2-aminoethanethiol dioxygenase

Overview
Name2-aminoethanethiol dioxygenase
Smed IDSMED30003617
Length (bp)1156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 2-aminoethanethiol dioxygenase (SMED30003617) t-SNE clustered cells

Violin plots show distribution of expression levels for 2-aminoethanethiol dioxygenase (SMED30003617) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 2-aminoethanethiol dioxygenase (SMED30003617) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 2-aminoethanethiol dioxygenase (SMED30003617) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003617

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003617SMESG000043231.1 SMESG000017924.1 Contig5247GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Human
Match: ADO (2-aminoethanethiol dioxygenase [Source:HGNC Symbol;Acc:HGNC:23506])

HSP 1 Score: 105.531 bits (262), Expect = 1.491e-25
Identity = 76/215 (35.35%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  352 VLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRV---FGNKPMS-----SFT-PLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEG-AAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            V Y+HI E + FSLG+F+L+ G+ IPLHDHP M G++KV+YG +R     ++    G +P +      F  PL PR  E     ++ +   +    EA    I L+P   N H++  V  EG AAF+DILAPPYD   G R+CH+Y+ +   R                P +  +S  D  +        V+ +ET Q  D+WC+   Y GPKV 
Sbjct:   85 VTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRS---RAEYTEASGPCI-LTPHRDNLHQIDAV--EGPAAFLDILAPPYDPDDG-RDCHYYRVLEPVR----------------PKEASSSACDLPR-------EVWLLETPQADDFWCEGEPYPGPKVF 269          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Fly
Match: CG7550 (gene:FBgn0035839 transcript:FBtr0076736)

HSP 1 Score: 98.2117 bits (243), Expect = 2.121e-23
Identity = 50/145 (34.48%), Postives = 82/145 (56.55%), Query Frame = 1
Query:  346 APVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCL---GQRECHFYQEIS 771
            AP  Y+HI E++ FS+ +F++R  S IPLHDHP MFGL++ I+G +   SF+   G     ++ P     H+     ++     +  ++   S    L+P + N+H++  +G+  AAF DIL+PPYD  +   G R+C FY+  +
Sbjct:   58 APCSYMHIFEDDRFSMSLFIVRGASTIPLHDHPMMFGLLRCIWGQLMVDSFSHQLGPDEPLTYDP-----HQ----TVVKVNVEEPKLVTPASPCATLTPRKRNYHQIAQIGSGVAAFFDILSPPYDADMPTYGPRQCRFYRATA 193          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Zebrafish
Match: adob (2-aminoethanethiol (cysteamine) dioxygenase b [Source:ZFIN;Acc:ZDB-GENE-040426-2267])

HSP 1 Score: 120.553 bits (301), Expect = 2.219e-31
Identity = 71/207 (34.30%), Postives = 105/207 (50.72%), Query Frame = 1
Query:  343 SAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKV 963
            + PV Y+HI E + FS+G+F+L+ G+ IPLHDHP M+G++KVIYG +R   F R+   +  +S     P L  +Q   L  +           S   +LSP + N H++  V     AF+DILAPPYD   G R+CH+Y+ +            Q  ++A+             K   + Q  V+ +E  QP ++WC    Y GPKV
Sbjct:   66 APPVTYMHICETDSFSMGVFLLKTGASIPLHDHPGMYGMLKVIYGKVRISCFDRLDKPRDGASGVQFNPPLMPFQRGSLRPSVLKSVGEFTEDSSPCVLSPQQDNIHQIDAVDGP-TAFLDILAPPYDPDEG-RDCHYYKVL------------QAHSEAAD-----------KKSEVQDQGDVWLMEIPQPSEFWCGGEPYPGPKV 247          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Zebrafish
Match: adob (2-aminoethanethiol (cysteamine) dioxygenase b [Source:ZFIN;Acc:ZDB-GENE-040426-2267])

HSP 1 Score: 120.553 bits (301), Expect = 2.300e-31
Identity = 71/207 (34.30%), Postives = 105/207 (50.72%), Query Frame = 1
Query:  343 SAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKV 963
            + PV Y+HI E + FS+G+F+L+ G+ IPLHDHP M+G++KVIYG +R   F R+   +  +S     P L  +Q   L  +           S   +LSP + N H++  V     AF+DILAPPYD   G R+CH+Y+ +            Q  ++A+             K   + Q  V+ +E  QP ++WC    Y GPKV
Sbjct:   71 APPVTYMHICETDSFSMGVFLLKTGASIPLHDHPGMYGMLKVIYGKVRISCFDRLDKPRDGASGVQFNPPLMPFQRGSLRPSVLKSVGEFTEDSSPCVLSPQQDNIHQIDAVDGP-TAFLDILAPPYDPDEG-RDCHYYKVL------------QAHSEAAD-----------KKSEVQDQGDVWLMEIPQPSEFWCGGEPYPGPKV 252          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Zebrafish
Match: adoa (2-aminoethanethiol (cysteamine) dioxygenase a [Source:ZFIN;Acc:ZDB-GENE-041212-62])

HSP 1 Score: 114.775 bits (286), Expect = 3.133e-29
Identity = 66/205 (32.20%), Postives = 99/205 (48.29%), Query Frame = 1
Query:  349 PVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKV 963
            PV Y+HI E ++FS+G+F+L+ G+ IPLHDHP M G++KV+YG +  R + ++       +     P L  +Q +D+              S   +LSP + N HE+  V +  AAF+DILAPPYD   G R+CH+Y+ +                              G K  +      + +E  QP D+WC    Y GP+V
Sbjct:   72 PVTYMHICETDVFSMGVFLLKSGASIPLHDHPGMHGMLKVLYGKVSIRCYDKL-DKAESDTERHFDPPLLAFQGDDVRRAALRSSGQFSELSGPCVLSPFKDNLHEIDAV-DGAAAFLDILAPPYDPDDG-RDCHYYRVLQTA---------------------------GKKSEQSGDDEAWLLEIPQPDDFWCGGEPYPGPEV 246          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Xenopus
Match: cog4 (component of oligomeric golgi complex 4 [Source:Xenbase;Acc:XB-GENE-6085196])

HSP 1 Score: 122.865 bits (307), Expect = 6.107e-32
Identity = 77/232 (33.19%), Postives = 113/232 (48.71%), Query Frame = 1
Query:  295 DISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFT---------PLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKV 963
            D+       ++ G     PV Y+HI E   FS+G+F+LRPG+ IPLHDHP M GL+KV+YG +R   F R+      ++           PLLP    ++   +          +   S   LL+P   N H++  V    AAF+DILAPPYD   G R+CH+Y+ +      +   G  +   A+S      +N  G      +Q+ ++ +E  QP D+WC    Y GPKV
Sbjct:   50 DVGLGGGRPRSAGGKGP-PVTYMHICETSCFSMGVFLLRPGACIPLHDHPGMHGLLKVLYGKLRVSGFDRLEAAGGTAAAKEPEAAAFSPPLLP----YECGSVRRAALRSVGELGDSSPPCLLAPHRENLHQISAVDGP-AAFLDILAPPYDPADG-RDCHYYKLLQPAASSAAPAGESDGPAAAS------ANPAGGT----AQKEIWLLEIPQPDDFWCGGEPYPGPKV 264          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Mouse
Match: Ado (2-aminoethanethiol (cysteamine) dioxygenase [Source:MGI Symbol;Acc:MGI:2685083])

HSP 1 Score: 105.916 bits (263), Expect = 6.011e-26
Identity = 70/209 (33.49%), Postives = 100/209 (47.85%), Query Frame = 1
Query:  349 PVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRV---FGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            PV Y+HI E E FSLG+F+L+ G+ IPLHDHP M G++KV+YG +R     ++    G++         P L   +   +              S   +L+P   N H++  V    AAF+DILAPPYD   G R+CH+Y+ +   R                P +   S  D  +        V+ +ET Q  D+WC+   Y GPKVL
Sbjct:   72 PVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGTVRISCMDKLDTGAGHRRPPPEQQFEPPLQPLEREAVRPGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGP-AAFLDILAPPYDPEDG-RDCHYYRVVEPIR----------------PKEASGSACDLPR-------EVWLLETPQADDFWCEGEPYPGPKVL 255          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Mouse
Match: Ado (2-aminoethanethiol (cysteamine) dioxygenase [Source:MGI Symbol;Acc:MGI:2685083])

HSP 1 Score: 105.916 bits (263), Expect = 6.011e-26
Identity = 70/209 (33.49%), Postives = 100/209 (47.85%), Query Frame = 1
Query:  349 PVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRV---FGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            PV Y+HI E E FSLG+F+L+ G+ IPLHDHP M G++KV+YG +R     ++    G++         P L   +   +              S   +L+P   N H++  V    AAF+DILAPPYD   G R+CH+Y+ +   R                P +   S  D  +        V+ +ET Q  D+WC+   Y GPKVL
Sbjct:   72 PVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGTVRISCMDKLDTGAGHRRPPPEQQFEPPLQPLEREAVRPGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGP-AAFLDILAPPYDPEDG-RDCHYYRVVEPIR----------------PKEASGSACDLPR-------EVWLLETPQADDFWCEGEPYPGPKVL 255          
BLAST of 2-aminoethanethiol dioxygenase vs. UniProt/SwissProt
Match: sp|Q6PDY2|AEDO_MOUSE (2-aminoethanethiol dioxygenase OS=Mus musculus OX=10090 GN=Ado PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 4.204e-25
Identity = 70/209 (33.49%), Postives = 100/209 (47.85%), Query Frame = 1
Query:  349 PVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRV---FGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            PV Y+HI E E FSLG+F+L+ G+ IPLHDHP M G++KV+YG +R     ++    G++         P L   +   +              S   +L+P   N H++  V    AAF+DILAPPYD   G R+CH+Y+ +   R                P +   S  D  +        V+ +ET Q  D+WC+   Y GPKVL
Sbjct:   72 PVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGTVRISCMDKLDTGAGHRRPPPEQQFEPPLQPLEREAVRPGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGP-AAFLDILAPPYDPEDG-RDCHYYRVVEPIR----------------PKEASGSACDLPR-------EVWLLETPQADDFWCEGEPYPGPKVL 255          
BLAST of 2-aminoethanethiol dioxygenase vs. UniProt/SwissProt
Match: sp|Q96SZ5|AEDO_HUMAN (2-aminoethanethiol dioxygenase OS=Homo sapiens OX=9606 GN=ADO PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 7.159e-25
Identity = 76/215 (35.35%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  352 VLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRV---FGNKPMS-----SFT-PLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEG-AAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            V Y+HI E + FSLG+F+L+ G+ IPLHDHP M G++KV+YG +R     ++    G +P +      F  PL PR  E     ++ +   +    EA    I L+P   N H++  V  EG AAF+DILAPPYD   G R+CH+Y+ +   R                P +  +S  D  +        V+ +ET Q  D+WC+   Y GPKV 
Sbjct:   85 VTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRS---RAEYTEASGPCI-LTPHRDNLHQIDAV--EGPAAFLDILAPPYDPDDG-RDCHYYRVLEPVR----------------PKEASSSACDLPR-------EVWLLETPQADDFWCEGEPYPGPKVF 269          
BLAST of 2-aminoethanethiol dioxygenase vs. UniProt/SwissProt
Match: sp|Q556I2|AEDO_DICDI (Probable 2-aminoethanethiol dioxygenase OS=Dictyostelium discoideum OX=44689 GN=ado-1 PE=4 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.581e-13
Identity = 47/142 (33.10%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  352 VLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLS-PSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISI 774
            V Y  ++ENE F+L IF   P + IP HDHP M  L KV+YG+I C SF  +     +             Q   +   T     ++ +  E + ++ P+E N H  F  G+E  A +D+L PPYD     R C +Y+  S+
Sbjct:   58 VFYYPLVENEKFTLAIFAFPPNTCIPTHDHPQMTVLSKVLYGSISCDSFDWIDNTSNVKK-----------QGKAIYTGT----NILNSNDEKVKITLPNENNIHR-FQSGDEHCAVLDLLYPPYDSNF-YRSCTYYRPTSV 182          
BLAST of 2-aminoethanethiol dioxygenase vs. UniProt/SwissProt
Match: sp|Q9SJI9|PCO4_ARATH (Plant cysteine oxidase 4 OS=Arabidopsis thaliana OX=3702 GN=PCO4 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.821e-13
Identity = 53/151 (35.10%), Postives = 79/151 (52.32%), Query Frame = 1
Query:  328 DGSNASAPVL-YVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPH---QDTVIEAKSEAILLSP-SEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQE 765
            +GSN S P + Y+H+ E + FS+GIF + P S IPLH+HP M  L K++YG++  +S+              L P+L E +  D     P    +DT + A+S    L P S GN H    + +   A +DILAPPY      R C ++++
Sbjct:   62 NGSNQSPPAIKYLHLHECDSFSIGIFCMPPSSMIPLHNHPGMTVLSKLVYGSMHVKSYDW------------LEPQLTEPE--DPSQARPAKLVKDTEMTAQSPVTTLYPKSGGNIHCFKAITH--CAILDILAPPYS-SEHDRHCTYFRK 195          
BLAST of 2-aminoethanethiol dioxygenase vs. UniProt/SwissProt
Match: sp|Q9LXG9|PCO1_ARATH (Plant cysteine oxidase 1 OS=Arabidopsis thaliana OX=3702 GN=PCO1 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.570e-12
Identity = 60/214 (28.04%), Postives = 93/214 (43.46%), Query Frame = 1
Query:  334 SNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSE-GNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQ-YVFFIETHQ-PKDYW-CDTAEYRGPKV 963
            + +S P+ Y+H+ + + FS+GIF L P   IPLH+HP M    K+++G +  +S+  V  + PM      L +L               D+   A   A +L P + GN H    +     A +D+L PPY    G R C ++ E                     P+D  +S  D    +E  ++ Y +  E    P+D+     A YRGPKV
Sbjct:  115 ARSSPPITYLHLHQCDQFSIGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVV-DAPMRDSKTRLAKL-------------KVDSTFTAPCNASILYPEDGGNMHRFTAI--TACAVLDVLGPPYCNPEG-RHCTYFLEF--------------------PLDKLSSEDDDVLSSEEEKEGYAWLQERDDNPEDHTNVVGALYRGPKV 291          
BLAST of 2-aminoethanethiol dioxygenase vs. TrEMBL
Match: A0A5J4NV04 (Cysteamine dioxygenase OS=Paragonimus westermani OX=34504 GN=DEA37_0004094 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.677e-71
Identity = 136/331 (41.09%), Postives = 189/331 (57.10%), Query Frame = 1
Query:  121 MTTKISRVANLALQVFSQHSNRAXXXXXXXXXXXX------------LPKDXXXXXXXXXX----------------------XIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFG-------NKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNE-----RSQQY---VFFIETHQPKDYWCDTAEYRGPKVL 966
            MTTKI+ VANLAL VF QHS RA+  +   ++ SS             P D+ +                              +  RD+GFD+ W+     +D S  +APV YVHIMENE+FS+GIFVLRPGSRIPLHDHP M+G+++V+YG++RCRSF+R+           P S+++ L      WQ++DLI   PHQD V+   S   LL+P EGN HE+  V    A F+DILAPPYD+ LG REC FY+E+ +P  +  +N  Q++ +  + VD+   N   + G +      S  Y   ++ +ET+QPKDYWC++AEY GP V+
Sbjct:    1 MTTKIASVANLALHVFQQHSARATMTAAVSMNSSSRSDGVCAGIPNCTPTDRSSSSNATSTVPTCNTTGVSDQLLQRLLTTVRSLTTRDIGFDLRWV-----SDASVYAAPVAYVHIMENEVFSMGIFVLRPGSRIPLHDHPGMYGVLRVVYGSLRCRSFSRLQNISARSNLGYPKSTYSKL--SGCRWQLSDLIVARPHQDAVLTPDSPTQLLAPDEGNLHEITPVDGP-AVFLDILAPPYDHDLGTRECRFYKEVELPHPVPGRNA-QSQTRIGAIVDSPALNDSRSVGTDVPVFHDSDTYPPLIYLVETNQPKDYWCESAEYVGPSVI 322          
BLAST of 2-aminoethanethiol dioxygenase vs. TrEMBL
Match: A0A430Q7M7 (Cysteamine dioxygenase OS=Schistosoma bovis OX=6184 GN=DC041_0005418 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.257e-67
Identity = 134/321 (41.74%), Postives = 182/321 (56.70%), Query Frame = 1
Query:  121 MTTKISRVANLALQVFSQHSNRAXX-----------------------XXXXXXXXXXLP------KDXXXXXXXXXXXIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRL-----HEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQ-----YVFFIETHQPKDYWCDTAEYRGPKVL 966
            MTTKI+ VANLA   F QHS RA+                                 +LP       + L +LL  +  +  +DVGFD+ WI     +D + +SAPV YVHIMENE+FS+GIF+L+PGSRIPLHDHP M+G++KV+ G++RCRSFTR+   K  +      P L      +WQ+ DLI   PHQDTV+    +  LL P EGN HE+  V    A F+DILAPPYD+ LG REC FY+E+ IP+  S     QN    ++  +   S+ D +  ++ + Q      V+ +ET+QP DYWC++AEY GP V+
Sbjct:    1 MTTKIATVANLAFHAFQQHSVRATLGPASANINNGMGDSHPCTNGNSPTHSDKPVSPTLPVKHKHLSESLCRLLACVRSLTPKDVGFDVRWI-----SDSNISSAPVAYVHIMENEVFSMGIFILKPGSRIPLHDHPGMYGILKVLTGSVRCRSFTRLKNVKSTTDLGNYKPSLSVFDDSKWQLTDLIIARPHQDTVLSPDHQPCLLFPIEGNLHEITPVDGP-AVFLDILAPPYDHDLGTRECRFYKEVIIPQMNSNSLLSQNNLHNNNNNEELLSSADSSDPDQCTNQSEKDSIVYLVETNQPSDYWCESAEYNGPSVV 315          
BLAST of 2-aminoethanethiol dioxygenase vs. TrEMBL
Match: A0A183JGM9 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS1851 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.257e-67
Identity = 134/321 (41.74%), Postives = 182/321 (56.70%), Query Frame = 1
Query:  121 MTTKISRVANLALQVFSQHSNRAXX-----------------------XXXXXXXXXXLP------KDXXXXXXXXXXXIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRL-----HEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQ-----YVFFIETHQPKDYWCDTAEYRGPKVL 966
            MTTKI+ VANLA   F QHS RA+                                 +LP       + L +LL  +  +  +DVGFD+ WI     +D + +SAPV YVHIMENE+FS+GIF+L+PGSRIPLHDHP M+G++KV+ G++RCRSFTR+   K  +      P L      +WQ+ DLI   PHQDTV+    +  LL P EGN HE+  V    A F+DILAPPYD+ LG REC FY+E+ IP+  S     QN    ++  +   S+ D +  ++ + Q      V+ +ET+QP DYWC++AEY GP V+
Sbjct:    1 MTTKIATVANLAFHAFQQHSVRATLGPASANINNGMGDSHPCTNGNSPTHSDKPVSPTLPVKHKHLSESLCRLLACVRSLTPKDVGFDVRWI-----SDSNISSAPVAYVHIMENEVFSMGIFILKPGSRIPLHDHPGMYGILKVLTGSVRCRSFTRLKNVKSTTDLGNYKPSLSVFDDSKWQLTDLIIARPHQDTVLSPDHQPCLLFPIEGNLHEITPVDGP-AVFLDILAPPYDHDLGTRECRFYKEVIIPQMNSNSLLSQNNLHNNNNNEELLSSADSSDPDQCTNQSEKDSIVYLVETNQPSDYWCESAEYNGPSVV 315          
BLAST of 2-aminoethanethiol dioxygenase vs. TrEMBL
Match: A0A183MTV7 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS19482 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 4.988e-67
Identity = 133/318 (41.82%), Postives = 176/318 (55.35%), Query Frame = 1
Query:  121 MTTKISRVANLALQVFSQHSNRAXX-----------------------XXXXXXXXXXLP------KDXXXXXXXXXXXIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRL-----HEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPR--GISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            MTTKI+ VANLA   F QHS RA+                                 +LP       + L +LL  +  +  +DVGFD+ WI     +D + +SAPV YVHIMENE+FS+GIF+L+PGSRIPLHDHP M+G++KV+ G++RCRSFTR+   K  +      P L      +WQ+ DLI   PHQDTV+    +  LL P EGN HE+  V    A F+DILAPPYD+ LG REC FY+E+ IP+    S  +   N N         +S+ D           V+ +ET+QP DYWC++AEY GP V+
Sbjct:    1 MTTKIATVANLAFHAFQQHSVRATLGPASANINNGMGDSHPCTNGNSPTHSDKPVSPTLPVKHKHLSESLCRLLACVRSLTPKDVGFDVRWI-----SDSNISSAPVAYVHIMENEVFSMGIFILKPGSRIPLHDHPGMYGILKVLTGSVRCRSFTRLKNVKSTTDLGNYKPSLSVFDDSKWQLTDLIIARPHQDTVLCPDHQPCLLFPVEGNLHEITPVDGP-AVFLDILAPPYDHDLGTRECRFYKEVIIPQMNSNSLLSQNNNNNNEELSFSADSSDPDQCTNQSEKDSIVYLVETNQPSDYWCESAEYNGPSVV 312          
BLAST of 2-aminoethanethiol dioxygenase vs. TrEMBL
Match: H2KTT2 (2-aminoethanethiol dioxygenase OS=Clonorchis sinensis OX=79923 GN=Ado PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 3.231e-66
Identity = 137/333 (41.14%), Postives = 189/333 (56.76%), Query Frame = 1
Query:  121 MTTKISRVANLALQVFSQHSNRAXXXXXX-----------------------------XXXXXXLPKDXXXXXXXXXXXIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRV---------FGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNR----NQASSPV-DNHNSNFDGAKG-------NERSQQ-YVFFIETHQPKDYWCDTAEYRGPKVL 966
            MT+KI+ VANLA+ VF QHS R+   S                                 +  SL  D L +LL  ++ +  +DVGFD  WI+S      +  +APV YVHIMENEIFS+GIF+LRPGSRIPLHDHP MFG+++VIYG++RCRSFT +         F     S F+        WQ++D+I   P+QD V+  +S+A LLSP +GN HE+  V    A F+DIL+PPYD+ LG REC FY+E+ +P  IS    + +     +   + V D   S+ D + G       N+ +Q   ++ +ET+QPKDYWC++AEY GP V+
Sbjct:    1 MTSKIATVANLAVHVFQQHSIRSGLSSATQFNINSVDLPAGGPPNGRFETAQNLSTPPTSTTYSLVPDLLQRLLSSVHSLTPKDVGFDTRWISS-----ANVYAAPVAYVHIMENEIFSMGIFILRPGSRIPLHDHPGMFGILRVIYGSLRCRSFTPLRNIKSSDSSFHKVAFSKFSD-----SRWQLSDIILARPYQDVVMTTESQAHLLSPIDGNLHEISAVDGP-AVFLDILSPPYDHDLGTRECRFYKEVVLPCPISGATKHLDDFPIPSAGDATVGDTGTSDSDISSGPSGQVYTNQNAQSPIIYLVETNQPKDYWCESAEYSGPSVV 322          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Cavefish
Match: adob (2-aminoethanethiol (cysteamine) dioxygenase b [Source:ZFIN;Acc:ZDB-GENE-040426-2267])

HSP 1 Score: 102.064 bits (253), Expect = 2.014e-24
Identity = 59/143 (41.26%), Postives = 86/143 (60.14%), Query Frame = 1
Query:  349 PVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSS----FT-PLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQ 762
            PV Y+HI E + FS+G+F+L+ G+ IPLHDHP M+G++KV+YG +R   F R+  +   +S    F+ PLLP    +Q + L A+          +S   +LSP   N H++  V     AF+DILAPPYD   G R+CH+Y+
Sbjct:   72 PVTYMHICETDDFSMGVFLLKHGTSIPLHDHPGMYGMLKVLYGKVRISCFDRLDTSPESASGGQQFSPPLLP----FQKSSLKASLLRSVGEYTEESPPCVLSPHRDNIHQIEAVDGP-TAFLDILAPPYDPDDG-RDCHYYK 208          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008036.1 (pep scaffold:Pmarinus_7.0:GL491796:503:934:1 gene:ENSPMAG00000007273.1 transcript:ENSPMAT00000008036.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 4.622e-11
Identity = 41/140 (29.29%), Postives = 64/140 (45.71%), Query Frame = 1
Query:  547 PRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            P L  WQ   + A+       +   +   LL+P  GN H +  VG   AAF+DILAPPY    G R+CH+Y+ + +P                       +N D   G++   +  + +E  QP ++WC + +Y GP V+
Sbjct:    5 PPLRAWQRPLVRASRYRGQQRLSPLAPCRLLTPHHGNLHRVDAVGGP-AAFLDILAPPYSPDTG-RDCHYYRPL-VP----------------------ATNDDDHGGDDGVGEPCWLLEIPQPAEFWCGSQDYPGPPVI 119          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Nematostella
Match: EDO36136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK9])

HSP 1 Score: 83.1889 bits (204), Expect = 2.062e-18
Identity = 60/212 (28.30%), Postives = 98/212 (46.23%), Query Frame = 1
Query:  346 APVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTP-----HQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            APV ++ I E   FS+GIF+++ G  IPLHDHP M+GL KV+YG+++  S+  +  +  +S+  PL           ++   P      ++   +A     +L+P  GNFH +  +     AF+DILAPPY                 P      N  ++  +   P+      +  ++G + +    +F E   PK Y     EY GP+V+
Sbjct:   60 APVSHIAIYECPFFSMGIFIVKKGCHIPLHDHPGMYGLCKVLYGSVKVESY-HITDDSQLSNQFPL-------GYGGIVKRIPLHFVREKERRFDASGGTCVLTPQGGNFHAVHAMPGP-TAFLDILAPPYS----------------PERAQDNNSTEDNERWLIPIPPPREFYCDSQGRDCT----YFKECDPPKSYQ----EYTGPEVI 238          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Medaka
Match: adoa (2-aminoethanethiol dioxygenase [Source:NCBI gene;Acc:101157575])

HSP 1 Score: 124.02 bits (310), Expect = 1.010e-32
Identity = 72/209 (34.45%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  343 SAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLL-PRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            S PV Y+HI E E FS+G+F+LRPG+ IPLHDHP M G++KV+YG +  R F ++ G    S  +P   P L   Q   +  +          +S   LL+P   N H++  V     AF+DILAPPY+   G R+CH+Y+ +        Q   ++   A               G +   + V+ +E  QP+D+WC    Y GP V+
Sbjct:   69 SPPVTYMHICETEAFSMGVFLLRPGASIPLHDHPGMNGMLKVLYGKLNVRCFDKLEGGSTKSGASPPFDPPLEPRQRASVWRSALRSVAQYSEESGPCLLTPLRDNLHQIDAVDGP-VAFLDILAPPYNPDDG-RDCHYYKLL--------QTAAEDGTVAKG-------------GQKEKDEEVWLLEIPQPEDFWCGGEPYPGPAVV 254          
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Medaka
Match: adob (2-aminoethanethiol (cysteamine) dioxygenase b [Source:ZFIN;Acc:ZDB-GENE-040426-2267])

HSP 1 Score: 107.457 bits (267), Expect = 1.218e-26
Identity = 69/208 (33.17%), Postives = 102/208 (49.04%), Query Frame = 1
Query:  340 ASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKV 963
             +APV Y+HI E + FS+G+F+L+ G+ IPLHDHP M G++KV+YG +R   F R+   +P        P L   Q+  L  +          +S   +LSP   N H++  V     AF+DILAPPYD   G R+CH+++ +S                 + P            G E+  + V+ +E  QP  +WC    Y GP+V
Sbjct:   77 GAAPVTYMHICETDQFSMGVFLLKSGASIPLHDHPGMHGMLKVLYGKVRISCFDRL--ERPAGGPQ-AAPALPPAQMGALRRSVLRSTAEYTEESGPCVLSPDRDNLHQIDAVDGP-TAFMDILAPPYDQDEG-RDCHYFKVLS----------------ETEPT-----------GPEQKDKEVWLMEISQPSHFWCGGEPYPGPEV 252          
BLAST of 2-aminoethanethiol dioxygenase vs. Planmine SMEST
Match: SMESG000017924.1 (SMESG000017924.1)

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 279/282 (98.94%), Postives = 280/282 (99.29%), Query Frame = 1
Query:  121 MTTKISRVANLALQVFSQHSNRAXXXXXXXXXXXXLPKDXXXXXXXXXXXIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            MTTKISRVANLALQVFSQHSNRASSVSGG ISQSSLPKDKLNQLLLQLNKIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKG+ERSQQYVF IETHQPKDYWCDTAEYRGPKVL
Sbjct:    1 MTTKISRVANLALQVFSQHSNRASSVSGGAISQSSLPKDKLNQLLLQLNKIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGDERSQQYVFLIETHQPKDYWCDTAEYRGPKVL 282          
BLAST of 2-aminoethanethiol dioxygenase vs. Planmine SMEST
Match: SMESG000043231.1 (SMESG000043231.1)

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 279/282 (98.94%), Postives = 281/282 (99.65%), Query Frame = 1
Query:  121 MTTKISRVANLALQVFSQHSNRAXXXXXXXXXXXXLPKDXXXXXXXXXXXIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKGNERSQQYVFFIETHQPKDYWCDTAEYRGPKVL 966
            MTTKISRVANLALQVFSQHSNRASSVSGGVISQSSLPKDKLNQLLLQLNKIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPV+NHNSNFDGAKG+ERSQQYVF IETHQPKDYWCDTAEYRGPKVL
Sbjct:    1 MTTKISRVANLALQVFSQHSNRASSVSGGVISQSSLPKDKLNQLLLQLNKIDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGSRIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQINDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPPYDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVENHNSNFDGAKGDERSQQYVFLIETHQPKDYWCDTAEYRGPKVL 282          
The following BLAST results are available for this feature:
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ADO1.491e-2535.352-aminoethanethiol dioxygenase [Source:HGNC Symbol... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG75502.121e-2334.48gene:FBgn0035839 transcript:FBtr0076736[more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
adob2.219e-3134.302-aminoethanethiol (cysteamine) dioxygenase b [Sou... [more]
adob2.300e-3134.302-aminoethanethiol (cysteamine) dioxygenase b [Sou... [more]
adoa3.133e-2932.202-aminoethanethiol (cysteamine) dioxygenase a [Sou... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cog46.107e-3233.19component of oligomeric golgi complex 4 [Source:Xe... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ado6.011e-2633.492-aminoethanethiol (cysteamine) dioxygenase [Sourc... [more]
Ado6.011e-2633.492-aminoethanethiol (cysteamine) dioxygenase [Sourc... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PDY2|AEDO_MOUSE4.204e-2533.492-aminoethanethiol dioxygenase OS=Mus musculus OX=... [more]
sp|Q96SZ5|AEDO_HUMAN7.159e-2535.352-aminoethanethiol dioxygenase OS=Homo sapiens OX=... [more]
sp|Q556I2|AEDO_DICDI1.581e-1333.10Probable 2-aminoethanethiol dioxygenase OS=Dictyos... [more]
sp|Q9SJI9|PCO4_ARATH2.821e-1335.10Plant cysteine oxidase 4 OS=Arabidopsis thaliana O... [more]
sp|Q9LXG9|PCO1_ARATH1.570e-1228.04Plant cysteine oxidase 1 OS=Arabidopsis thaliana O... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NV041.677e-7141.09Cysteamine dioxygenase OS=Paragonimus westermani O... [more]
A0A430Q7M72.257e-6741.74Cysteamine dioxygenase OS=Schistosoma bovis OX=618... [more]
A0A183JGM92.257e-6741.74Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A183MTV74.988e-6741.82Uncharacterized protein OS=Schistosoma margrebowie... [more]
H2KTT23.231e-6641.142-aminoethanethiol dioxygenase OS=Clonorchis sinen... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
adob2.014e-2441.262-aminoethanethiol (cysteamine) dioxygenase b [Sou... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008036.14.622e-1129.29pep scaffold:Pmarinus_7.0:GL491796:503:934:1 gene:... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO361362.062e-1828.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
adoa1.010e-3234.452-aminoethanethiol dioxygenase [Source:NCBI gene;A... [more]
adob1.218e-2633.172-aminoethanethiol (cysteamine) dioxygenase b [Sou... [more]
back to top
BLAST of 2-aminoethanethiol dioxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017924.10.000e+098.94SMESG000017924.1[more]
SMESG000043231.10.000e+098.94SMESG000043231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003617 ID=SMED30003617|Name=2-aminoethanethiol dioxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1156bp
GGAATTTTAAATTTTAATATTTACGACTACTTCTATTTAAATTTATCCAA
ATTTTCAATAGTTGTGATTTAGATAGTATAATTTTTAATTTTATAATTTT
TTTACTGATTTTAAAAATTGATGACTACTAAAATATCAAGAGTCGCTAAT
TTAGCACTTCAAGTTTTCAGTCAGCATTCAAATAGAGCTTCATCTGTATC
AGGTGGAGTAATATCACAATCGAGTTTGCCAAAAGATAAATTAAATCAAC
TTTTATTACAATTAAATAAAATTGATGGACGTGATGTTGGTTTTGATATT
TCTTGGATTAATTCCACGGCTAAAACTGATGGATCAAATGCTAGTGCCCC
AGTTCTTTACGTTCACATAATGGAAAATGAAATTTTTAGTTTAGGTATAT
TCGTATTGAGACCTGGTTCACGAATTCCTTTGCACGATCACCCAAATATG
TTTGGATTAGTTAAGGTGATTTATGGCAATATACGATGCCGTAGTTTCAC
TCGTGTATTTGGCAATAAACCAATGTCTTCTTTTACTCCTTTGCTACCGC
GTTTGCACGAATGGCAAATTAACGATTTGATCGCAACGACACCTCATCAA
GACACAGTTATTGAAGCAAAAAGTGAAGCAATTTTATTGAGTCCCAGTGA
AGGAAATTTCCATGAATTATTTACTGTTGGTAATGAAGGTGCTGCATTTG
TTGATATACTTGCTCCGCCATATGACTATTGTTTGGGACAACGAGAGTGT
CACTTCTATCAAGAAATCAGTATTCCTCGAGGAATTTCTCCTCAGAATGG
TTATCAAAATCGCAATCAAGCTTCATCGCCAGTTGACAACCATAATTCAA
ATTTCGACGGAGCTAAAGGCAATGAAAGAAGCCAGCAATACGTGTTTTTT
ATTGAAACCCATCAGCCAAAAGATTATTGGTGCGATACTGCGGAATATCG
TGGCCCGAAAGTGTTGTAATGGTAGACAGATTAATCAATATGGATTTTAT
ACAGATTTTTAAGAGTAATCCGCTCAAAAATAGTCAAATTTAAACGCAAT
TTATGTAAATAAATGAATTGTTGGATATTTTGTCGATTATATATATATAT
GCTTATCGGGTTGTATAGGAAGATTTTTTACATTTGTATATTATACTCAT
TTAATA
back to top

protein sequence of SMED30003617-orf-1

>SMED30003617-orf-1 ID=SMED30003617-orf-1|Name=SMED30003617-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=283bp
MTTKISRVANLALQVFSQHSNRASSVSGGVISQSSLPKDKLNQLLLQLNK
IDGRDVGFDISWINSTAKTDGSNASAPVLYVHIMENEIFSLGIFVLRPGS
RIPLHDHPNMFGLVKVIYGNIRCRSFTRVFGNKPMSSFTPLLPRLHEWQI
NDLIATTPHQDTVIEAKSEAILLSPSEGNFHELFTVGNEGAAFVDILAPP
YDYCLGQRECHFYQEISIPRGISPQNGYQNRNQASSPVDNHNSNFDGAKG
NERSQQYVFFIETHQPKDYWCDTAEYRGPKVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR012864PCO/ADO
IPR014710RmlC-like_jellyroll
IPR011051RmlC_Cupin_sf
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016702oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0051213dioxygenase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012864Cysteine oxygenase/2-aminoethanethiol dioxygenasePFAMPF07847PCO_ADOcoord: 48..281
e-value: 1.0E-43
score: 149.2
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 62..196
e-value: 2.0E-6
score: 29.6
NoneNo IPR availablePANTHERPTHR22966UNCHARACTERIZEDcoord: 3..281
NoneNo IPR availablePANTHERPTHR22966:SF292-AMINOETHANETHIOL DIOXYGENASEcoord: 3..281
IPR011051RmlC-like cupin domain superfamilySUPERFAMILYSSF51182RmlC-like cupinscoord: 73..215