Chloride intracellular channel protein 4

Overview
NameChloride intracellular channel protein 4
Smed IDSMED30003609
Length (bp)1213
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chloride intracellular channel protein 4 (SMED30003609) t-SNE clustered cells

Violin plots show distribution of expression levels for Chloride intracellular channel protein 4 (SMED30003609) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chloride intracellular channel protein 4 (SMED30003609) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chloride intracellular channel protein 4 (SMED30003609) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003609

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30003609h1SMcG0004400 Contig50555uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003609h1SMcG0004400 Contig50555newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003609h1SMcG0004400 Contig22291uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003609h1SMcG0004400 Contig22291newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003609h1SMcG0004400 dd_Smed_v4_2382_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Human
Match: CLIC4 (chloride intracellular channel 4 [Source:HGNC Symbol;Acc:HGNC:13518])

HSP 1 Score: 96.6709 bits (239), Expect = 2.668e-22
Identity = 66/253 (26.09%), Postives = 115/253 (45.45%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGAT-----AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +E    P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P             E   D+     ++IE  +++  CP   L  +     +     D+F  F++Y++ +           +L  L  L+++                I+  + K+L G++++  DC ++PKL  +++   +++NF IP E  G+W+YL   Y    F  +CP D+++ I YS+
Sbjct:   11 KEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFSVTTVDLKRKPADLQNLAPGTHPPFIT-------FNSEVKTDV-----NKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSD 246          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Human
Match: CLIC4 (chloride intracellular channel 4 [Source:HGNC Symbol;Acc:HGNC:13518])

HSP 1 Score: 96.6709 bits (239), Expect = 2.668e-22
Identity = 66/253 (26.09%), Postives = 115/253 (45.45%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGAT-----AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +E    P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P             E   D+     ++IE  +++  CP   L  +     +     D+F  F++Y++ +           +L  L  L+++                I+  + K+L G++++  DC ++PKL  +++   +++NF IP E  G+W+YL   Y    F  +CP D+++ I YS+
Sbjct:   11 KEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFSVTTVDLKRKPADLQNLAPGTHPPFIT-------FNSEVKTDV-----NKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSD 246          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Human
Match: CLIC5 (chloride intracellular channel 5 [Source:HGNC Symbol;Acc:HGNC:13517])

HSP 1 Score: 93.9745 bits (232), Expect = 2.463e-21
Identity = 67/243 (27.57%), Postives = 110/243 (45.27%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTE-DLFRNFNSYL----QTNNST---NMLANLASLNDFI----------------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            P IELFVK+  +D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P  L   G       D+   +   ++ +E  +   K P L            D+F  F++Y+    Q NN+     +   L  L+D++                +    K+L GD+++  DC ++PKL  ++I   +++N+ IP E  GLW+YL+  Y    F  +C  D +I + Y++
Sbjct:   14 PEIELFVKAG-IDGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLHNLAPGTHPPF-LTFNG-------DVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYAD 243          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Human
Match: CLIC1 (chloride intracellular channel 1 [Source:HGNC Symbol;Acc:HGNC:2062])

HSP 1 Score: 92.8189 bits (229), Expect = 4.051e-21
Identity = 67/255 (26.27%), Postives = 113/255 (44.31%), Query Frame = 3
Query:  246 MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG-----LELGATAFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            M+EE    P +ELFVK+   D A  G CP SQ+ FM  +     + +   VT VD K   +   KL  G  LP  L     H  T            ++IE  ++   CP        L   +     D+F  F++Y++ +N          +L  L  L++++ +                   K+L G++++  DC ++PKL  +++ C +++ F IP  F+G+ +YL   Y  + F  +CP D +I + Y +
Sbjct:    1 MAEEQ---PQVELFVKAGS-DGAKIGNCPFSQRLFMVLWL----KGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDT------------NKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQ 235          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Human
Match: CLIC1 (chloride intracellular channel 1 [Source:HGNC Symbol;Acc:HGNC:2062])

HSP 1 Score: 92.8189 bits (229), Expect = 4.051e-21
Identity = 67/255 (26.27%), Postives = 113/255 (44.31%), Query Frame = 3
Query:  246 MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG-----LELGATAFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            M+EE    P +ELFVK+   D A  G CP SQ+ FM  +     + +   VT VD K   +   KL  G  LP  L     H  T            ++IE  ++   CP        L   +     D+F  F++Y++ +N          +L  L  L++++ +                   K+L G++++  DC ++PKL  +++ C +++ F IP  F+G+ +YL   Y  + F  +CP D +I + Y +
Sbjct:    1 MAEEQ---PQVELFVKAGS-DGAKIGNCPFSQRLFMVLWL----KGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDT------------NKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQ 235          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Celegans
Match: exc-4 (Chloride intracellular channel exc-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQA4])

HSP 1 Score: 119.783 bits (299), Expect = 7.421e-31
Identity = 77/266 (28.95%), Postives = 128/266 (48.12%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTN----------------------NSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVPEAV 1001
            P++EL+VK+S +D    G     Q+++M  Y L E  +  + V  V++ +  + + K  +G   P+  +IE +  +T  D  ++    +  I +L  +F  P  E   +A K  E+L+RNF  +L+                        +   +   L++++  +  R ++YL G+ ++  DC +MP+L H+RI       F IP  F  LW Y+ T Y T AF+ SCP D+DII HY E+ N        L+    T T+PE V
Sbjct:   17 PLLELYVKASGIDARRIGADLFCQEFWMELYALYEIGVARVEVKTVNVNS--EAFKKNFLGAQPPI--MIEEEKELTYTDNREI----EGRIFHLAKEFNVPLFEKDPSAEKRIENLYRNFKLFLRAKVEFDKGKKEPSRVEDLPAQIKVHYNRVCEQLSNIDQLLSERKSRYLLGNSMTEYDCELMPRLHHIRIIGLSLLGFDIPHNFTHLWAYILTAYRTAAFIESCPADQDIIHHYKEQMNLFTNQRETLQSPTKTHTIPEKV 274          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Celegans
Match: exl-1 (Chloride intracellular channel exl-1 [Source:UniProtKB/Swiss-Prot;Acc:O45405])

HSP 1 Score: 86.2705 bits (212), Expect = 3.417e-19
Identity = 62/232 (26.72%), Postives = 107/232 (46.12%), Query Frame = 3
Query:  267 LPIIELFVKSSPVDPADKGPC--PISQKWFM-AYYTLVENQLINLRVTPVDIKNPPQEYLKLNVG-RHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQ--TNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE-KTNPR 941
            +P   L++   P    +  PC  P +   FM   Y    +  +   V   ++    QE+   N G R +P     E     T E         +D+I + ++  K P       A   T DLFR F  +++   +  T     L  L+ ++  +  K+L  D V+ +DC+V+ +L  +R+A    KN++IP +   +  YL+  Y T+ F +SCP D++I++H++E K  PR
Sbjct:    1 MPTFSLWL---PAGSNNVHPCGDPYAHHLFMRCLYHAKHDPTMKFDVKTTNVNKTSQEFK--NTGLRRMPGISAEESGETQTFE--------TEDDILDFLEYLK-PERGDDEEAENATCDLFRQFARFVKDVEHRDTAFNTELLRLDKYLSEQETKFLISDDVTHIDCLVLTRLHSIRVAAKMLKNYEIPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLHWTELKDTPR 218          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Celegans
Match: exl-1 (Chloride intracellular channel exl-1 [Source:UniProtKB/Swiss-Prot;Acc:O45405])

HSP 1 Score: 86.2705 bits (212), Expect = 3.417e-19
Identity = 62/232 (26.72%), Postives = 107/232 (46.12%), Query Frame = 3
Query:  267 LPIIELFVKSSPVDPADKGPC--PISQKWFM-AYYTLVENQLINLRVTPVDIKNPPQEYLKLNVG-RHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQ--TNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE-KTNPR 941
            +P   L++   P    +  PC  P +   FM   Y    +  +   V   ++    QE+   N G R +P     E     T E         +D+I + ++  K P       A   T DLFR F  +++   +  T     L  L+ ++  +  K+L  D V+ +DC+V+ +L  +R+A    KN++IP +   +  YL+  Y T+ F +SCP D++I++H++E K  PR
Sbjct:    1 MPTFSLWL---PAGSNNVHPCGDPYAHHLFMRCLYHAKHDPTMKFDVKTTNVNKTSQEFK--NTGLRRMPGISAEESGETQTFE--------TEDDILDFLEYLK-PERGDDEEAENATCDLFRQFARFVKDVEHRDTAFNTELLRLDKYLSEQETKFLISDDVTHIDCLVLTRLHSIRVAAKMLKNYEIPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLHWTELKDTPR 218          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Fly
Match: Clic (gene:FBgn0030529 transcript:FBtr0346089)

HSP 1 Score: 133.265 bits (334), Expect = 5.237e-36
Identity = 80/246 (32.52%), Postives = 128/246 (52.03%), Query Frame = 3
Query:  264 NLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTNNSTN---MLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVP 992
            ++P IEL +K+S +D   KG C   Q++FM  Y L E + I+L+VT VD++ PP ++       H P+ L+  G   +  E +   I  N     NL  + K    E+      + E+L+      L   +      +L++L  +ND +  R+ ++L GD +   DC +MP+LQH+R+A   F +F+IPT    LW+Y+  MY+  AF  SCP D+DII HY  + + + K    L     T+ +P
Sbjct:   19 DVPEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPI-LIDNGLAILENEKIERHIMKNIPGGYNLFVQDK----EVAT----LIENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHYKLQQSLKMKKHEELETPTFTTYIP 255          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Fly
Match: Clic (gene:FBgn0030529 transcript:FBtr0073835)

HSP 1 Score: 133.265 bits (334), Expect = 5.237e-36
Identity = 80/246 (32.52%), Postives = 128/246 (52.03%), Query Frame = 3
Query:  264 NLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTNNSTN---MLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVP 992
            ++P IEL +K+S +D   KG C   Q++FM  Y L E + I+L+VT VD++ PP ++       H P+ L+  G   +  E +   I  N     NL  + K    E+      + E+L+      L   +      +L++L  +ND +  R+ ++L GD +   DC +MP+LQH+R+A   F +F+IPT    LW+Y+  MY+  AF  SCP D+DII HY  + + + K    L     T+ +P
Sbjct:   19 DVPEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPI-LIDNGLAILENEKIERHIMKNIPGGYNLFVQDK----EVAT----LIENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHYKLQQSLKMKKHEELETPTFTTYIP 255          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Zebrafish
Match: clic4 (chloride intracellular channel 4 [Source:ZFIN;Acc:ZDB-GENE-030326-3])

HSP 1 Score: 95.5153 bits (236), Expect = 3.684e-22
Identity = 64/252 (25.40%), Postives = 118/252 (46.83%), Query Frame = 3
Query:  255 ENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG--LELGAT---AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +  N P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P            GE   D+     ++IE  ++   CP    +LGA    +     D+F  F+++++ +           +L  L  L+++                ++  +  +L G++++  DC ++PKL  +++   +++ F+IP +  G+W+YL   Y+ + F  +CP D++I I Y++
Sbjct:   11 KGDNEPVIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLQNLAPGTHPPFIT-------FNGEVKTDV-----NKIEEYLEDILCPPKYSKLGARHPESNTAGMDIFAKFSAFIKNSKPDANEALERGLLKTLQKLDEYLCSPLPDEIDHNSMEEVKASTRMFLDGEEMTLADCNLLPKLHIVKVVAKKYRGFEIPKDLTGIWRYLNNAYKREEFTNTCPSDKEIEIAYAD 245          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Zebrafish
Match: pnpla7a (patatin-like phospholipase domain containing 7a [Source:ZFIN;Acc:ZDB-GENE-070112-1812])

HSP 1 Score: 94.7449 bits (234), Expect = 6.548e-22
Identity = 67/241 (27.80%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  276 IELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFK----VTEDLFRNFNSYLQTNN-------STNMLANLASLNDFI--------------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYS 923
            IELFVK+S  D    G CP  Q+ FM  +     + +N  +T VD+K  P+    L  G   P  L+  G          ++  D +   E L D    P        +K      +D+F  F++Y++  N           L +L  L+ ++                 +  YL G+ +S  DC ++PKL  +++ C +++ F+IP E KGL KYL+  Y+   F ++CP D++I++ YS
Sbjct:    7 IELFVKASD-DGESVGNCPFCQRLFMILWL----KGVNFTLTTVDMKRAPEVLKDLAPGSQPPF-LIYNG----------EVRTDTNKIEEFLEDTLAPPQYPKLCCRYKESNTAGDDIFHKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCKKYRGFEIPAELKGLSKYLDKAYKEDVFHLTCPKDKEILLAYS 231          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Zebrafish
Match: clic3 (chloride intracellular channel 3 [Source:ZFIN;Acc:ZDB-GENE-010507-2])

HSP 1 Score: 94.7449 bits (234), Expect = 6.548e-22
Identity = 67/241 (27.80%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  276 IELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFK----VTEDLFRNFNSYLQTNN-------STNMLANLASLNDFI--------------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYS 923
            IELFVK+S  D    G CP  Q+ FM  +     + +N  +T VD+K  P+    L  G   P  L+  G          ++  D +   E L D    P        +K      +D+F  F++Y++  N           L +L  L+ ++                 +  YL G+ +S  DC ++PKL  +++ C +++ F+IP E KGL KYL+  Y+   F ++CP D++I++ YS
Sbjct:    7 IELFVKASD-DGESVGNCPFCQRLFMILWL----KGVNFTLTTVDMKRAPEVLKDLAPGSQPPF-LIYNG----------EVRTDTNKIEEFLEDTLAPPQYPKLCCRYKESNTAGDDIFHKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCKKYRGFEIPAELKGLSKYLDKAYKEDVFHLTCPKDKEILLAYS 231          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Zebrafish
Match: clic2 (chloride intracellular channel 2 [Source:ZFIN;Acc:ZDB-GENE-040718-299])

HSP 1 Score: 93.9745 bits (232), Expect = 1.212e-21
Identity = 67/235 (28.51%), Postives = 114/235 (48.51%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLE-LGATAFKVTEDLFRNFNSYLQT--NNSTN---MLANLASLNDF------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHY 920
            P IELF+K+   D  + G CP  Q+ FM  +     + +   VT VD++  P E   L  G + P  L         G    D I   ++ +E  +   + P L      +F V  D+F  F+++++   NN+ +   +L     L+D+            I     K+L G++++  DC ++PKL  +++A  ++ NF IPT+F G+W+YL++ YE + F  +CP D +I   Y
Sbjct:   11 PRIELFIKAGH-DGENVGNCPFCQRLFMVLWL----KGVKFTVTTVDMRKKPDELKDLAPGTNPPFLL-------YNGTLKTDFIK-IEEFLETTLAPPRYPHLSPRYKESFDVGADIFAKFSAFIKNSPNNAFHEKALLREFKRLDDYLNTPLQDELDQNISVSKRKFLDGNRLTLADCNLLPKLHVIKVAARKYCNFDIPTQFTGVWRYLQSAYEREEFSQTCPADIEIEKAY 232          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Zebrafish
Match: clic2 (chloride intracellular channel 2 [Source:ZFIN;Acc:ZDB-GENE-040718-299])

HSP 1 Score: 93.9745 bits (232), Expect = 1.212e-21
Identity = 67/235 (28.51%), Postives = 114/235 (48.51%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLE-LGATAFKVTEDLFRNFNSYLQT--NNSTN---MLANLASLNDF------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHY 920
            P IELF+K+   D  + G CP  Q+ FM  +     + +   VT VD++  P E   L  G + P  L         G    D I   ++ +E  +   + P L      +F V  D+F  F+++++   NN+ +   +L     L+D+            I     K+L G++++  DC ++PKL  +++A  ++ NF IPT+F G+W+YL++ YE + F  +CP D +I   Y
Sbjct:   11 PRIELFIKAGH-DGENVGNCPFCQRLFMVLWL----KGVKFTVTTVDMRKKPDELKDLAPGTNPPFLL-------YNGTLKTDFIK-IEEFLETTLAPPRYPHLSPRYKESFDVGADIFAKFSAFIKNSPNNAFHEKALLREFKRLDDYLNTPLQDELDQNISVSKRKFLDGNRLTLADCNLLPKLHVIKVAARKYCNFDIPTQFTGVWRYLQSAYEREEFSQTCPADIEIEKAY 232          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Xenopus
Match: clic4 (chloride intracellular channel 5 [Source:NCBI gene;Acc:493290])

HSP 1 Score: 94.7449 bits (234), Expect = 1.244e-21
Identity = 68/255 (26.67%), Postives = 117/255 (45.88%), Query Frame = 3
Query:  246 MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG--LELGAT---AFKVTEDLFRNFNSYLQTNNSTN-------MLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            + E+  NL  +ELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P    I   H          +  + ++IE  +++  CP    +L A    +     D+F  F++Y++ +   N       +L  L  L+D+                I   + K+L G++++  DC ++PKL  +++   +++ F+IP    G+W+YL   Y    F  +CP DR+I I Y++
Sbjct:   10 VQEDKDNL--VELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLQNLAPGTHPPF---ITYNHE---------VKTDVNKIEEFLEEVLCPPKYRKLAAKHPESNTAGMDIFAKFSAYIKNSRPDNNEALERGLLKTLQKLDDYLNSPLPDEIDENSMDDITQSNRKFLDGEEMTLADCNLLPKLHIIKVVTKKYRGFEIPKSMTGIWRYLSNAYSKDEFTNTCPGDREIEIAYAD 245          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Xenopus
Match: clic1 (chloride intracellular channel 1 [Source:NCBI gene;Acc:394484])

HSP 1 Score: 91.2781 bits (225), Expect = 1.482e-20
Identity = 68/255 (26.67%), Postives = 116/255 (45.49%), Query Frame = 3
Query:  261 SNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTE------DLFRNFNSYLQTNNST----------------NMLANLASLNDFIENRS-------NKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNP 938
            S  P +ELFVK++  D    G CP SQ+ FM  +     + +   VT VD+K  P     L  G   P  L         GE   D      ++IE  +++  CP  +    A +  E      D+F  F++Y++ +N                  ++  N   +++  EN +        K+L G++++  DC ++PKL  +++ C  F+ F+IP EF G+ +YL+  Y+ + F  +CP   +I+  Y+E   P
Sbjct:    2 SEQPQVELFVKAAN-DGQSIGNCPFSQRLFMVLWL----KGVTFNVTTVDMKKKPDILKDLAPGAQPPFLL-------FAGEVRTDT-----NKIEEFLEETLCPP-KYPKLACRNQESNTAGLDVFARFSAYIKNSNPAPNQSVEKGLLKALKVLDIYLNTPQIDEIDENSAEDEPVSNRKFLDGNELTLADCNLLPKLNIVQVVCEHFRGFKIPAEFTGIHRYLQNAYKREEFASTCPDAAEIVRAYAEVAKP 238          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Xenopus
Match: clic4 (chloride intracellular channel 5 [Source:NCBI gene;Acc:493290])

HSP 1 Score: 87.0409 bits (214), Expect = 5.240e-19
Identity = 59/230 (25.65%), Postives = 104/230 (45.22%), Query Frame = 3
Query:  321 GPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG--LELGAT---AFKVTEDLFRNFNSYLQTNNSTN-------MLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P    I   H          +  + ++IE  +++  CP    +L A    +     D+F  F++Y++ +   N       +L  L  L+D+                I   + K+L G++++  DC ++PKL  +++   +++ F+IP    G+W+YL   Y    F  +CP DR+I I Y++
Sbjct:   25 GNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLQNLAPGTHPPF---ITYNHE---------VKTDVNKIEEFLEEVLCPPKYRKLAAKHPESNTAGMDIFAKFSAYIKNSRPDNNEALERGLLKTLQKLDDYLNSPLPDEIDENSMDDITQSNRKFLDGEEMTLADCNLLPKLHIIKVVTKKYRGFEIPKSMTGIWRYLSNAYSKDEFTNTCPGDREIEIAYAD 238          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Xenopus
Match: st3gal5 (ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Source:Xenbase;Acc:XB-GENE-955106])

HSP 1 Score: 85.5001 bits (210), Expect = 1.886e-18
Identity = 64/247 (25.91%), Postives = 111/247 (44.94%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGL--ELGATAFKVTE---DLFRNFNSYL----QTNNS---TNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            P IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P            GE   D+     ++IE  +++   P    +L A   +      D+F  F++Y+    Q +N+     +   L  L+ ++ +                   K+L GD+ +  DC ++PKL  ++I   +++N++IP E  G+W+YL+  Y    F  +C  D++  + Y++
Sbjct:   14 PDIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLHNLAPGTHPPFLT-------FNGEVKTDV-----NKIEEFLEESLAPPRYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQDNAGLEKGLTKALKKLDTYLNSPLPEEIDANSREEEKVSKRKFLDGDEFTLADCNLLPKLHVVKIVAKKYRNYEIPAEMSGIWRYLKNAYARDEFTNTCAADKETELAYAD 243          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Xenopus
Match: clic1 (chloride intracellular channel 1 [Source:NCBI gene;Acc:394484])

HSP 1 Score: 83.5741 bits (205), Expect = 6.699e-18
Identity = 60/235 (25.53%), Postives = 105/235 (44.68%), Query Frame = 3
Query:  321 GPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTE------DLFRNFNSYLQTNNST----------------NMLANLASLNDFIENRS-------NKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNP 938
            G CP SQ+ FM  +     + +   VT VD+K  P     L  G   P  L         GE   D      ++IE  +++  CP  +    A +  E      D+F  F++Y++ +N                  ++  N   +++  EN +        K+L G++++  DC ++PKL  +++ C  F+ F+IP EF G+ +YL+  Y+ + F  +CP   +I+  Y+E   P
Sbjct:   10 GNCPFSQRLFMVLWL----KGVTFNVTTVDMKKKPDILKDLAPGAQPPFLL-------FAGEVRTDT-----NKIEEFLEETLCPP-KYPKLACRNQESNTAGLDVFARFSAYIKNSNPAPNQSVEKGLLKALKVLDIYLNTPQIDEIDENSAEDEPVSNRKFLDGNELTLADCNLLPKLNIVQVVCEHFRGFKIPAEFTGIHRYLQNAYKREEFASTCPDAAEIVRAYAEVAKP 227          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Mouse
Match: Clic4 (chloride intracellular channel 4 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1352754])

HSP 1 Score: 95.1301 bits (235), Expect = 5.794e-22
Identity = 65/253 (25.69%), Postives = 114/253 (45.06%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGAT-----AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +E    P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P             E   D+     ++IE  +++  CP   L  +     +     D+F  F++Y++ +           +L  L  L+++                I+  + ++L GD+++  DC ++PKL  +++   +++NF IP    G+W+YL   Y    F  +CP D+++ I YS+
Sbjct:   11 KEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFSVTTVDLKRKPADLQNLAPGTHPPFIT-------FNSEVKTDV-----NKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSD 246          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Mouse
Match: Clic5 (chloride intracellular channel 5 [Source:MGI Symbol;Acc:MGI:1917912])

HSP 1 Score: 93.9745 bits (232), Expect = 1.658e-21
Identity = 67/243 (27.57%), Postives = 110/243 (45.27%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTE-DLFRNFNSYL----QTNNST---NMLANLASLNDFI----------------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            P IELFVK+  +D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P  L   G       D+   +   ++ +E  +   K P L            D+F  F++Y+    Q NN+     +   L  L+D++                +    K+L GD+++  DC ++PKL  ++I   +++N+ IP E  GLW+YL+  Y    F  +C  D +I + Y++
Sbjct:   14 PEIELFVKAG-IDGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLHNLAPGTHPPF-LTFNG-------DVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYAD 243          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Mouse
Match: Clic1 (chloride intracellular channel 1 [Source:MGI Symbol;Acc:MGI:2148924])

HSP 1 Score: 92.4337 bits (228), Expect = 4.012e-21
Identity = 67/255 (26.27%), Postives = 113/255 (44.31%), Query Frame = 3
Query:  246 MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG-----LELGATAFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            M+EE    P +ELFVK+   D A  G CP SQ+ FM  +     + +   VT VD K   +   KL  G  LP  L     H  T            ++IE  ++   CP        L   +     D+F  F++Y++ +N          +L  L  L++++ +                   K+L G++++  DC ++PKL  +++ C +++ F IP  F+G+ +YL   Y  + F  +CP D +I + Y +
Sbjct:    1 MAEEQ---PQVELFVKAGS-DGAKIGNCPFSQRLFMVLWL----KGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDT------------NKIEEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQ 235          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Mouse
Match: Clic5 (chloride intracellular channel 5 [Source:MGI Symbol;Acc:MGI:1917912])

HSP 1 Score: 90.8929 bits (224), Expect = 2.135e-19
Identity = 68/249 (27.31%), Postives = 112/249 (44.98%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTE-DLFRNFNSYL----QTNNST---NMLANLASLNDFI----------------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            E  S+ P I LFVK+  +D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P  L   G       D+   +   ++ +E  +   K P L            D+F  F++Y+    Q NN+     +   L  L+D++                +    K+L GD+++  DC ++PKL  ++I   +++N+ IP E  GLW+YL+  Y    F  +C  D +I + Y++
Sbjct:  242 EAASSNPEIFLFVKAG-IDGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLHNLAPGTHPPF-LTFNG-------DVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYAD 477          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Mouse
Match: Clic6 (chloride intracellular channel 6 [Source:MGI Symbol;Acc:MGI:2146607])

HSP 1 Score: 80.8777 bits (198), Expect = 6.088e-16
Identity = 65/247 (26.32%), Postives = 111/247 (44.94%), Query Frame = 3
Query:  276 IELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMT--GEDMADLIADNDDEIENLMDKFKCPGL--ELGAT---AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            I LFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G + P          MT  GE   D+     ++IE  +++   P    +LG     +     D+F  F+++++            N+L  L  L+ ++ +                   K+L GD+++  DC ++PKL  ++I   ++++F+ P+E  G+W+YL   Y    F  +CP DR+I   YS+
Sbjct:  363 ITLFVKAG-YDGESIGNCPFSQRLFMILWL----KGVIFNVTTVDLKRKPADLQNLAPGTNPPF---------MTFDGEVKTDV-----NKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLLRALKKLDSYLNSPLPDEIDADSSEDVTVSQRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADREIEHAYSD 590          
BLAST of Chloride intracellular channel protein 4 vs. UniProt/SwissProt
Match: sp|Q8WQA4|EXC4_CAEEL (Chloride intracellular channel exc-4 OS=Caenorhabditis elegans OX=6239 GN=exc-4 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 9.439e-30
Identity = 77/266 (28.95%), Postives = 128/266 (48.12%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTN----------------------NSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVPEAV 1001
            P++EL+VK+S +D    G     Q+++M  Y L E  +  + V  V++ +  + + K  +G   P+  +IE +  +T  D  ++    +  I +L  +F  P  E   +A K  E+L+RNF  +L+                        +   +   L++++  +  R ++YL G+ ++  DC +MP+L H+RI       F IP  F  LW Y+ T Y T AF+ SCP D+DII HY E+ N        L+    T T+PE V
Sbjct:   17 PLLELYVKASGIDARRIGADLFCQEFWMELYALYEIGVARVEVKTVNVNS--EAFKKNFLGAQPPI--MIEEEKELTYTDNREI----EGRIFHLAKEFNVPLFEKDPSAEKRIENLYRNFKLFLRAKVEFDKGKKEPSRVEDLPAQIKVHYNRVCEQLSNIDQLLSERKSRYLLGNSMTEYDCELMPRLHHIRIIGLSLLGFDIPHNFTHLWAYILTAYRTAAFIESCPADQDIIHHYKEQMNLFTNQRETLQSPTKTHTIPEKV 274          
BLAST of Chloride intracellular channel protein 4 vs. UniProt/SwissProt
Match: sp|Q5R957|CLIC4_PONAB (Chloride intracellular channel protein 4 OS=Pongo abelii OX=9601 GN=CLIC4 PE=2 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 7.053e-22
Identity = 66/253 (26.09%), Postives = 115/253 (45.45%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGAT-----AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +E    P+IELFVK+   D    G CP SQ+ FM  +     + +   V+ VD+K  P +   L  G H P             E   D+     ++IE  +++  CP   L  +     +     D+F  F++Y++ +           +L  L  L+++                I+  + K+L GD+++  DC ++PKL  +++   +++NF IP E  G+W+YL   Y    F  +CP D+++ I YS+
Sbjct:   11 KEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFSVSTVDLKRKPADLQNLAPGTHPPFIT-------FNSEVKTDV-----NKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSD 246          
BLAST of Chloride intracellular channel protein 4 vs. UniProt/SwissProt
Match: sp|Q9Y696|CLIC4_HUMAN (Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4)

HSP 1 Score: 96.6709 bits (239), Expect = 1.281e-21
Identity = 66/253 (26.09%), Postives = 115/253 (45.45%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGAT-----AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +E    P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P             E   D+     ++IE  +++  CP   L  +     +     D+F  F++Y++ +           +L  L  L+++                I+  + K+L G++++  DC ++PKL  +++   +++NF IP E  G+W+YL   Y    F  +CP D+++ I YS+
Sbjct:   11 KEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFSVTTVDLKRKPADLQNLAPGTHPPFIT-------FNSEVKTDV-----NKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSD 246          
BLAST of Chloride intracellular channel protein 4 vs. UniProt/SwissProt
Match: sp|Q9Z0W7|CLIC4_RAT (Chloride intracellular channel protein 4 OS=Rattus norvegicus OX=10116 GN=Clic4 PE=1 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 1.610e-21
Identity = 65/253 (25.69%), Postives = 114/253 (45.06%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGAT-----AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +E    P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P     L  G H P             E   D+     ++IE  +++  CP   L  +     +     D+F  F++Y++ +           +L  L  L+++                I++ + ++L GD+++  DC ++PKL  +++   +++NF IP    G+W+YL   Y    F  +CP D+++ I YS+
Sbjct:   11 KEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFSVTTVDLKRKPAHLQNLAPGTHPPFIT-------FNSEVKTDV-----NKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSD 246          
BLAST of Chloride intracellular channel protein 4 vs. UniProt/SwissProt
Match: sp|Q9QYB1|CLIC4_MOUSE (Chloride intracellular channel protein 4 OS=Mus musculus OX=10090 GN=Clic4 PE=1 SV=3)

HSP 1 Score: 95.1301 bits (235), Expect = 4.053e-21
Identity = 65/253 (25.69%), Postives = 114/253 (45.06%), Query Frame = 3
Query:  252 EENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGAT-----AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +E    P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P             E   D+     ++IE  +++  CP   L  +     +     D+F  F++Y++ +           +L  L  L+++                I+  + ++L GD+++  DC ++PKL  +++   +++NF IP    G+W+YL   Y    F  +CP D+++ I YS+
Sbjct:   11 KEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFSVTTVDLKRKPADLQNLAPGTHPPFIT-------FNSEVKTDV-----NKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSD 246          
BLAST of Chloride intracellular channel protein 4 vs. TrEMBL
Match: A0A5J4NWW5 (Chloride intracellular channel protein 2 OS=Paragonimus westermani OX=34504 GN=DEA37_0002493 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 8.024e-64
Identity = 106/250 (42.40%), Postives = 155/250 (62.00%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGL------ELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVPEAV 1001
            P++ELF+K++P D  +KGPC I Q+WFMA Y LVE  LI+LR+TP+ ++  P  YL+LNV RHLPVA +  G   + G+D + +I  + + +E LM+K   P L      +    A +V EDL+RN  +Y++ +N   ++  L +L++++  R+  YL  +   +VDC +MPKLQHLR+A   +KNF IP     LW Y++ MY TKAF+ SCP DRDI+ HY+EK      +   L  S   S VPE +
Sbjct:   40 PLVELFIKAAPTDKREKGPCLIDQQWFMAMYCLVEQGLIDLRLTPMSLEMAPPNYLRLNVARHLPVAWIESGF--VQGKDYSGVIISSTEHLEQLMEKLGSPNLNPYVNPDDALRAEEVFEDLYRNLMNYIRYDNLRPLMTTLTALDNYLAQRAQPYLLDEYPVYVDCQLMPKLQHLRVAARAYKNFDIPEHLTYLWAYIDRMYHTKAFICSCPSDRDILAHYNEKDKLPHSTRISLLGSECLSDVPETI 287          
BLAST of Chloride intracellular channel protein 4 vs. TrEMBL
Match: A0A1I8G5H8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009590g1 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.198e-63
Identity = 104/247 (42.11%), Postives = 160/247 (64.78%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLEL------GATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSN-KYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPT-EFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITST 986
            P+IELF+K SP+   DKGPCPISQ+WFM +Y L E +++NL VT V+   PP+ Y  L+VG+ LPVA VI+G+  + G D+ +L+ D +DEIE LMD ++CP L L       A A +   DL+   N +L++   T +  +L  +N ++  R + +YL G ++S+ DC +MPKL H RIA   ++N+ IP+ + + L +Y+E MY+T AF+ SCP DRDI+ HY +K +P  +    ++ S++ +T
Sbjct:    5 PVIELFIKVSPIGREDKGPCPISQQWFMVFYLLAEKKIVNLFVTTVNPDLPPEAYQALDVGKRLPVARVIKGRD-LKGTDLENLVCDTNDEIEQLMDVWRCPALALPKESPEEAAAERCFADLYTGLNIFLKSGVDTKLRTSLFKINSYLAERPDVQYLIGQELSYADCQLMPKLHHARIAAKAYRNYDIPSPDLRFLQQYMERMYKTAAFVDSCPADRDIVQHYFDKLDPPSRQHLPVKPSLMRAT 250          
BLAST of Chloride intracellular channel protein 4 vs. TrEMBL
Match: A0A0R3TDM9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS5166 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 4.204e-60
Identity = 97/223 (43.50%), Postives = 139/223 (62.33%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLP-VALVIEGKHPM-TGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKT 932
            P++ELF+K+S VDP DKG CP SQKWFM +Y  VE + INLRV PV   NPP EYL L++G+ LP VA   EG   +  G    + +   +DE+E    +     + +  T   V  DL R+ N +L+T +   MLANL ++ND + N    +L+G+ VS+ DCV+  KL H+R+A + F+ F IP + + +W YL+ +Y T+ F +SCP DRDI++HY EK 
Sbjct:    4 PLVELFIKASSVDPGDKGACPFSQKWFMIFYLFVERKAINLRVIPVSSANPPTEYLSLDMGKQLPAVAFYTEGNDDLDVGSVQPESVHTGNDELELFCKQRFASQINIDVTEQWVGADLLRSLNHFLRTGSDQQMLANLTAINDHLLNARTTFLEGNDVSYSDCVLSCKLHHVRVAASFFRGFTIPEDLQYVWSYLKAIYSTRVFDVSCPLDRDILLHYLEKV 226          
BLAST of Chloride intracellular channel protein 4 vs. TrEMBL
Match: A0A2H1BZT4 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_12429 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 9.276e-60
Identity = 95/234 (40.60%), Postives = 155/234 (66.24%), Query Frame = 3
Query:  264 NLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGL------ELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPK 947
            ++P +ELFV+++P +  +KGPC +SQ+W M  +TL    LI L VTP  ++NPP+ Y+KLN  R LP+A +  G+  +  ED   ++  +   +E LM K K P L      E    A KV +DL++NF  Y++ N   ++L+ L++L+ ++ +++  YL G+++S+VDC +MP+LQH+R+A   +K+F IP  F  LW+Y++ MY+T++F+ SCP DRDI++HY E+ +P PK
Sbjct:    5 SIPSVELFVRAAPSNKKEKGPCLVSQQWMMVLHTLEMKGLIKLHVTPTSLENPPENYVKLNAARLLPIAWIQSGE--LDEEDATGMVISSSGSLEALMQKLKEPNLNAKLKKEDVLHAEKVCQDLYKNFMHYVRNNVDKSLLSTLSNLDSYLASQNGIYLLGNELSYVDCQLMPRLQHIRVAGRAYKDFDIPHNFSHLWQYIKNMYDTESFVYSCPSDRDILMHYEER-DPLPK 235          
BLAST of Chloride intracellular channel protein 4 vs. TrEMBL
Match: A0A4E0R3R9 (Chloride intracellular channel protein 4 OS=Fasciola hepatica OX=6192 GN=D915_008377 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 9.805e-60
Identity = 95/234 (40.60%), Postives = 155/234 (66.24%), Query Frame = 3
Query:  264 NLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGL------ELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPK 947
            ++P +ELFV+++P +  +KGPC +SQ+W M  +TL    LI L VTP  ++NPP+ Y+KLN  R LP+A +  G+  +  ED   ++  +   +E LM K K P L      E    A KV +DL++NF  Y++ N   ++L+ L++L+ ++ +++  YL G+++S+VDC +MP+LQH+R+A   +K+F IP  F  LW+Y++ MY+T++F+ SCP DRDI++HY E+ +P PK
Sbjct:    4 SIPSVELFVRAAPSNKKEKGPCLVSQQWMMVLHTLEMKGLIKLHVTPTSLENPPENYVKLNAARLLPIAWIQSGE--LDEEDATGMVISSSGSLEALMQKLKEPNLNAKLKKEDVLHAEKVCQDLYKNFMHYVRNNVDKSLLSTLSNLDSYLASQNGIYLLGNELSYVDCQLMPRLQHIRVAGRAYKDFDIPHNFSHLWQYIKNMYDTESFVYSCPSDRDILMHYEER-DPLPK 234          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Cavefish
Match: clic4 (chloride intracellular channel 4 [Source:NCBI gene;Acc:103041029])

HSP 1 Score: 94.3597 bits (233), Expect = 9.291e-22
Identity = 66/252 (26.19%), Postives = 114/252 (45.24%), Query Frame = 3
Query:  258 NSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG--LELGAT---AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIEN-----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
              N P+IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P            GE   D+     ++IE  ++    P    +LGA    +     D+F  F++Y++ +           +L  L  L++++ +                  + K+L GD ++  DC ++PKL  +++   +++ F+IP +  G+W YL   Y  + F  +CP D++I I Y++
Sbjct:   11 GENEPVIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLQNLAPGTHPPFIT-------FNGEVKTDV-----NKIEEFLEDVLSPPKYSKLGARHPESNTAGMDIFAKFSAYIKNSRPDTNEGLERGLLKTLQKLDEYLRSPLPDEIDHNSMDDDIKVSARKFLDGDDMTLADCNLLPKLHIVKVVAKKYRGFEIPKDMLGIWGYLNNAYTREEFTNTCPSDKEIEIAYAD 245          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Cavefish
Match: clic3 (chloride intracellular channel protein 4-like [Source:NCBI gene;Acc:103028884])

HSP 1 Score: 86.2705 bits (212), Expect = 4.875e-19
Identity = 61/243 (25.10%), Postives = 110/243 (45.27%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLE-----LGATAFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFI--------------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHY 920
            P +ELF+K+S  D    G CP  Q+ FM  +     + +N  +T VD+K  P+    L  G   P  L+  G+           +  + ++IE  +++   P            + +  +D+F  F++Y++  N           L +L  L+ ++                 S +YL GD ++  DC ++PKL  +++ C ++++F IP    GL +YLE  Y+   F  +CP D +I++ Y
Sbjct:    5 PKVELFIKASD-DGEGVGNCPFCQRLFMILWL----KGVNFTLTTVDMKRAPEVLKDLAPGSQPPF-LIYNGE-----------VRTDTNKIEEFLEETLAPPQYPKLCCRYKESNRAGDDIFHKFSAYIKNPNPGLNDMLEKKFLRSLMKLDQYLLTPLPCELDKNPDASQSSRQYLDGDSLTLADCNLLPKLHIVKVVCRKYRDFVIPEALVGLTRYLEKAYQQDEFRYTCPNDAEILLAY 230          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000047642.1 (chloride intracellular channel protein 4-like [Source:NCBI gene;Acc:103024513])

HSP 1 Score: 85.8853 bits (211), Expect = 7.536e-19
Identity = 61/256 (23.83%), Postives = 119/256 (46.48%), Query Frame = 3
Query:  237 FYTMSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKF----KCPGLELGATAFKVTE-DLFRNFNSYL-----QTNNSTN--MLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHY 920
            ++ ++ +    P IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G + P            GE + D+     ++IE  +++     + P L +          D+F  F++Y+     + N+     +L +L  L++++++                 +  +L G  ++  DC ++PKL  ++I   +++ F+IP +  G+W+YL + Y+ + F+ +CP +R+I   Y
Sbjct:    3 WFDIAAKRFGFPTIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVIFNVTTVDLKRKPADLQDLAPGTNPPFMT-------FNGEVLVDV-----NKIEEFLEERLVPPRYPKLSVKHPESNTAGIDVFAKFSAYIKNPRKEANDGLEKVLLKSLKRLDEYLQSPLPEEIDENSTDDPGPSTRSFLDGQDLTLADCNLLPKLHIIKIVAKKYRGFEIPADMTGVWRYLNSAYQREEFINTCPAEREIEFAY 241          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Cavefish
Match: clic5a (chloride intracellular channel 5 [Source:NCBI gene;Acc:103041670])

HSP 1 Score: 85.1149 bits (209), Expect = 1.264e-18
Identity = 61/243 (25.10%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLEL-GATAFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            P IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P            GE   D +   ++ +E ++   K P L      +     D+F  F++Y++             +L  L  L++++                   + KYL  ++++  DC ++PKL  +++   +++NF IP+E+ G+ +YL+  Y    F+ +C  D++I + Y +
Sbjct:    7 PDIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLHNLAPGTHPPFLT-------FNGEVQTD-VNKIEEYLEEMLAPPKYPKLSAKNRESNTAGNDIFSKFSAYVKNTQPEANASLENGLLKALRKLDNYLNTPLPEEIDADSMEEEKCSTRKYLDSNELTLADCNLLPKLHVVKVVSKKYRNFDIPSEYTGVRRYLQNAYARDEFINTCAADKEIELAYQD 236          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Cavefish
Match: clic2 (chloride intracellular channel 2 [Source:NCBI gene;Acc:103028266])

HSP 1 Score: 83.9593 bits (206), Expect = 3.985e-18
Identity = 66/247 (26.72%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLE-LGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDF----------------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPR 941
            P IELF+K+   D  + G CP  Q  FM  +     + +   VT VD++  P+E   L  G + P  L         G    D I   ++ +E  +   + P L  L   +F V  D+F  F+++++ N+  N +   A L +F                      I   S KYL G++++  DC ++PKL  +++A  ++ NF IP  F  + +YL+     + F+ +CP + +I   Y    N R
Sbjct:   11 PTIELFIKAGH-DGENVGNCPFCQSLFMVLWL----KGVKFTVTTVDMRKKPEELKDLAPGTNPPFLL-------YNGVLKTDFIKI-EEFLETTLAPPRYPHLSPLNKESFDVGADIFAKFSAFIK-NSPNNSIQEQALLREFKRLDIYLSTPLPEEIDHNSRENITVSSRKYLDGNRLTLADCNLLPKLHVIKVAAKKYCNFDIPAHFSAVHRYLQNANAREEFIQTCPANIEIEKAYLSVANKR 243          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Sea Lamprey
Match: clic2 (chloride intracellular channel 2 [Source:ZFIN;Acc:ZDB-GENE-040718-299])

HSP 1 Score: 110.153 bits (274), Expect = 3.569e-28
Identity = 73/249 (29.32%), Postives = 121/249 (48.59%), Query Frame = 3
Query:  258 NSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGL--ELGA---TAFKVTEDLFRNFNSYLQTNNST----------NMLANLASLNDFI-------ENRSN----KYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            ++N P IELFVK+   D    G CP+ Q+ FM  +     + +   VT VD+   P     L  G   P            G+   D I     +IE  +++  CP     LG    +++K   D+F  F++Y++ +++T          N+L  L  L+D++       EN S+    K+L G+Q++  DC ++PKL  +++ C  ++ F IP +  G+W YL+  Y    FM +CP DR+I + Y+E
Sbjct:   11 DANEPSIELFVKAGS-DGETIGNCPLCQRIFMVLWL----KGVTFNVTTVDMTKKPAILRSLAPGSQPPFLT-------FNGDVRTDFI-----KIEEFLEETLCPPRYPSLGVKYQSSYKAGADVFSRFSAYIKNSSATDNGSDNYLMKNLLKALKRLDDYLKEPLPYEENSSDVTERKFLDGNQLTLADCDLLPKLHIVKVVCKRYRGFDIPEQLMGIWHYLKNAYAQDEFMRTCPADREIELAYAE 242          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Sea Lamprey
Match: clic6 (chloride intracellular channel 6 [Source:ZFIN;Acc:ZDB-GENE-121214-172])

HSP 1 Score: 88.1965 bits (217), Expect = 2.096e-20
Identity = 66/245 (26.94%), Postives = 110/245 (44.90%), Query Frame = 3
Query:  276 IELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG--LELGATAFK---VTEDLFRNFNSYLQT-------NNSTNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            +EL V++   D    G CP SQ+ FM  +     + +   VT VDIK  P E   L  G H P            GE   D+     ++IE  +++   P   + L A   +      D+F  F++Y++        N    +L     L+D++ +                   K+L GD+++  DC ++PKL  ++I   ++++F+IP E  G+WKYL   Y    F  +CP DR+I + Y++
Sbjct:    8 LELRVRAGS-DGESIGNCPFSQRLFMILWL----KGVVFNVTTVDIKRKPPELQNLAPGTHPPFLT-------FNGEVKTDV-----NKIEEFLEEQLSPPNYVRLAARHRESNLAGNDVFAKFSAYIKNAKKEANDNLEKALLKAFKKLDDYLLSPLPEEIDDCSMGDDGISPRKFLDGDELTLADCNLLPKLHIVKIVAKKYRDFEIPAEMTGVWKYLRGAYARDEFTNTCPADREIELAYAD 235          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Nematostella
Match: EDO38693 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC76])

HSP 1 Score: 62.7734 bits (151), Expect = 1.564e-11
Identity = 37/135 (27.41%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  543 IENLMDKFKCPGLELGATAFKVTED---LFRNFNSYLQTNNST---NMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEK 929
            IE+ ++    P L+ G  +         L   F S+L +NN+     +  +L  L+  + +R  ++++ D ++FVD  ++P L  +R+A A+ K FQIP   K +  Y+E   +++ F  + P D  II H+  +
Sbjct:   83 IEDFIESLPGPSLKGGKGSLMAKIQNLMLLTKFRSFLNSNNTKAEDTLKLHLEILDKLLASRKTRFVESDSLTFVDSYLLPILLVIRVAGAK-KGFQIPATLKNVRLYIEEGDKSQVFQETRPTDSSIIDHWCRR 216          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Nematostella
Match: EDO41092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5C0])

HSP 1 Score: 53.1434 bits (126), Expect = 4.539e-8
Identity = 61/256 (23.83%), Postives = 98/256 (38.28%), Query Frame = 3
Query:  246 MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFK-----CPGLE------LGATAFKVTEDLFRNFNSYLQTNNS-------TNMLANLASLNDFI-------ENRSNK-YLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTN 935
            M+EE   +P +ELFVK+S +D    G      +  M +          L+  P+   N      K NV  H P         P    D    + D+ DEIE   +K        P L       L          +++ FN +++           T +L  L  +N F+       +   N+ +L G+     DC ++PKL ++ +     K F +  E  G+  YLE+  +  AF  +CP   DI+  Y  +  
Sbjct:    1 MAEET--IPGVELFVKASTLDCQSLGADIQCHRIMMMF---------ALKGLPIKTFNV-DTIKKTNVQLHFPYK-----NFPTLTLDNGAEVLDDLDEIERRFEKLSETNQSIPKLACTNKDILSFVNVGPGSKIYQKFNYFIKNRAQEGEEALKTQLLQELKKVNAFLMSAKMPKDGEGNQMFLSGESPGLPDCTLLPKLHYIYVCLGVVKEFPM-EELTGIESYLESGRKHSAFQSTCPKKADIVHFYCRQAG 238          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Nematostella
Match: EDO31904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL2])

HSP 1 Score: 48.9062 bits (115), Expect = 1.046e-6
Identity = 59/246 (23.98%), Postives = 100/246 (40.65%), Query Frame = 3
Query:  282 LFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLP------VALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTED------LFRNFNSYLQTNNST-------NMLANLASLNDFI--------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTE-FKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTN 935
            L+VK+S  D    G   +  +  M    L +   I+ R+ PVD         K NV  H P      + L I+GK         D   D+  +IE+  ++   P L     A            ++  FN Y++  ++        ++LA +  +N+F+        E+ +  +L G +    DC  +PK+ ++ +     K F  P E + G+  YLE   +  AF  +CP   DII  +  + N
Sbjct:   10 LYVKASTRDGKSLGADIVCHRVMMML-ALKDIAGISGRIFPVDTVR------KSNVDLHFPYKNLPTLVLEIDGK---------DQDFDDAADIEDRFERSFQPVLRSENKAINSFVSVGPGCTIYHKFNQYIKNKDTAGDPLLREHLLAEIKKVNNFLLSDNMPKDEHGNKGFLCGSKPGLPDCYFLPKMHYIFVTLGVVKEF--PEESYPGIEAYLELGRKHPAFSSTCPEKPDIIHFFCRQAN 237          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Medaka
Match: clic4 (chloride intracellular channel 4 [Source:NCBI gene;Acc:101159958])

HSP 1 Score: 100.523 bits (249), Expect = 5.757e-24
Identity = 68/249 (27.31%), Postives = 115/249 (46.18%), Query Frame = 3
Query:  264 NLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPG--LELGAT---AFKVTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIEN----------------RSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            N PIIELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G H P            GE   D+     ++IE  ++   CP   ++LGA    +     D+F  F+++++ +           +L  L  L++++                     K+L GD+++  DC ++PKL  +++   +++ F IP E   +WKYL   Y  + F+ +CP D++I I Y++
Sbjct:   14 NEPIIELFVKAGS-DGESIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLQNLAPGTHPPFIT-------FNGEVKTDV-----NKIEEFLEDVLCPPKFIKLGARHPESNTAGMDIFAKFSAFIKNSKPDANEALERGLLKTLQKLDEYLRTPLPDEIDHNSIEDVKVSGRKFLDGDEMTLADCNLLPKLHIVKVVARKYRGFDIPKEMTAIWKYLNNAYTREEFINTCPSDKEIEIAYAD 245          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Medaka
Match: ENSORLT00000013178.2 (chloride intracellular channel protein 4 [Source:NCBI gene;Acc:101172747])

HSP 1 Score: 98.5969 bits (244), Expect = 2.502e-23
Identity = 72/242 (29.75%), Postives = 113/242 (46.69%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFK----VTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIE-------------NRSNK-YLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHY 920
            P IELFVK+S +D    G CP  Q+ FM  +     +     +T VD+K  P+    L  G   P  L+  G          ++  D +   E L +K   P        +K      ED+FR F++Y++  N           L+ L  LN ++E             N S++ YL G+  +  DC ++PKL  +++ C +++NF IPTE KGL +YL+  Y+   F  +CP D +I++ Y
Sbjct:   20 PNIELFVKAS-LDAESVGNCPFCQRLFMILWL----KRAEFVLTTVDMKRAPEVLKALAPGSQPPF-LIFNG----------EVKTDTNKIEEFLEEKLAPPRYPKLCCTYKESNLAGEDIFRKFSAYIKNPNPGLNIMLEKQFLSTLVKLNMYLETPLPHELERNPDANESSRLYLDGNAFTLADCNLLPKLNIVKVVCKKYRNFDIPTELKGLTRYLDNAYKQDEFRHTCPQDEEILLAY 245          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Medaka
Match: ENSORLT00000037696.1 (chloride intracellular channel protein 4 [Source:NCBI gene;Acc:101172747])

HSP 1 Score: 98.2117 bits (243), Expect = 2.662e-23
Identity = 72/242 (29.75%), Postives = 113/242 (46.69%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFK----VTEDLFRNFNSYLQTNN-------STNMLANLASLNDFIE-------------NRSNK-YLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHY 920
            P IELFVK+S +D    G CP  Q+ FM  +     +     +T VD+K  P+    L  G   P  L+  G          ++  D +   E L +K   P        +K      ED+FR F++Y++  N           L+ L  LN ++E             N S++ YL G+  +  DC ++PKL  +++ C +++NF IPTE KGL +YL+  Y+   F  +CP D +I++ Y
Sbjct:    5 PNIELFVKAS-LDAESVGNCPFCQRLFMILWL----KRAEFVLTTVDMKRAPEVLKALAPGSQPPF-LIFNG----------EVKTDTNKIEEFLEEKLAPPRYPKLCCTYKESNLAGEDIFRKFSAYIKNPNPGLNIMLEKQFLSTLVKLNMYLETPLPHELERNPDANESSRLYLDGNAFTLADCNLLPKLNIVKVVCKKYRNFDIPTELKGLTRYLDNAYKQDEFRHTCPQDEEILLAY 230          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Medaka
Match: ENSORLT00000037869.1 (chloride intracellular channel protein 5 [Source:NCBI gene;Acc:101168438])

HSP 1 Score: 93.9745 bits (232), Expect = 1.106e-21
Identity = 70/251 (27.89%), Postives = 121/251 (48.21%), Query Frame = 3
Query:  243 TMSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLE-LGATAFKVTEDLFRNFNSYLQT-----NNSTNMLAN--LASLNDFI---------------ENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSE 926
            T+ EE+ + P IELFVK+   D    G CP SQ+ FM  +     + +   VT VD+K  P +   L  G + P     E       E + D +   ++ +E ++   K P L      +     D+F  F++Y++      N +     N  L  L++++               E  + KYL GD+++  DC ++PKL  L++   +++N++IP++ KG+W+YL   YE   F+ +CP D +I + Y +
Sbjct:    4 TVGEEDRD-PDIELFVKAGS-DGEAIGNCPFSQRLFMILWL----KGVVFNVTTVDLKRKPADLHNLAPGTNPPFLTFKE-------EVLTD-VNKIEEYLEQMLAPPKYPKLAPKNRDSNTAGIDIFAKFSAYVKNTRPDKNRALEQALNKALMKLDEYLMSPVPEEVQKGRHHEEPSTRKYLDGDELTLADCNLLPKLHVLKVVAKKYRNYEIPSDLKGVWRYLGNAYERDEFINTCPADEEIELAYRD 240          
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Medaka
Match: clic2 (chloride intracellular channel 2 [Source:NCBI gene;Acc:101162375])

HSP 1 Score: 93.2041 bits (230), Expect = 2.005e-21
Identity = 69/246 (28.05%), Postives = 114/246 (46.34%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLE-LGATAFKVTEDLFRNFNSYLQT--NNST---NMLANLASLNDF----------------IENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPR 941
            PIIELFVK+   D  + G CP  Q+ FM  +     + +   VT VD++  P E   L  G + P  L         G    D I   ++ +E  +   + P L      +F V  D+F  F+++++   NN+    N+L     L+D+                I   + K+L G++++  DC ++PKL  + +A  ++ +F IP  F G+W+YL+   E + F+ +CP D +I   Y    N R
Sbjct:   11 PIIELFVKAGH-DGENVGNCPFCQRLFMVLWL----KGVKFTVTTVDMRKKPAELKDLAPGTNPPFLL-------YNGTLKTDFIKI-EEFLEQTLAPPRYPHLSPQNKESFDVGADIFAKFSAFIKNSPNNAVQKKNLLKEFKRLDDYLNSPLPEEIDHHSTETISTSNRKFLDGNRLTLADCNLLPKLHVIMVASKKYCDFDIPAHFTGVWRYLQNASEREEFVQTCPADIEIEKAYFSVANNR 243          
BLAST of Chloride intracellular channel protein 4 vs. Planmine SMEST
Match: SMESG000054543.1 (SMESG000054543.1)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 255/255 (100.00%), Postives = 255/255 (100.00%), Query Frame = 3
Query:  246 MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVPEAVRTH 1010
            MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVPEAVRTH
Sbjct:    1 MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVPEAVRTH 255          
BLAST of Chloride intracellular channel protein 4 vs. Planmine SMEST
Match: SMESG000070758.1 (SMESG000070758.1)

HSP 1 Score: 199.904 bits (507), Expect = 1.107e-61
Identity = 102/241 (42.32%), Postives = 152/241 (63.07%), Query Frame = 3
Query:  267 LPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEIENLMDKFKCPGLEL------GATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTNP-RPKSSFLLRD 968
            +P+IELFVK S  D  D G CPI+Q WFMA+Y LVEN+LI+LRVTPV+++   + YL+LNV R LPVA V E     +G+D+ +LIA+  D++E L+  F CP L L       A A  +  D+ ++ N  L+T N   ++  L  ++ F+ ++S K L  D+V++ DC++MP+LQH+R+A  E  +F IP   K L +Y++ MY  K F ++C  DRDII  + EK +  + + S L +D
Sbjct:    2 IPVIELFVKCSLYDKEDFGSCPINQTWFMAFYVLVENKLIDLRVTPVNMEMQCESYLQLNVSRRLPVAKV-ESGTSTSGKDLTNLIAETTDDLEKLIMIFNCPQLTLPIYDPEVAKAENLAADILKSLNILLKTKNEKPLITILTRIDIFLGSKSTKLLMSDEVTYGDCILMPRLQHVRVAGRELASFDIPFNLKHLIRYIKHMYLEKVFEVTCSKDRDIIAQHEEKVSTGKNRRSLLTKD 241          
BLAST of Chloride intracellular channel protein 4 vs. Planmine SMEST
Match: SMESG000007126.1 (SMESG000007126.1)

HSP 1 Score: 155.992 bits (393), Expect = 8.374e-45
Identity = 85/230 (36.96%), Postives = 128/230 (55.65%), Query Frame = 3
Query:  270 PIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLRVTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADN----DDEIENLMDKFKCPGLELGATAFKVTE----DLFRNFNSYLQTNNSTNMLANLASLNDFIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWKYLETMYETKAFMISCPCDRDIIIHYSEKTN 935
            P++EL+VK+S  +  D G CPI Q WFM  Y LV+   I+L+VTPV++ NP   Y +L +GR LPV  +I GK  +  +  ++++  N     +E+  L+  +K   L   +      E    DL+R+F  +L TNN       L  L+D+    ++K+L GD +S  DC +MPKLQH+RI C   K   +      +  Y+  MY  +AF+ SCP DR+II+HY +  N
Sbjct:    4 PLLELYVKTSSCED-DIGSCPICQTWFMILYQLVDENFIDLQVTPVNVDNPCNSYKQLGMGRKLPVVKIISGKELIDCQ--SEIVRKNFIFSGNELYELLKSWKSKLLNENSIKIHEAEFSFLDLYRDFKIFLTTNNFNKFHYYLKKLDDYFTICNSKFLVGDFISICDCELMPKLQHIRITCILLKEIDVFENLDHIKTYINKMYSVEAFIQSCPSDRNIILHYRDTLN 230          
The following BLAST results are available for this feature:
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLIC42.668e-2226.09chloride intracellular channel 4 [Source:HGNC Symb... [more]
CLIC42.668e-2226.09chloride intracellular channel 4 [Source:HGNC Symb... [more]
CLIC52.463e-2127.57chloride intracellular channel 5 [Source:HGNC Symb... [more]
CLIC14.051e-2126.27chloride intracellular channel 1 [Source:HGNC Symb... [more]
CLIC14.051e-2126.27chloride intracellular channel 1 [Source:HGNC Symb... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exc-47.421e-3128.95Chloride intracellular channel exc-4 [Source:UniP... [more]
exl-13.417e-1926.72Chloride intracellular channel exl-1 [Source:UniP... [more]
exl-13.417e-1926.72Chloride intracellular channel exl-1 [Source:UniP... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Clic5.237e-3632.52gene:FBgn0030529 transcript:FBtr0346089[more]
Clic5.237e-3632.52gene:FBgn0030529 transcript:FBtr0073835[more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clic43.684e-2225.40chloride intracellular channel 4 [Source:ZFIN;Acc:... [more]
pnpla7a6.548e-2227.80patatin-like phospholipase domain containing 7a [S... [more]
clic36.548e-2227.80chloride intracellular channel 3 [Source:ZFIN;Acc:... [more]
clic21.212e-2128.51chloride intracellular channel 2 [Source:ZFIN;Acc:... [more]
clic21.212e-2128.51chloride intracellular channel 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clic41.244e-2126.67chloride intracellular channel 5 [Source:NCBI gene... [more]
clic11.482e-2026.67chloride intracellular channel 1 [Source:NCBI gene... [more]
clic45.240e-1925.65chloride intracellular channel 5 [Source:NCBI gene... [more]
st3gal51.886e-1825.91ST3 beta-galactoside alpha-2,3-sialyltransferase 5... [more]
clic16.699e-1825.53chloride intracellular channel 1 [Source:NCBI gene... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clic45.794e-2225.69chloride intracellular channel 4 (mitochondrial) [... [more]
Clic51.658e-2127.57chloride intracellular channel 5 [Source:MGI Symbo... [more]
Clic14.012e-2126.27chloride intracellular channel 1 [Source:MGI Symbo... [more]
Clic52.135e-1927.31chloride intracellular channel 5 [Source:MGI Symbo... [more]
Clic66.088e-1626.32chloride intracellular channel 6 [Source:MGI Symbo... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WQA4|EXC4_CAEEL9.439e-3028.95Chloride intracellular channel exc-4 OS=Caenorhabd... [more]
sp|Q5R957|CLIC4_PONAB7.053e-2226.09Chloride intracellular channel protein 4 OS=Pongo ... [more]
sp|Q9Y696|CLIC4_HUMAN1.281e-2126.09Chloride intracellular channel protein 4 OS=Homo s... [more]
sp|Q9Z0W7|CLIC4_RAT1.610e-2125.69Chloride intracellular channel protein 4 OS=Rattus... [more]
sp|Q9QYB1|CLIC4_MOUSE4.053e-2125.69Chloride intracellular channel protein 4 OS=Mus mu... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NWW58.024e-6442.40Chloride intracellular channel protein 2 OS=Parago... [more]
A0A1I8G5H81.198e-6342.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0R3TDM94.204e-6043.50Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A2H1BZT49.276e-6040.60Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4E0R3R99.805e-6040.60Chloride intracellular channel protein 4 OS=Fascio... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clic49.291e-2226.19chloride intracellular channel 4 [Source:NCBI gene... [more]
clic34.875e-1925.10chloride intracellular channel protein 4-like [Sou... [more]
ENSAMXT00000047642.17.536e-1923.83chloride intracellular channel protein 4-like [Sou... [more]
clic5a1.264e-1825.10chloride intracellular channel 5 [Source:NCBI gene... [more]
clic23.985e-1826.72chloride intracellular channel 2 [Source:NCBI gene... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clic23.569e-2829.32chloride intracellular channel 2 [Source:ZFIN;Acc:... [more]
clic62.096e-2026.94chloride intracellular channel 6 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO386931.564e-1127.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410924.539e-823.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319041.046e-623.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clic45.757e-2427.31chloride intracellular channel 4 [Source:NCBI gene... [more]
ENSORLT00000013178.22.502e-2329.75chloride intracellular channel protein 4 [Source:N... [more]
ENSORLT00000037696.12.662e-2329.75chloride intracellular channel protein 4 [Source:N... [more]
ENSORLT00000037869.11.106e-2127.89chloride intracellular channel protein 5 [Source:N... [more]
clic22.005e-2128.05chloride intracellular channel 2 [Source:NCBI gene... [more]
back to top
BLAST of Chloride intracellular channel protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000054543.10.000e+0100.00SMESG000054543.1[more]
SMESG000070758.11.107e-6142.32SMESG000070758.1[more]
SMESG000007126.18.374e-4536.96SMESG000007126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003609 ID=SMED30003609|Name=Chloride intracellular channel protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1213bp
CTGTTTTGTTCCAAAATGTGTGCGCATTGTGTGTGTAATACTGTGTGTGT
AAACATTCGCATTCACGAACTTGTAATTGCTTCTCTATCCTGACAATGGT
GTGTGTGTGAACAACTCCAATTTGATGAAAAGCACACATTCATAACTAGC
CAATGTACGCATTGTGCGATACAGACTTTCTCTACGAGACAGAGTAAATA
AATACGTGCTCTGTTAACACTTTTTCATTAATCAATTTTTACACGATGTC
TGAAGAAAATTCTAACTTGCCTATTATTGAGTTATTTGTAAAATCGTCAC
CTGTAGATCCAGCTGATAAAGGTCCATGCCCAATTTCTCAAAAATGGTTT
ATGGCTTACTATACCTTAGTTGAAAATCAACTAATCAACTTGAGGGTAAC
ACCAGTTGATATCAAAAATCCACCTCAAGAATATCTTAAGTTAAATGTCG
GCAGACATTTACCGGTTGCTCTAGTCATTGAAGGAAAACACCCAATGACT
GGTGAAGATATGGCAGATCTTATTGCAGATAATGATGATGAAATTGAAAA
CCTTATGGATAAATTCAAATGCCCTGGTTTGGAATTGGGAGCAACTGCTT
TCAAAGTGACTGAAGATCTTTTCAGAAATTTCAATTCATATCTTCAAACC
AACAATTCAACAAATATGCTGGCTAATCTTGCAAGTTTAAATGATTTTAT
TGAAAATCGAAGCAACAAATATTTACAAGGTGATCAAGTTAGTTTTGTAG
ACTGTGTTGTTATGCCAAAGTTGCAACATCTTAGAATAGCGTGTGCAGAA
TTCAAGAATTTTCAGATTCCTACAGAATTCAAAGGATTATGGAAATATTT
AGAAACAATGTATGAAACAAAAGCTTTTATGATTAGCTGCCCATGCGACC
GGGATATAATAATACATTATAGTGAAAAAACAAATCCCCGACCTAAATCT
TCATTTTTATTGAGAGATAGTGTAATTACTTCAACAGTTCCAGAAGCTGT
ACGAACCCATTGAGTTAATTTGAAAATGGATTGTGCACAATAAACAAGCT
CAATGTTAGTATTTATTAAGATGTTAACAATGAATTAAACAAAGTTATAT
TTTAAACTTTATGCTTTGCTGAATTATTGAATTCAGCTGTCTGTGTTATG
TTTAATTGGATTGTTAAAAATTGTTATTATCGTCAAATATATGTCACCTT
GTTTTAAAAAAAA
back to top

protein sequence of SMED30003609-orf-1

>SMED30003609-orf-1 ID=SMED30003609-orf-1|Name=SMED30003609-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=256bp
MSEENSNLPIIELFVKSSPVDPADKGPCPISQKWFMAYYTLVENQLINLR
VTPVDIKNPPQEYLKLNVGRHLPVALVIEGKHPMTGEDMADLIADNDDEI
ENLMDKFKCPGLELGATAFKVTEDLFRNFNSYLQTNNSTNMLANLASLND
FIENRSNKYLQGDQVSFVDCVVMPKLQHLRIACAEFKNFQIPTEFKGLWK
YLETMYETKAFMISCPCDRDIIIHYSEKTNPRPKSSFLLRDSVITSTVPE
AVRTH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005244voltage-gated ion channel activity
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006821chloride transport
GO:0034220ion transmembrane transport
GO:0034765regulation of ion transmembrane transport
GO:1902476chloride transmembrane transport
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR036282Glutathione-S-Trfase_C_sf
IPR010987Glutathione-S-Trfase_C-like
IPR012336Thioredoxin-like_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 1..110
e-value: 3.2E-20
score: 74.4
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 114..255
e-value: 6.2E-41
score: 142.0
NoneNo IPR availablePFAMPF13410GST_C_2coord: 141..203
e-value: 3.0E-6
score: 27.2
NoneNo IPR availablePANTHERPTHR43920:SF5CHLORIDE INTRACELLULAR CHANNEL, ISOFORM Acoord: 7..231
NoneNo IPR availablePANTHERPTHR43920FAMILY NOT NAMEDcoord: 7..231
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 142..229