SL +L +QNAS IL +RY RT   E FF++S +++ E++K+    V+   Q    +K+  H   N I     D++K+ +PA IY +QNNL Y+A+SNL +A FQV+YQLK+LTTA+FSV +LK+S+ ++QW+SL LLF+GVA+VQ+    +    +A+   QN ++G+ AV+ +C+ SGFAG+YFEK LKGS+ S+W RNV +   G  +   G W+ +  ++ E+GF +G+  MV  +IF Q+ GGLLVA+VV +   LL
Sbjct:   25 KLKYI---SLAVLVVQNASLILSIRYVRTLPGERFFSTSAVVMAEVLKVCTCLVIILLQKRFNLKETLHLLLNSIVFQYRDTLKLAIPALIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLKKSLSRVQWISLLLLFAGVAIVQVQQEGNKEASMAN---QNYMVGVVAVVISCLSSGFAGVYFEKILKGSSASVWIRNVQLGIFGTALGLLGLWWNDGAAVAERGFLFGYTGMVWCVIFNQAFGGLLVAMVVNFHVDLL 287          
BLAST of slc35a-3 vs. Ensembl Medaka
Match: slc35a1 (solute carrier family 35 member A1 [Source:NCBI gene;Acc:100049482])

HSP 1 Score: 201.06 bits (510), Expect = 2.186e-61
Identity = 122/303 (40.26%), Postives = 197/303 (65.02%), Query Frame = 2
Query:   83 LILLTIQNASHILMMRYCRTRTT-ELFFTSSVIIVTEIVKLLISTVVFCYQSG-IKKL-----YHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLY 970
            L ++T+  A++ + +RY RT ++ +L+F+++ + +TE+ KL++S  +   ++G + KL      H  F+   + +K+ VP+ +Y IQNN+ +VALSNLD+AV+QV+YQLK+  TA+ +V +L +S+ ++QW S+F+L  GV LVQ   A    +     I QN  +G  A+  A + SGFAG+YFEK LK S  SLW RN+ M   GI+++  G +  + + + EKGFF+G+   VC ++FL S GGL  +VVVKY + ++KGF+ +A+IV+S + SV +F   ++  F  GA +V +SI LY
Sbjct:   15 LTVMTLVAAAYTVALRYTRTISSGDLYFSTTAVCITEVFKLILSLGMLTKETGSLVKLKSTIEEHIIFSP-KELLKLSVPSVVYAIQNNMAFVALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSRLQWFSVFMLCGGVTLVQWRPA----EATKVQIEQNPFMGFVAIAVAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIVVTLIGVYVTDGDKVLEKGFFFGYTPWVCFVVFLSSVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVLLFGLQITFAFASGAILVCISIYLY 312          
BLAST of slc35a-3 vs. Planmine SMEST
Match: SMESG000020105.1 (SMESG000020105.1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 2
Query:   59 MKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 1006
            MKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE
Sbjct:    1 MKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 316          
BLAST of slc35a-3 vs. Planmine SMEST
Match: SMESG000020105.1 (SMESG000020105.1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 2
Query:  122 MMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 1006
            MMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE
Sbjct:    1 MMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 295          
BLAST of slc35a-3 vs. Planmine SMEST
Match: SMESG000020105.1 (SMESG000020105.1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 294/294 (100.00%), Postives = 294/294 (100.00%), Query Frame = 2
Query:  125 MRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 1006
            MRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE
Sbjct:    1 MRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVSIVLYSKFSPTKIKKEE 294          
BLAST of slc35a-3 vs. Planmine SMEST
Match: SMESG000022370.1 (SMESG000022370.1)

HSP 1 Score: 231.106 bits (588), Expect = 2.456e-73
Identity = 135/317 (42.59%), Postives = 208/317 (65.62%), Query Frame = 2
Query:   68 IKELSLILLTIQNASHILMMRYCRTR--TTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIG--------DSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACXXXXXXXXXXXXXXXHTYVSG-LFLVGASMVVVSIVLYSKFSP 985
            +K +SL+LL  Q  + +L+MRY R    T++ + +S+ + + EI+KL     + CYQ+  K  + +TFN I         D++K+ VP+A+Y IQNNLLY+ALSNLD+A +QV+YQLK+LTTAVFSV +L + +   QW SL +L  GV+ VQ    SD  +G  +     ++IG+ +VL ACV SGFAG+YFEK LKGS+ S+W RN+ +   G ++   G    ++  I + GFF G++++  I+I LQ+ GGL++AVV+KYA+ +LKGFA S SI++S +FS +I   ++    FL+G + V+++  LY  ++P
Sbjct:    3 LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICYQNQFK--FKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQW--PSDSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQLGLFGSVLGLFGVLVTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATSISIILSSIFSYYILSDFIPNTFFLIGTTFVLIATFLYG-YTP 314          
BLAST of slc35a-3 vs. Planmine SMEST
Match: SMESG000021327.1 (SMESG000021327.1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.389e-18
Identity = 74/257 (28.79%), Postives = 134/257 (52.14%), Query Frame = 2
Query:  107 ASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNL-LYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSL-FLLFSGVALVQLDSASDG---SKGVAD--GIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKG-STISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGF 853
            +S+ + +  C       F +SS++++TEI K ++S ++F  +     L    F  I   I   VP  +Y + NNL +Y+ L  +D A +QV    K+LTTA+    I+K+ I K+QW++L FLL +G+      + S G   +K V    G +   + G+  +   C +SG +G+Y E  LK    +S+  +N L+   GI+++ G  + Y+     +   F G+     +LI  Q+  G+++ V++K+A+ + + F
Sbjct:   40 SSYTIFVHLCEIDGKIPFKSSSMVLMTEITKFVMSAIMFIPEYKKHGLQLPPFLLI---IPFAVPGFLYCLNNNLAVYIQLE-MDPATYQVLGNFKILTTAILFRLIIKKPITKIQWIALGFLLLAGI------TNSYGGFINKLVVKDLGHIYITIAGLIMIFIYCTVSGLSGVYTEYVLKNQKELSIHLQNGLLYSFGILLN-GILFLYQGYDTADYAMFTGYTVYTWLLIISQAVIGIIMGVIMKHASNITRLF 285          
The following BLAST results are available for this feature:
BLAST of slc35a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC35A22.595e-7444.09solute carrier family 35 member A2 [Source:HGNC Sy... [more]
SLC35A22.276e-7344.55solute carrier family 35 member A2 [Source:HGNC Sy... [more]
SLC35A22.276e-7344.55solute carrier family 35 member A2 [Source:HGNC Sy... [more]
SLC35A22.583e-7344.55solute carrier family 35 member A2 [Source:HGNC Sy... [more]
SLC35A23.026e-7344.55solute carrier family 35 member A2 [Source:HGNC Sy... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nstp-45.224e-6940.49Nucleotide Sugar TransPorter family [Source:UniPr... [more]
nstp-36.645e-6940.00Nucleotide Sugar TransPorter family [Source:UniPr... [more]
nstp-52.584e-6837.43Nucleotide Sugar TransPorter family [Source:UniPr... [more]
srf-32.418e-6442.53UDP-galactose/UDP-N-acetylglucosamine transporter ... [more]
srf-34.629e-6442.53UDP-galactose/UDP-N-acetylglucosamine transporter ... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ugalt2.157e-6841.16gene:FBgn0024994 transcript:FBtr0345710[more]
Ugalt2.157e-6841.16gene:FBgn0024994 transcript:FBtr0070501[more]
Ugalt2.608e-6841.16gene:FBgn0024994 transcript:FBtr0273276[more]
senju1.813e-1726.49gene:FBgn0031676 transcript:FBtr0079009[more]
back to top
BLAST of slc35a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35a21.068e-7644.84solute carrier family 35 member 2 [Source:ZFIN;Acc... [more]
slc35a11.290e-6740.58solute carrier family 35 member A1 [Source:ZFIN;Ac... [more]
slc35a3b1.537e-6542.26solute carrier family 35 member A3b [Source:ZFIN;A... [more]
slc35a3b2.223e-6542.26solute carrier family 35 member A3b [Source:ZFIN;A... [more]
slc35a3a7.902e-6240.13solute carrier family 35 member A3a [Source:ZFIN;A... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crabp11.187e-6841.72cellular retinoic acid binding protein 1 [Source:X... [more]
mindy21.887e-6840.49to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
crabp12.322e-6642.03cellular retinoic acid binding protein 1 [Source:X... [more]
mindy22.900e-5439.45to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
mindy26.390e-5439.45to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc35a28.522e-7243.91solute carrier family 35 (UDP-galactose transporte... [more]
Slc35a28.522e-7243.91solute carrier family 35 (UDP-galactose transporte... [more]
Slc35a29.667e-7243.91solute carrier family 35 (UDP-galactose transporte... [more]
Slc35a17.991e-7040.63solute carrier family 35 (CMP-sialic acid transpor... [more]
Slc35a33.528e-6741.67solute carrier family 35 (UDP-N-acetylglucosamine ... [more]
back to top
BLAST of slc35a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q58DA6|S35A2_BOVIN2.300e-7344.23UDP-galactose translocator OS=Bos taurus OX=9913 G... [more]
sp|P78381|S35A2_HUMAN1.240e-7244.55UDP-galactose translocator OS=Homo sapiens OX=9606... [more]
sp|Q8WMS0|S35A2_CANLF1.390e-7244.23UDP-galactose translocator OS=Canis lupus familiar... [more]
sp|Q9R0M8|S35A2_MOUSE5.961e-7143.91UDP-galactose translocator OS=Mus musculus OX=1009... [more]
sp|Q61420|S35A1_MOUSE5.589e-6940.63CMP-sialic acid transporter OS=Mus musculus OX=100... [more]
back to top
BLAST of slc35a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJH40.000e+0100.00Slc35a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A210PPQ32.684e-8849.21UDP-galactose translocator OS=Mizuhopecten yessoen... [more]
V4AN809.990e-8748.86Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7NSS38.663e-8646.01Uncharacterized protein OS=Pomacea canaliculata OX... [more]
K1P7Y33.049e-8446.18UDP-galactose translocator OS=Crassostrea gigas OX... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35a21.927e-7744.73solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a3a1.227e-6639.75UDP-N-acetylglucosamine transporter-like [Source:N... [more]
slc35a3a2.747e-6639.75UDP-N-acetylglucosamine transporter-like [Source:N... [more]
slc35a3b1.172e-6440.76UDP-N-acetylglucosamine transporter [Source:NCBI g... [more]
slc35a19.163e-6339.94solute carrier family 35 member A1 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001949.18.142e-5742.17pep scaffold:Pmarinus_7.0:GL478223:154121:174070:1... [more]
ENSPMAT00000010664.13.584e-2938.82pep scaffold:Pmarinus_7.0:GL477367:216292:219753:1... [more]
ENSPMAT00000005236.17.615e-1833.98pep scaffold:Pmarinus_7.0:GL479281:30128:33541:1 g... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc35a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438951.315e-8548.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348765.717e-6638.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348746.392e-6342.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439558.447e-3341.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365706.272e-1426.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc35a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35a25.469e-7945.51solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a29.040e-7945.51solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a21.459e-7845.51solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a29.016e-7144.98solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a12.186e-6140.26solute carrier family 35 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc35a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020105.10.000e+0100.00SMESG000020105.1[more]
SMESG000020105.10.000e+0100.00SMESG000020105.1[more]
SMESG000020105.10.000e+0100.00SMESG000020105.1[more]
SMESG000022370.12.456e-7342.59SMESG000022370.1[more]
SMESG000021327.13.389e-1828.79SMESG000021327.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003645
GenBankAKN21639.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003645 ID=SMED30003645|Name=slc35a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1089bp
ATTTTTATTTTAAAATTCTTAGATTATTTTTAAATTTTTTTTATTTTAAA
TCCCAAAAATGAAGTATATCAAGGAACTAAGTTTAATATTATTAACAATT
CAAAATGCAAGTCATATATTAATGATGCGATATTGCAGAACAAGAACTAC
GGAATTATTTTTCACATCATCAGTTATTATTGTTACAGAAATTGTTAAAT
TACTGATAAGCACTGTAGTATTTTGCTACCAAAGTGGAATTAAGAAACTA
TATCATGAGACATTTAATGACATTGGTGATAGTATTAAAGTAATAGTTCC
AGCTGCTATATATGTTATTCAAAATAATCTTTTGTATGTAGCGTTAAGCA
ATTTAGATTCGGCAGTATTTCAAGTTTCATATCAATTGAAATTATTAACA
ACTGCTGTATTTAGTGTTTTTATTTTAAAACAGTCCATTTTGAAAATGCA
ATGGTTGTCACTGTTTTTATTATTTAGTGGAGTTGCTTTAGTCCAATTAG
ATTCAGCCTCAGATGGATCGAAAGGTGTTGCTGATGGTATTGTTCAAAAT
AAAGTAATTGGAATGGGAGCAGTTTTAACTGCTTGTGTAATGTCTGGATT
TGCTGGAATCTATTTTGAAAAGACTCTAAAGGGATCAACAATATCTTTAT
GGGCTCGAAATGTTTTAATGGCATTTATTGGAATTATAATAAGTTTCGGG
GGTCAATGGTTTTATGAATTTGAAAGTATTAATGAAAAAGGATTTTTCTA
TGGTTTCGATTATATGGTTTGCATATTAATATTCCTTCAATCGGCTGGTG
GACTTTTGGTAGCCGTCGTAGTAAAATATGCTAATCAACTATTAAAGGGC
TTCGCTTGTTCTGCCTCAATTGTGATATCGATTCTATTTAGTGTTTTCAT
ATTTCATACCTATGTCAGTGGTCTGTTCCTGGTGGGGGCCTCAATGGTCG
TCGTGTCGATTGTCCTCTACAGTAAATTCAGTCCCACCAAAATTAAGAAA
GAAGAATAGAGATTATTTTTGCAATATCATTTTATGAATTATTTGTTATA
AATATAGCTCTTTTCCCTTTGTACTTGATTAATTGCGAT
back to top

protein sequence of SMED30003645-orf-1

>SMED30003645-orf-1 ID=SMED30003645-orf-1|Name=SMED30003645-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=317bp
MKYIKELSLILLTIQNASHILMMRYCRTRTTELFFTSSVIIVTEIVKLLI
STVVFCYQSGIKKLYHETFNDIGDSIKVIVPAAIYVIQNNLLYVALSNLD
SAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSA
SDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWAR
NVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLL
VAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSGLFLVGASMVVVS
IVLYSKFSPTKIKKEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015165pyrimidine nucleotide-sugar transmembrane transporter activity
GO:0005351sugar:proton symporter activity
GO:0005459UDP-galactose transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0090481pyrimidine nucleotide-sugar transmembrane transport
GO:0008643carbohydrate transport
GO:0006810transport
GO:0015992proton transport
GO:0072334UDP-galactose transmembrane transport
GO:0097624UDP-galactose transmembrane import into Golgi lumen
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR007271Nuc_sug_transpt
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0030173integral component of Golgi membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007271Nucleotide-sugar transporterPFAMPF04142Nuc_sug_transpcoord: 3..305
e-value: 4.1E-104
score: 348.1
IPR007271Nucleotide-sugar transporterPIRSFPIRSF005799UDP-gal_transptcoord: 1..316
e-value: 1.2E-95
score: 317.8
IPR007271Nucleotide-sugar transporterPANTHERPTHR10231NUCLEOTIDE-SUGAR TRANSMEMBRANE TRANSPORTERcoord: 3..313
NoneNo IPR availableTIGRFAMTIGR00803TIGR00803coord: 80..304
e-value: 7.8E-52
score: 174.1
NoneNo IPR availablePANTHERPTHR10231:SF43UDP-GALACTOSE TRANSLOCATORcoord: 3..313
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 78..149
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 166..185
NoneNo IPR availableTMHMMTMhelixcoord: 288..305
NoneNo IPR availableTMHMMTMhelixcoord: 232..254
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 197..219
NoneNo IPR availableTMHMMTMhelixcoord: 132..151
NoneNo IPR availableTMHMMTMhelixcoord: 101..123