ATPase family AAA domain containing 2B

Overview
NameATPase family AAA domain containing 2B
Smed IDSMED30003605
Length (bp)3730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATPase family AAA domain containing 2B (SMED30003605) t-SNE clustered cells

Violin plots show distribution of expression levels for ATPase family AAA domain containing 2B (SMED30003605) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATPase family AAA domain containing 2B (SMED30003605) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATPase family AAA domain containing 2B (SMED30003605) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003605

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003605SMESG000011785.1 SmedASXL_015089SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003605SMESG000011785.1 SmedASXL_015089SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30003605SMESG000011785.1 dd_Smed_v4_8534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Human
Match: ATAD2B (ATPase family AAA domain containing 2B [Source:HGNC Symbol;Acc:HGNC:29230])

HSP 1 Score: 559.681 bits (1441), Expect = 1.191e-175
Identity = 328/795 (41.26%), Postives = 459/795 (57.74%), Query Frame = 1
Query:  799 RKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF--------------QGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL-------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELV--SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            R+  +  K+     SD   +DE RFE+RK +S+ RAR+   P+N    +L   +  +R    A+ AD++PM ID+S+ F  IGG   +I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++ +KL+L+++ I +   DF  A++ I P+++R+       +   I+ LL + +      + K F              + ++       NA L     +CH  S  +  SS                    ++PRLL++G         L   + H +   ++   D   L   +  + EE    IFREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    KC        ++ IQ P    R  +F EL+    S+ P  +   +   +    EVL  A    P+ LS  E  ++E +E+  LR+ R+ LR +   LA D++FN+F  PVD+ EV DY  +I  P+DLST+  K+D +NY T  +F  D+ LI +NAL YNP ++   K IR  A    D A  I      PEF+++ ++I EAR+ R 
Sbjct:  321 RRSHIRRKKHAIHSSDTTSSDEERFERRKSKSMARARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQKARKHILQIHTRDWNPKLSDAFLGELAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSHKLQLDVSSIVLSAQDFYHAMQNIVPASQRAVMSSGHALSPIIRPLLERSFNNILAVLQKVFPHAEISQSDKKEDIETLILEDSEDENA-LSIFETNCHSGSPKKQSSSAAIHKPYLHFTMSPYHQPTSYRPRLLLSGERGSGQTSHLAPALLHTLERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWWEAVSETVRATFLTLLQD----------------------IPSFSPI-FLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPIEEDRRKFFQELILNQASMAPPRRKHAALCAM----EVLPLALPSPPRQLSESEKSRMEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKRG 1086          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Human
Match: ATAD2 (ATPase family AAA domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30123])

HSP 1 Score: 550.436 bits (1417), Expect = 1.045e-172
Identity = 313/748 (41.84%), Postives = 443/748 (59.22%), Query Frame = 1
Query:  922 PINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            P+N  K+ELK  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+VA++ + P+++R+       +   +K LL        E + + F    F ++  L++ + C LL+     S     S+                                F+PR+L+ G         L   + H +    + + D   L   +  S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ + S    P L +           +  D   +   + +Q   I  + G+ F     N+Q PD  +R  +F +L+   + KP    I     +  A EVL  A   +P++L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:  389 PLNFRKDELK-GIYKDRMKIGASLADVDPMQLDSSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEETCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPS--FAPVLLL-----------ATSDKPHSALPEEVQELFIR-DYGEIF-----NVQLPDKEERTKFFEDLILKQAAKP---PISKKKAVLQALEVLPVAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 1112          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Human
Match: VCP (valosin containing protein [Source:HGNC Symbol;Acc:HGNC:12666])

HSP 1 Score: 207.608 bits (527), Expect = 9.094e-55
Identity = 117/275 (42.55%), Postives = 170/275 (61.82%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            + +  IGG +K +  +KE V LPL +P +FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DE+D +AP R     ++   IVS LL+L+DGL  R  +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +I++IHT++ K  L+D++ +  +A+ T G  GAD+  L  EA L A+R++   I      ++   +N + V  DDF+ A+    PS  R +
Sbjct:  201 VGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMK--LADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRET 467          

HSP 2 Score: 167.162 bits (422), Expect = 1.339e-41
Identity = 106/315 (33.65%), Postives = 172/315 (54.60%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDD 1797
            ++Q  R +++ I+L    +  ++ N   VT  +F    +   P A+  ++      T+  IGG +   + L+E V  P+ +P+ F K G++P +G+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A +  P ++FFDE+D +A  R         +   +++ +L+ +DG+  +  + +IGATNR D IDPA+ RPGR D+     LP+E+ R  I++ + R   P   D  +  +A +T GFSGAD+  +   A   A+R           + + N + + V+EDD
Sbjct:  419 ALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRK-SPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDD 726          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Human
Match: SPATA5 (spermatogenesis associated 5 [Source:HGNC Symbol;Acc:HGNC:18119])

HSP 1 Score: 200.675 bits (509), Expect = 4.425e-52
Identity = 119/297 (40.07%), Postives = 181/297 (60.94%), Query Frame = 1
Query:  973 NVTRANFADIEPMAIDR----SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFF-MRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLD---DRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNER 1839
            + TR NF +I+  + ++     +T+ MIGG    ++A++E + LPL  PE+FK  GI  PRG+L YGPPG+GKT++ARA+ NE         A+  +  G + +SK+ GE+E +LR +F +A    PSIIF DE+D L P R   Q+++   +V++LL+L+DG+      G+++V+GATNR  A+D ALRRPGRFD+E    +P  ++R DI++   R     L++  +  +A+   G+ GAD+K L  EAGLCALRR   +  +  +     L +I +K  DF  A+  IRPS  R
Sbjct:  328 STTRVNFTEIDKNSKEQDNQFKVTYDMIGGLSSQLKAIREIIELPLKQPELFKSYGIPAPRGVLLYGPPGTGKTMIARAVANEVG-------AYVSVINGPEIISKFYGETEAKLRQIFAEATLRHPSIIFIDELDALCPKREGAQNEVEKRVVASLLTLMDGIGSEVSEGQVLVLGATNRPHALDAALRRPGRFDKEIEIGVPNAQDRLDILQKLLRRVPHLLTEAELLQLANSAHGYVGADLKVLCNEAGLCALRRILKKQPNLPDVKVAGLVKITLK--DFLQAMNDIRPSAMR 615          

HSP 2 Score: 156.762 bits (395), Expect = 3.823e-38
Identity = 100/251 (39.84%), Postives = 149/251 (59.36%), Query Frame = 1
Query:  997 DIEP-----MAIDR-SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVR--SVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXX--XXXXHTRDWKPQLS-DEMITSIASVTKGFSGADIKGLVVEAGLCAL 1716
            DI P     +AID  ++++S IGG +     L+++V  PL +PE F ++GI PP+G+L YGPPG  KT++A+AL NE  LN      F   KG + ++K+VGESER +R  F +A  + PSIIFFDE+D LA  R  S+    +   +++ LL+ +DG++   ++ ++ ATNR D ID AL RPGR DR     LP+   RR+   ++ H+     ++  DE+I      T  +SGA+I  +  EA L AL
Sbjct:  608 DIRPSAMREIAIDVPNVSWSDIGGLESIKLKLEQAVEWPLKHPESFIRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLN------FLAIKGPELMNKYVGESERAVRETFRKARAVAPSIIFFDELDALAVERGSSLGAGNVADRVLAQLLTEMDGIEQLKDVTILAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRREIFKLQFHSMPVSNEVDLDELILQ----TDAYSGAEIVAVCREAALLAL 848          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Human
Match: PSMC1 (proteasome 26S subunit, ATPase 1 [Source:HGNC Symbol;Acc:HGNC:9547])

HSP 1 Score: 179.489 bits (454), Expect = 1.244e-48
Identity = 103/237 (43.46%), Postives = 149/237 (62.87%), Query Frame = 1
Query: 1030 TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMR-KGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSL---IDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRR 1725
            T++ IGG    IQ +KESV LPL +PE ++++GI PP+G++ YGPPG+GKTLLA+A+ N+ S       A F+R  G++ + K++G+  + +R LF  A +  PSI+F DEID +   R          I  T+L L   +DG D RG++ VI ATNRI+ +DPAL RPGR DR+  F LP+E+ ++ I +IHT   +  L+D++ +  +       SGADIK +  EAGL ALR R
Sbjct:  110 TYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTS-------ATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHT--SRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRER 337          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Celegans
Match: lex-1 (Tat-binding homolog 7 [Source:UniProtKB/Swiss-Prot;Acc:P54816])

HSP 1 Score: 424.861 bits (1091), Expect = 1.540e-127
Identity = 331/985 (33.60%), Postives = 487/985 (49.44%), Query Frame = 1
Query:  898 QRARSELNPINLSKNELK------MDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDW---KPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTI------------RPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFAIEQLISG---------IFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKS---IVFLPHIDITFHSLTLSGQNLLLQMVRSH-NLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHW--------------------SPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIREFLVDLNG------CKFGIPNGPLIKTQLMLYDKYYKSEEPFATSKERKSHSDSEASVKRSPMETKYKKSKS---INDLDFTQTDNNHSTLMESFKELQSNLGSNALVTIDVDQSISDPKLLEMSPPEPVVIDLSELEEIIHHVAS--LTDCS-------TILQLEEIYFVLSKEISKFFICSDRSILPKNLRQIIDSY 3636
            +R R    PIN+++ EL+      MD     +  +   +DI+PM++D S+ F  +GG   +IQ+LKE V+ P++YPEVF+K  I+PP+G++FYGPPG+GKTL+ARAL NEC    N K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS +QDQIH+SIVSTLL+L+DGLD RGE++VIGATNR+D +DPALRRPGRFDRE  F LP+   RR I+ IHT  W   KP    E + +IA  T G+ GAD+K L  EA L  LR RYP IY    +L+L++  I +  + F  A++ I            RP +ER+S  L   + + I L + Q Y        +C +  +  + + L   +           +++   ++   RLL+ G   EQL  G         I  ++  + + S  S+   + +G   EE   +  + A + S +   I+ LP ID     + +S Q++L+  + S     P LF+           S +D  ++ E      T+I+        +N I +       R  YF  ++   I    K  D      P  +         + L+  E  +L      + R+ R+  +  L+ L +DR+F  F+ PVD  E  DYY II  PI +  + +K++   YN  D+F  DL LI  NAL YNP      K IR+ A    D  + + E                       +P  D+++ +I +    +    K   M N+  +EI ++  +          K G+    L    + + D   KSEE  +TS +    S           + + K        +D D T  D    T++E+ +  ++    N+   I++  +  D      S P  V I ++E E I+   A+  L  C        ++ +LE +  VLS  I +F    +R  LP  L QI+  +
Sbjct:  338 ERERGRFMPINMTEKELQSAQHILMDRMRKTDAGQG-ASDIDPMSVDSSVGFDQVGGLGHHIQSLKEVVLFPMLYPEVFEKFRINPPKGVVFYGPPGTGKTLVARALANECRRGAN-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYAMRPSIIFFDEIDGLAPVRSSKQDQIHASIVSTLLALMDGLDGRGEVVVIGATNRLDTLDPALRRPGRFDRELRFSLPDLNARRQILDIHTSKWEENKP--IPETLDAIAERTSGYCGADLKFLCTEAVLIGLRSRYPHIYMCSERLKLDVATIKITSEHFGHAMRRITPASRRDLTIPSRPLDERTSILLGDTVSNLISLRIPQGY--------RCVENAMATASSELEQVV----------RALEPNPTVPAIRLLLCGS--EQLADGGQTSYVLPAILAKLDHLPVFSL-SVSSLLTDG-RPEEAFSNAIQSAMRASATGPCIMLLPSIDEWIKVIPVSVQHMLITCLESMTGFTPILFL-----------STLD--TSFEDAPEYVTEIFR------HANCITLNPSRRTIRQKYFEHVIE-KINTPPKVFDPTVYEMPLPDDDSPDSKPSRKLNDDETRELLKMYTALQRQMRLFFKERLTRLMRDRRFVEFVEPVDPDEAEDYYEIIETPICMQDIMEKLNNCEYNHADKFVADLILIQTNALEYNPSTTKDGKLIRQMANTLRDAIDDLIECELDESFVERIETVSRMLQDAGVTPTSDKLLTEIPKGFARK----KAWSMTNSLAKEIEQWTSEREAENQKMLSKLGVAAPTLELVVVPVED--MKSEEGTSTSTDGVPASAGNKKKLLKKKKGQKKSKTGESEEHDEDSTVEDAGEDTIVENLEIKKNQETPNSEHDIEMKDASKD------STPS-VQISIAEKELIVSKPATCELIQCCVEKSEGWSVSELERLSSVLSHTIERFRDEWNRENLPAQLTQIVREW 1263          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Celegans
Match: lex-1 (Tat-binding homolog 7 [Source:UniProtKB/Swiss-Prot;Acc:P54816])

HSP 1 Score: 424.476 bits (1090), Expect = 1.910e-127
Identity = 331/985 (33.60%), Postives = 487/985 (49.44%), Query Frame = 1
Query:  898 QRARSELNPINLSKNELK------MDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDW---KPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTI------------RPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFAIEQLISG---------IFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKS---IVFLPHIDITFHSLTLSGQNLLLQMVRSH-NLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHW--------------------SPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIREFLVDLNG------CKFGIPNGPLIKTQLMLYDKYYKSEEPFATSKERKSHSDSEASVKRSPMETKYKKSKS---INDLDFTQTDNNHSTLMESFKELQSNLGSNALVTIDVDQSISDPKLLEMSPPEPVVIDLSELEEIIHHVAS--LTDCS-------TILQLEEIYFVLSKEISKFFICSDRSILPKNLRQIIDSY 3636
            +R R    PIN+++ EL+      MD     +  +   +DI+PM++D S+ F  +GG   +IQ+LKE V+ P++YPEVF+K  I+PP+G++FYGPPG+GKTL+ARAL NEC    N K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS +QDQIH+SIVSTLL+L+DGLD RGE++VIGATNR+D +DPALRRPGRFDRE  F LP+   RR I+ IHT  W   KP    E + +IA  T G+ GAD+K L  EA L  LR RYP IY    +L+L++  I +  + F  A++ I            RP +ER+S  L   + + I L + Q Y        +C +  +  + + L   +           +++   ++   RLL+ G   EQL  G         I  ++  + + S  S+   + +G   EE   +  + A + S +   I+ LP ID     + +S Q++L+  + S     P LF+           S +D  ++ E      T+I+        +N I +       R  YF  ++   I    K  D      P  +         + L+  E  +L      + R+ R+  +  L+ L +DR+F  F+ PVD  E  DYY II  PI +  + +K++   YN  D+F  DL LI  NAL YNP      K IR+ A    D  + + E                       +P  D+++ +I +    +    K   M N+  +EI ++  +          K G+    L    + + D   KSEE  +TS +    S           + + K        +D D T  D    T++E+ +  ++    N+   I++  +  D      S P  V I ++E E I+   A+  L  C        ++ +LE +  VLS  I +F    +R  LP  L QI+  +
Sbjct:  340 ERERGRFMPINMTEKELQSAQHILMDRMRKTDAGQG-ASDIDPMSVDSSVGFDQVGGLGHHIQSLKEVVLFPMLYPEVFEKFRINPPKGVVFYGPPGTGKTLVARALANECRRGAN-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYAMRPSIIFFDEIDGLAPVRSSKQDQIHASIVSTLLALMDGLDGRGEVVVIGATNRLDTLDPALRRPGRFDRELRFSLPDLNARRQILDIHTSKWEENKP--IPETLDAIAERTSGYCGADLKFLCTEAVLIGLRSRYPHIYMCSERLKLDVATIKITSEHFGHAMRRITPASRRDLTIPSRPLDERTSILLGDTVSNLISLRIPQGY--------RCVENAMATASSELEQVV----------RALEPNPTVPAIRLLLCGS--EQLADGGQTSYVLPAILAKLDHLPVFSL-SVSSLLTDG-RPEEAFSNAIQSAMRASATGPCIMLLPSIDEWIKVIPVSVQHMLITCLESMTGFTPILFL-----------STLD--TSFEDAPEYVTEIFR------HANCITLNPSRRTIRQKYFEHVIE-KINTPPKVFDPTVYEMPLPDDDSPDSKPSRKLNDDETRELLKMYTALQRQMRLFFKERLTRLMRDRRFVEFVEPVDPDEAEDYYEIIETPICMQDIMEKLNNCEYNHADKFVADLILIQTNALEYNPSTTKDGKLIRQMANTLRDAIDDLIECELDESFVERIETVSRMLQDAGVTPTSDKLLTEIPKGFARK----KAWSMTNSLAKEIEQWTSEREAENQKMLSKLGVAAPTLELVVVPVED--MKSEEGTSTSTDGVPASAGNKKKLLKKKKGQKKSKTGESEEHDEDSTVEDAGEDTIVENLEIKKNQETPNSEHDIEMKDASKD------STPS-VQISIAEKELIVSKPATCELIQCCVEKSEGWSVSELERLSSVLSHTIERFRDEWNRENLPAQLTQIVREW 1265          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Celegans
Match: lex-1 (Tat-binding homolog 7 [Source:UniProtKB/Swiss-Prot;Acc:P54816])

HSP 1 Score: 424.476 bits (1090), Expect = 1.910e-127
Identity = 331/985 (33.60%), Postives = 487/985 (49.44%), Query Frame = 1
Query:  898 QRARSELNPINLSKNELK------MDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDW---KPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTI------------RPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFAIEQLISG---------IFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKS---IVFLPHIDITFHSLTLSGQNLLLQMVRSH-NLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHW--------------------SPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIREFLVDLNG------CKFGIPNGPLIKTQLMLYDKYYKSEEPFATSKERKSHSDSEASVKRSPMETKYKKSKS---INDLDFTQTDNNHSTLMESFKELQSNLGSNALVTIDVDQSISDPKLLEMSPPEPVVIDLSELEEIIHHVAS--LTDCS-------TILQLEEIYFVLSKEISKFFICSDRSILPKNLRQIIDSY 3636
            +R R    PIN+++ EL+      MD     +  +   +DI+PM++D S+ F  +GG   +IQ+LKE V+ P++YPEVF+K  I+PP+G++FYGPPG+GKTL+ARAL NEC    N K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS +QDQIH+SIVSTLL+L+DGLD RGE++VIGATNR+D +DPALRRPGRFDRE  F LP+   RR I+ IHT  W   KP    E + +IA  T G+ GAD+K L  EA L  LR RYP IY    +L+L++  I +  + F  A++ I            RP +ER+S  L   + + I L + Q Y        +C +  +  + + L   +           +++   ++   RLL+ G   EQL  G         I  ++  + + S  S+   + +G   EE   +  + A + S +   I+ LP ID     + +S Q++L+  + S     P LF+           S +D  ++ E      T+I+        +N I +       R  YF  ++   I    K  D      P  +         + L+  E  +L      + R+ R+  +  L+ L +DR+F  F+ PVD  E  DYY II  PI +  + +K++   YN  D+F  DL LI  NAL YNP      K IR+ A    D  + + E                       +P  D+++ +I +    +    K   M N+  +EI ++  +          K G+    L    + + D   KSEE  +TS +    S           + + K        +D D T  D    T++E+ +  ++    N+   I++  +  D      S P  V I ++E E I+   A+  L  C        ++ +LE +  VLS  I +F    +R  LP  L QI+  +
Sbjct:  340 ERERGRFMPINMTEKELQSAQHILMDRMRKTDAGQG-ASDIDPMSVDSSVGFDQVGGLGHHIQSLKEVVLFPMLYPEVFEKFRINPPKGVVFYGPPGTGKTLVARALANECRRGAN-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYAMRPSIIFFDEIDGLAPVRSSKQDQIHASIVSTLLALMDGLDGRGEVVVIGATNRLDTLDPALRRPGRFDRELRFSLPDLNARRQILDIHTSKWEENKP--IPETLDAIAERTSGYCGADLKFLCTEAVLIGLRSRYPHIYMCSERLKLDVATIKITSEHFGHAMRRITPASRRDLTIPSRPLDERTSILLGDTVSNLISLRIPQGY--------RCVENAMATASSELEQVV----------RALEPNPTVPAIRLLLCGS--EQLADGGQTSYVLPAILAKLDHLPVFSL-SVSSLLTDG-RPEEAFSNAIQSAMRASATGPCIMLLPSIDEWIKVIPVSVQHMLITCLESMTGFTPILFL-----------STLD--TSFEDAPEYVTEIFR------HANCITLNPSRRTIRQKYFEHVIE-KINTPPKVFDPTVYEMPLPDDDSPDSKPSRKLNDDETRELLKMYTALQRQMRLFFKERLTRLMRDRRFVEFVEPVDPDEAEDYYEIIETPICMQDIMEKLNNCEYNHADKFVADLILIQTNALEYNPSTTKDGKLIRQMANTLRDAIDDLIECELDESFVERIETVSRMLQDAGVTPTSDKLLTEIPKGFARK----KAWSMTNSLAKEIEQWTSEREAENQKMLSKLGVAAPTLELVVVPVED--MKSEEGTSTSTDGVPASAGNKKKLLKKKKGQKKSKTGESEEHDEDSTVEDAGEDTIVENLEIKKNQETPNSEHDIEMKDASKD------STPS-VQISIAEKELIVSKPATCELIQCCVEKSEGWSVSELERLSSVLSHTIERFRDEWNRENLPAQLTQIVREW 1265          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Celegans
Match: cdc-48.1 (Transitional endoplasmic reticulum ATPase homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P54811])

HSP 1 Score: 194.897 bits (494), Expect = 5.147e-51
Identity = 114/275 (41.45%), Postives = 169/275 (61.45%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            I +  +GG +K +  +KE V LPL +P++FK +GI PPRG+L +GPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++  K +P+I+F DEID +AP R     ++   IVS LL+L+DG+  R  ++VI ATNR ++ID ALRR GRFDRE    +P+   R +I+RIHT++ K  L+D++ +  IA+   GF GAD+  L  EA L  +R +   I    ++++   LN + V  ++F+ A     PS  R +
Sbjct:  207 IGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGIKPPRGILLFGPPGTGKTLIARAVANETGS------FFFLINGPEVMSKMSGESESNLRKAFEECEKNQPAILFIDEIDAIAPKREKTNGEVERRIVSQLLTLMDGVKGRSNLVVIAATNRPNSIDGALRRFGRFDREIDIGIPDAVGRLEILRIHTKNMK--LADDVDLEQIANECHGFVGADLASLCSEAALQQIREKMELIDLEDDQIDAEVLNSLAVTMENFRFAQGKSSPSALREA 473          

HSP 2 Score: 166.007 bits (419), Expect = 1.205e-41
Identity = 106/291 (36.43%), Postives = 163/291 (56.01%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS----IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            ++Q+ R ++  I+L  +++  ++ N   VT  NF        P A+  ++      T+S IGG +   + L+E V  P+ +PE + K G+ P RG+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A  R              +++ +L+ +DG++ +  + +IGATNR D IDPA+ RPGR D+     LP+E  R  I++   R  K  LS ++ +T +A  T GFSGAD+  +   A   A+R
Sbjct:  425 ALQQIREKMELIDLEDDQIDAEVLNSLAVTMENFRFAQGKSSPSALREAVVETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGGAGGDGGGASDRVINQVLTEMDGMNAKKNVFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDEASRHQILKASLR--KTPLSKDLDLTFLAKNTVGFSGADLTEICQRACKLAIR 707          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Celegans
Match: cdc-48.2 (Transitional endoplasmic reticulum ATPase homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:P54812])

HSP 1 Score: 191.815 bits (486), Expect = 5.543e-50
Identity = 110/275 (40.00%), Postives = 166/275 (60.36%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            + +  +GG +K +  +KE V LPL +P++FK +G+ PPRG+L +GPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F +  K  P+I+F DEID +AP R     ++   IVS LL+L+DGL  R  ++VI ATNR ++ID ALRR GRFDRE    +P+   R +I+RIHT++ K  L +++ +  +A+   GF GAD+  L  EA +  +R +   I    + ++   LN + V  ++F+ A+    PS  R +
Sbjct:  206 VGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKMSGESESNLRKAFAECEKNSPAILFIDEIDAIAPKREKAHGEVEKRIVSQLLTLMDGLKTRAHVVVIAATNRPNSIDGALRRFGRFDREIDIGIPDAVGRLEILRIHTKNMK--LGEDVDLEQVANECHGFVGADLASLCSEAAIQQIREKMELIDLEDDTIDAEVLNSLAVTMENFRFAMGKSSPSALREA 472          

HSP 2 Score: 169.088 bits (427), Expect = 1.150e-42
Identity = 104/289 (35.99%), Postives = 159/289 (55.02%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            ++Q+ R ++  I+L  + +  ++ N   VT  NF        P A+  ++      T+S IGG +   + L+E V  P+ +PE + K G+ P RG+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A  R         +   +++ +L+ +DG++ +  + +IGATNR D IDPA+ RPGR D+     LP+E  R  I +   R   P  +D  +  +A  T GFSGAD+  +   A   A+R
Sbjct:  424 AIQQIREKMELIDLEDDTIDAEVLNSLAVTMENFRFAMGKSSPSALREAVVETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQVLTEMDGMNAKKNVFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDEASRLQIFKASLRK-TPLSADLDLNFLAKNTVGFSGADLTEICQRACKLAIR 705          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0112905)

HSP 1 Score: 198.364 bits (503), Expect = 5.483e-52
Identity = 114/276 (41.30%), Postives = 168/276 (60.87%), Query Frame = 1
Query: 1024 SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            ++ +  IGG +K +  +KE V LPL +P +FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R     ++   IVS LL+L+DG+     +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +++RIHT++ K  L D++ +  IA+ + G  GAD+  L  EA L  +R +   I    +K++   L  + V  ++F+ A+    PS  R +
Sbjct:  222 AVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK--LHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRET 489          

HSP 2 Score: 174.866 bits (442), Expect = 2.558e-44
Identity = 105/291 (36.08%), Postives = 168/291 (57.73%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRR 1722
            ++Q+ R +++ I+L  +++  ++     VT  NF        P A+  ++      T++ IGG +   + L+E V  P+ +P+ F K G+ P RG+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A  R         +   +++ +L+ +DG+  +  + +IGATNR D IDPA+ RPGR D+     LP+++ R  I++ + R  K  L+ E+ +T IA VT+GFSGAD+  +   A   A+R+
Sbjct:  441 ALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQAN------FISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLR--KSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQ 723          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0088391)

HSP 1 Score: 197.978 bits (502), Expect = 5.567e-52
Identity = 114/277 (41.16%), Postives = 168/277 (60.65%), Query Frame = 1
Query: 1024 SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSSF 1848
            ++ +  IGG +K +  +KE V LPL +P +FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R     ++   IVS LL+L+DG+     +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +++RIHT++ K  L D++ +  IA+ + G  GAD+  L  EA L  +R +   I    +K++   L  + V  ++F+ A+    PS  R + 
Sbjct:  197 AVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK--LHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETV 465          

HSP 2 Score: 174.481 bits (441), Expect = 2.651e-44
Identity = 105/291 (36.08%), Postives = 168/291 (57.73%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRR 1722
            ++Q+ R +++ I+L  +++  ++     VT  NF        P A+  ++      T++ IGG +   + L+E V  P+ +P+ F K G+ P RG+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A  R         +   +++ +L+ +DG+  +  + +IGATNR D IDPA+ RPGR D+     LP+++ R  I++ + R  K  L+ E+ +T IA VT+GFSGAD+  +   A   A+R+
Sbjct:  416 ALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQAN------FISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLR--KSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQ 698          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0112906)

HSP 1 Score: 197.208 bits (500), Expect = 6.348e-52
Identity = 114/276 (41.30%), Postives = 168/276 (60.87%), Query Frame = 1
Query: 1024 SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            ++ +  IGG +K +  +KE V LPL +P +FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R     ++   IVS LL+L+DG+     +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +++RIHT++ K  L D++ +  IA+ + G  GAD+  L  EA L  +R +   I    +K++   L  + V  ++F+ A+    PS  R +
Sbjct:  155 AVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK--LHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRET 422          

HSP 2 Score: 173.711 bits (439), Expect = 2.798e-44
Identity = 105/291 (36.08%), Postives = 168/291 (57.73%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRR 1722
            ++Q+ R +++ I+L  +++  ++     VT  NF        P A+  ++      T++ IGG +   + L+E V  P+ +P+ F K G+ P RG+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A  R         +   +++ +L+ +DG+  +  + +IGATNR D IDPA+ RPGR D+     LP+++ R  I++ + R  K  L+ E+ +T IA VT+GFSGAD+  +   A   A+R+
Sbjct:  374 ALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQAN------FISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLR--KSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQ 656          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0343852)

HSP 1 Score: 198.364 bits (503), Expect = 6.622e-52
Identity = 114/276 (41.30%), Postives = 168/276 (60.87%), Query Frame = 1
Query: 1024 SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            ++ +  IGG +K +  +KE V LPL +P +FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R     ++   IVS LL+L+DG+     +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +++RIHT++ K  L D++ +  IA+ + G  GAD+  L  EA L  +R +   I    +K++   L  + V  ++F+ A+    PS  R +
Sbjct:  222 AVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMK--LHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRET 489          

HSP 2 Score: 175.637 bits (444), Expect = 1.174e-44
Identity = 110/316 (34.81%), Postives = 174/316 (55.06%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDD 1797
            ++Q+ R +++ I+L  +++  ++     VT  NF        P A+  ++      T++ IGG +   + L+E V  P+ +P+ F K G+ P RG+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A  R         +   +++ +L+ +DG+  +  + +IGATNR D IDPA+ RPGR D+     LP+++ R  I++ + R  K  L+ E+ +T IA VT+GFSGAD+  +   A   A+R+          +   N N     EDD
Sbjct:  441 ALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQAN------FISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLR--KSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDDEDD 748          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Fly
Match: Rpt6 (gene:FBgn0020369 transcript:FBtr0077189)

HSP 1 Score: 177.948 bits (450), Expect = 4.906e-48
Identity = 109/270 (40.37%), Postives = 161/270 (59.63%), Query Frame = 1
Query: 1030 TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVN--ECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSL---IDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTI 1821
            T+ M+GG  K I+ +KE + LP+ +PE+F  LGI+ P+G+L YGPPG+GKTLLARA+ +  EC+        F    G++ + K++GE  R +R LF  A +  PSIIF DEID +   R        S +  T+L L   +DG +    I VI ATNRID +DPAL RPGR DR+  F  P E  R DI++IH+R  K  L+  + +  IA +  G SGA++KG+  EAG+ ALR R  +++      E+ + ++  K+ +  ++IK +
Sbjct:  146 TYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT--------FIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSR--KMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRER--RVHVTQEDFEMAVAKVMQKDSEKNMSIKKL 403          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Zebrafish
Match: atad2b (ATPase family AAA domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-110411-210])

HSP 1 Score: 530.02 bits (1364), Expect = 2.137e-165
Identity = 320/803 (39.85%), Postives = 450/803 (56.04%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFP-----------------------LHSYMPHRIKLLLHQDY-------------------CLFKEKITKCFQGIVFPSDNPLNAKLDCDLLD--CHWDSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQS----NLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAE-MKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIREFLVDLNG 3117
            RFE+RK +S+ RAR+   P+NL   +L   +  DR    A+ AD++PM +D S+ F  +GG   +IQ+LKE V+ PL+YP+VF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I+ IHTRDW P+L++  I  +A    G+ GADIK L  EA L ALRRRYPQIY +  + +L++  I +   DF  A+++I P+ +R+  P                       L    PH    LLH+++                   CL    I +   G      +P  A   C       H+ +S     + ++PRLL+TG         L   + H +    +   D   L   +  + EE    +FREA +   SI+++PHI   + +++ + ++  L +++      D+   T L++   + SV               Q+  EL KC  S     +  +  P    R  +F++L+ +      K+         A EVL  +E   P+ LS++E  +LE +E+  LR+ R+ LR +   LA D++F +F  PVD+ EV DY  +I+ P+DLS +  K+D + Y    +F  D+ LI +NAL YNP ++   K IR  A    D A  +      PEFDR+ ++I E+R  R      +  V   T   R+ + +  G
Sbjct:  324 RFERRKSKSMSRARNRCLPMNLRAEDLASGVLRDRVKVGASLADVDPMNLDTSVKFDSVGGLTHHIQSLKEMVVFPLLYPQVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDR-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDKKARKHILEIHTRDWSPKLAEPFIDELAERCVGYCGADIKALCTEAALAALRRRYPQIYGSSQRYQLDVASIVLGPQDFGRALRSIVPAGQRALAPPGQALSCVLKPLLEPTLNQTLACLTRVFPH--AELLHREHTHDSDNHLLVEDSYSEDEECLGASSIYETQSG------SPKKAA-SCTTHKPFLHFTTSAYQQPTSYRPRLLLTGPQGAGQSTHLAPALLHHLEKFTVHRLDLPTLYSVSAKTPEESCAQVFREARRCVPSIIYMPHISAWWEAISETVKSSFLMLLQ------DVPSFTPLLILATAESVYQ-------------QLPDEL-KCIFSRSYGEVFCLSMPGEEARRKFFSDLILVQAA---KAPPRRRKSACALEVLTLSEDPGPRQLSAEEQRRLEEQEENTLRELRLFLRDVTKRLATDKRFQIFSKPVDIEEVSDYLEVITQPMDLSAIMMKIDKHKYMVAKDFLADIDLICSNALEYNPDKDPGDKIIRHRACSLKDTAHAMIASELDPEFDRMCEEIKESRRKRAPQTAPQPPVTPSTVATRKPMGEEAG 1093          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Zebrafish
Match: atad2 (ATPase family AAA domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7003])

HSP 1 Score: 529.25 bits (1362), Expect = 2.687e-165
Identity = 315/765 (41.18%), Postives = 451/765 (58.95%), Query Frame = 1
Query:  862 EIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERS----------------SFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDC----------------HWDSSIQSFSSLFKPRLLVTGFA----IEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKP-------KTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHE 3024
            E +FE+R+ +S  R+ +   P+NL K++L + +  DR    A+ AD++PM ID+++ F  IGG  K+I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS     K+AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDG+APVRS RQDQIHSSIVSTLL+L+DGLD RGE++VIGATNR+D+IDPALRRPGRFDREF+F LP+   R+DI++IHTR W PQLSD  +  +A    G+ G DIK +  EA LCALRRRYPQIY++  KL L++  I V   DF  A++ I P+++R+                S  L++ M    +L  H +  L K++ T    GI+   D+ L ++ +   + C                H   S     + F+PRLL+ G +       L   I H +    + + D   L   +  + EE    +F EA +T+ SIV++PHI   + +++ + +   + +++   +  P L + T         + + +  +VE+            G+ F     ++  P   +R  +F +L+      L+++  + ++   A  VL+  E+ P       + L+ QEL+KLE +E+  LR+ R+ LR + + LA+D++F  F  PVD  EVPDY ++I  P+DLST+  K+DL+ Y T   +  D+ LI  NAL YNP R+   + IR  A    D    I  D    +F++I  ++ E
Sbjct:  325 EEKFERRRTKSRNRSINRCLPMNLRKDDL-LGIHKDRIKIGASLADVDPMQIDQTVRFDSIGGLGKHISALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGER-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGIAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNRLDSIDPALRRPGRFDREFLFNLPDREARKDILKIHTRHWDPQLSDAFLEELADKCVGYCGTDIKAVCAEAALCALRRRYPQIYASSQKLLLDVESICVSGRDFLSAMRKIVPASQRAVVSPAKALTPVIEPLLSAALNNAMKMLQRLFPHVEQGLKKKRDTGNVSGIL---DDLLQSEDEGSSV-CITNKGQKNTGPAVSVLHLTRSALQQPTSFRPRLLLCGTSGSAQTSHLAPAILHTLEKFTVYTLDVAVLYGVSSATPEEACAQVFCEARRTAPSIVYIPHIQRWWDTVSPTLRATFISLLQDIPSFCPCLLLATCSFPHDALYTEVQDLFHVEY------------GEVF-----DVPLPSRDERLRFFEDLI------LNQAAKAPASKREA--VLQALEVLPVAPPPPPRLLTKQELQKLEEQEEDTLRELRLFLRDVTNRLAQDKRFKAFTKPVDTEEVPDYTTVIKQPMDLSTVLSKIDLHKYETVAAYLEDVDLIWQNALEYNPDRDPSDRLIRHRACALKDTVHAIIRDELDEDFEKICVEMKE 1058          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Zebrafish
Match: atad2b (ATPase family AAA domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-110411-210])

HSP 1 Score: 440.654 bits (1132), Expect = 4.726e-137
Identity = 238/526 (45.25%), Postives = 321/526 (61.03%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFP-----------------------LHSYMPHRIKLLLHQDY-------------------CLFKEKITKCFQGIVFPSDNPLNAKLDCDLLD--CHWDSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVR 2301
            RFE+RK +S+ RAR+   P+NL   +L   +  DR    A+ AD++PM +D S+ F  +GG   +IQ+LKE V+ PL+YP+VF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I+ IHTRDW P+L++  I  +A    G+ GADIK L  EA L ALRRRYPQIY +  + +L++  I +   DF  A+++I P+ +R+  P                       L    PH    LLH+++                   CL    I +   G      +P  A   C       H+ +S     + ++PRLL+TG         L   + H +    +   D   L   +  + EE    +FREA +   SI+++PHI   + +++ + ++  L +++
Sbjct:  339 RFERRKSKSMSRARNRCLPMNLRAEDLASGVLRDRVKVGASLADVDPMNLDTSVKFDSVGGLTHHIQSLKEMVVFPLLYPQVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDR-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDKKARKHILEIHTRDWSPKLAEPFIDELAERCVGYCGADIKALCTEAALAALRRRYPQIYGSSQRYQLDVASIVLGPQDFGRALRSIVPAGQRALAPPGQALSCVLKPLLEPTLNQTLACLTRVFPH--AELLHREHTHDSDNHLLVEDSYSEDEECLGASSIYETQSG------SPKKAA-SCTTHKPFLHFTTSAYQQPTSYRPRLLLTGPQGAGQSTHLAPALLHHLEKFTVHRLDLPTLYSVSAKTPEESCAQVFREARRCVPSIIYMPHISAWWEAISETVKSSFLMLLQ 854          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Zebrafish
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 207.994 bits (528), Expect = 4.286e-55
Identity = 117/275 (42.55%), Postives = 170/275 (61.82%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            + +  IGG +K +  +KE V LPL +P +FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DE+D +AP R     ++   IVS LL+L+DGL  R  +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +I++IHT++ K  L+D++ +  +A+ T G  GAD+  L  EA L A+R++   I      ++   +N + V  DDF+ A+    PS  R +
Sbjct:  201 VGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMK--LADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRET 467          

HSP 2 Score: 169.859 bits (429), Expect = 9.790e-43
Identity = 107/315 (33.97%), Postives = 171/315 (54.29%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRS------ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDD 1797
            ++Q  R +++ I+L    +  ++ N   VT  +F    +   P A+  +      IT+  IGG     + L+E V  P+ +P+ F K G++P +G+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A +  P ++FFDE+D +A  R         +   +++ +L+ +DG+  +  + +IGATNR D IDPA+ RPGR D+     LP+E+ R  I++ + R   P   D  +  +A +T GFSGAD+  +   A   A+R           + + N + + V+EDD
Sbjct:  419 ALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRK-SPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDD 726          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Zebrafish
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 207.994 bits (528), Expect = 5.235e-55
Identity = 117/275 (42.55%), Postives = 170/275 (61.82%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            + +  IGG +K +  +KE V LPL +P +FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DE+D +AP R     ++   IVS LL+L+DGL  R  +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +I++IHT++ K  L+D++ +  +A+ T G  GAD+  L  EA L A+R++   I      ++   +N + V  DDF+ A+    PS  R +
Sbjct:  201 VGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMK--LADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRET 467          

HSP 2 Score: 169.859 bits (429), Expect = 1.014e-42
Identity = 107/315 (33.97%), Postives = 171/315 (54.29%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRS------ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDD 1797
            ++Q  R +++ I+L    +  ++ N   VT  +F    +   P A+  +      IT+  IGG     + L+E V  P+ +P+ F K G++P +G+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A +  P ++FFDE+D +A  R         +   +++ +L+ +DG+  +  + +IGATNR D IDPA+ RPGR D+     LP+E+ R  I++ + R   P   D  +  +A +T GFSGAD+  +   A   A+R           + + N + + V+EDD
Sbjct:  419 ALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRK-SPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDD 726          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Xenopus
Match: ATAD2B (ATPase family, AAA domain containing 2B [Source:NCBI gene;Acc:100496692])

HSP 1 Score: 544.273 bits (1401), Expect = 6.275e-172
Identity = 316/772 (40.93%), Postives = 451/772 (58.42%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSF-PLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSF------------------------------SSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELVSLSIKPLDK-SIDSNSNLNPADEVLKEAEMKPKT--LSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYY 3048
            RFE+RK +S+ +AR+   P+NL   +L   +  +R    A+ AD++PM++DRS+ F  +GG  ++I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++  KL+L+++ + +   DF  A+K I P+++R+   P HS  P  I+ LL + +      + K F    F  +N  +      L DC  ++++  F                               + ++PRLL++G         L   + H +   ++   D   L   +  + EE    +FREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    +C        +  I  P+   R  +F +++      L++ ++    N   A EVL  A + P+   LS  E +++E  E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T  +F  D+ LI +NAL YNP +    K IR  A    D A  I      PEF++  ++I E R  R  Y
Sbjct:  236 RFERRKSKSMAKARNRCLPMNLRAEDLASGILRERVKVGASLADVDPMSLDRSVRFDSVGGLSEHIYALKEMVVFPLLYPEIFEKFRIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYVMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDQKARKHILQIHTRDWNPKLSDSFLEELAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSQKLQLDISSVVLGAHDFYHAMKNIVPASQRAVMSPGHSLSP-VIRPLLERTFSDILRVLHKVFPHAEFSQNNKKDDAASLLLDDCEDENTLSIFDVSCASGSPKKQPAALHKPFLHFTMSACYQPTSYRPRLLLSGEPGSGQTSHLAPAVLHTLEKFSVHRLDLPTLYSVSAKTPEESCAQVFREARRTVPSIVYMPHIGDWWDAVSDTVRATFLTLLQD----------------------IPSFSPI-FLLSTSETLYSELPEEVRCIFRIQYEEVFIIHRPNQEDRTKFFQDII------LNQAALPPPRNKKAALEVLPLA-LPPQIQQLSEAEKQRMEDHEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIEEVSDYLEVIRKPMDLSTIMMKIDKHRYLTALDFLQDIDLICSNALEYNPDKEPGDKIIRHRACTLKDTAHAIIAAELDPEFNKHCEEIKETRTKRGRY 975          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Xenopus
Match: ATAD2B (ATPase family, AAA domain containing 2B [Source:NCBI gene;Acc:100496692])

HSP 1 Score: 542.347 bits (1396), Expect = 2.617e-171
Identity = 317/776 (40.85%), Postives = 453/776 (58.38%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSF-PLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFS------------------------------SLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKP--KTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQ 3063
            RFE+RK +S+ +AR+   P+NL   +L   +  +R    A+ AD++PM++DRS+ F  +GG  ++I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++  KL+L+++ + +   DF  A+K I P+++R+   P HS  P  I+ LL + +      + K F    F  +N  +      L DC  ++++  F                               + ++PRLL++G         L   + H +   ++   D   L   +  + EE    +FREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    +C        +  I  P+   R  +F +++ L+   L    +  + L  A EVL  A + P  + LS  E +++E  E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T  +F  D+ LI +NAL YNP +    K IR  A    D A  I      PEF++  ++I E R  R     +K+
Sbjct:  225 RFERRKSKSMAKARNRCLPMNLRAEDLASGILRERVKVGASLADVDPMSLDRSVRFDSVGGLSEHIYALKEMVVFPLLYPEIFEKFRIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYVMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDQKARKHILQIHTRDWNPKLSDSFLEELAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSQKLQLDISSVVLGAHDFYHAMKNIVPASQRAVMSPGHSLSP-VIRPLLERTFSDILRVLHKVFPHAEFSQNNKKDDAASLLLDDCEDENTLSIFDVSCASGSPKKQPAALHKPFLHFTMSACYQPTSYRPRLLLSGEPGSGQTSHLAPAVLHTLEKFSVHRLDLPTLYSVSAKTPEESCAQVFREARRTVPSIVYMPHIGDWWDAVSDTVRATFLTLLQD----------------------IPSFSPI-FLLSTSETLYSELPEEVRCIFRIQYEEVFIIHRPNQEDRTKFFQDII-LNQAALPPPRNKKAALR-ALEVLPLA-LPPQIQQLSEAEKQRMEDHEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIEEVSDYLEVIRKPMDLSTIMMKIDKHRYLTALDFLQDIDLICSNALEYNPDKEPGDKIIRHRACTLKDTAHAIIAAELDPEFNKHCEEIKETRTKRGRQLNIKR 972          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Xenopus
Match: ATAD2B (ATPase family, AAA domain containing 2B [Source:NCBI gene;Acc:100496692])

HSP 1 Score: 546.584 bits (1407), Expect = 4.649e-171
Identity = 320/777 (41.18%), Postives = 453/777 (58.30%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSF-PLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCH-------WDSSIQSFS-----------------------SLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKP--KTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQM 3066
            RFE+RK +S+ +AR+   P+NL   +L   +  +R    A+ AD++PM++DRS+ F  +GG  ++I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++  KL+L+++ + +   DF  A+K I P+++R+   P HS  P  I+ LL + +      + K F    F  +N  +      L DC        +D S  S S                       + ++PRLL++G         L   + H +   ++   D   L   +  + EE    +FREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    +C        +  I  P+   R  +F +++ L+   L    +  + L  A EVL  A + P  + LS  E +++E  E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T  +F  D+ LI +NAL YNP +    K IR  A    D A  I      PEF++  ++I E R  R      +Q+
Sbjct:  314 RFERRKSKSMAKARNRCLPMNLRAEDLASGILRERVKVGASLADVDPMSLDRSVRFDSVGGLSEHIYALKEMVVFPLLYPEIFEKFRIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYVMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDQKARKHILQIHTRDWNPKLSDSFLEELAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSQKLQLDISSVVLGAHDFYHAMKNIVPASQRAVMSPGHSLSP-VIRPLLERTFSDILRVLHKVFPHAEFSQNNKKDDAASLLLDDCEDENTLSIFDVSCASGSPKKQPAALHKPFLHFTMSACYQPTSYRPRLLLSGEPGSGQTSHLAPAVLHTLEKFSVHRLDLPTLYSVSAKTPEESCAQVFREARRTVPSIVYMPHIGDWWDAVSDTVRATFLTLLQD----------------------IPSFSPI-FLLSTSETLYSELPEEVRCIFRIQYEEVFIIHRPNQEDRTKFFQDII-LNQAALPPPRNKKAALR-ALEVLPLA-LPPQIQQLSEAEKQRMEDHEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIEEVSDYLEVIRKPMDLSTIMMKIDKHRYLTALDFLQDIDLICSNALEYNPDKEPGDKIIRHRACTLKDTAHAIIAAELDPEFNKHCEEIKETRTKRGLLASTEQL 1062          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Xenopus
Match: tomm22 (translocase of outer mitochondrial membrane 22 homolog [Source:Xenbase;Acc:XB-GENE-951173])

HSP 1 Score: 530.406 bits (1365), Expect = 4.611e-170
Identity = 315/760 (41.45%), Postives = 456/760 (60.00%), Query Frame = 1
Query:  862 EIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF----QGIVFPSDNPL-NAKLDCDLLD-------------------------CHWDSSIQSFSSLFKPRLLVTGFAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV--SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            E  FE+R  +S  +A S   P+NL +++LK  +  DR    A+ AD++PM ID ++ FS +GG  K+I +LKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS+ +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R+DI++IHT++W P+ SD  +  ++    G+ GADIK +  EA LC+LRRRYPQIY+   KL+L+++ I +   DF  A++ I P+++R+       +   I+ LL    C   + +TK F    +GI     + L N  LD DLL                               S  +  + ++PRLL+ G       + +F       + + D   L      S EE    +FREA +T+ SI+++PHI + + +++ + +   + +++S                  S S I   +  + D+ +      EL       + ++  P+  +R  +F +L+    +  P+ K       +  A EVL  A   +P+TLS++EL++LE +E+  LR+ R+ LR +   LA D++F VF  PVD  EVPDY ++I+ P+DLST+  K+DL+ Y+T  E+  D+ LI +NAL YNP ++   + IR  A    D    I ++    EF+++ ++I E+R  R 
Sbjct:  109 EQHFERRLNRSRNKAISRCLPLNLQRDDLK-GIQKDRMKIGASLADVDPMQIDATVRFSSVGGLSKHISSLKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSIGDR-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDQEARKDILKIHTKEWNPKPSDLFLDELSEKCVGYCGADIKSVCAEAALCSLRRRYPQIYTTTEKLQLDVDSIKITAKDFITAMQKIVPASQRAVISPGQALSPIIQPLLQNTLCKVLKALTKIFPHALEGIKKEKQSELSNHLLDEDLLYSDDEGLSVFDNGLPNKTPNKPNRPFLQLHMSAHNHPTSYRPRLLLAGKPGHGQGTHLF------TVYTADLAVLFGVGATSPEETCAQLFREAKRTAPSILYIPHIHLWWETVSDTLKATFVTLLKS----------------IPSFSPILLLATCDVDHYKLPHELQELFVEEYGEVFHVLLPNKEERRVFFEDLIINQAAKAPVSK----KKAVLQALEVLPVAPPPEPRTLSAEELKQLEEQEESTLRELRLFLRDVSHRLAIDKRFRVFTKPVDPEEVPDYVTVIAQPMDLSTVISKIDLHKYHTVKEYLKDIDLICSNALEYNPDKDPGDRLIRHRACTLKDATYAIIKEELDEEFEKLCEEIQESRKKRG 840          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Xenopus
Match: ATAD2B (ATPase family, AAA domain containing 2B [Source:NCBI gene;Acc:100496692])

HSP 1 Score: 525.783 bits (1353), Expect = 1.454e-169
Identity = 307/730 (42.05%), Postives = 434/730 (59.45%), Query Frame = 1
Query:  922 PINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSF-PLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLD----------CHWDSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKT--LSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNR 3039
            P+NL   +L   +  +R    A+ AD++PM++DRS+ F  +GG  ++I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++  KL+L+++ + +   DF  A+K I P+++R+   P HS  P  I+ LL + +      + K F    F  +N  +  L    +            H+  S     + ++PRLL++G         L   + H +   ++   D   L   +  + EE    +FREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    +C        +  I  P+   R  +F +++ L+   L    +  + L  A EVL  A + P+   LS  E +++E  E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T  +F  D+ LI +NAL YNP +    K IR  A    D A  I      PEF++  ++I E R  R
Sbjct:   50 PMNLRAEDLASGILRERVKVGASLADVDPMSLDRSVRFDSVGGLSEHIYALKEMVVFPLLYPEIFEKFRIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYVMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDQKARKHILQIHTRDWNPKLSDSFLEELAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSQKLQLDISSVVLGAHDFYHAMKNIVPASQRAVMSPGHSLSP-VIRPLLERTFSDILRVLHKVFPHAEFSQNNKKDGGLFSFSVFLSSSALHKPFLHFTMSACYQPTSYRPRLLLSGEPGSGQTSHLAPAVLHTLEKFSVHRLDLPTLYSVSAKTPEESCAQVFREARRTVPSIVYMPHIGDWWDAVSDTVRATFLTLLQD----------------------IPSFSPI-FLLSTSETLYSELPEEVRCIFRIQYEEVFIIHRPNQEDRTKFFQDII-LNQAALPPPRNKKAALR-ALEVLPLA-LPPQIQQLSEAEKQRMEDHEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIEEVSDYLEVIRKPMDLSTIMMKIDKHRYLTALDFLQDIDLICSNALEYNPDKEPGDKIIRHRACTLKDTAHAIIAAELDPEFNKHCEEIKETRTKR 751          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Mouse
Match: Atad2b (ATPase family, AAA domain containing 2B [Source:MGI Symbol;Acc:MGI:2444798])

HSP 1 Score: 562.377 bits (1448), Expect = 9.242e-177
Identity = 332/806 (41.19%), Postives = 463/806 (57.44%), Query Frame = 1
Query:  799 RKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLD-------------------------CHWDSSIQSFSSL----------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELV--SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQMV 3069
            R+  +  K+     SD   +DE RFE+RK +S+ RAR+   P+N    +L   +  +R    A+ AD++PM ID+S+ F  IGG   +I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++R R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++ +KL+L++  I +   DF  A++ I P+++R+       +   I+ LL + +      + K F       +    + L+C  L+                         C  DS   +F  L          ++PRLL++G         L   + H +   ++   D   L   +  + EE    IFREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    KC        ++ IQ P    R  +F EL+    S+ P  +    ++ L  A EVL  A    P+ LS  E  ++E +E+  LR+ R+ LR +   LA D++FN+F  PVD+ EV DY  +I  P+DLST+  K+D +NY T  +F  D+ LI +NAL YNP ++   K IR  A    D A  I      PEF+++ ++I EAR+ R      +Q+ 
Sbjct:  320 RRSHIRRKKHAIHSSDTTSSDEERFERRKSKSMARARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQRARKHILQIHTRDWNPKLSDAFLGELAEKCVGYCGADIKALCTEAALTALRRRYPQIYASSHKLQLDVTSIVLSAHDFYHAMQNIVPASQRAVMSSGQALSPIIRPLLERSFNNILAVLQKIFPHAETSQNFVAGSDLNCPSLEISSDYEETSIPEVKSSGKCFLGKKLCSKDSQGSTFVHLNFNMAFGPTSYRPRLLLSGERGSGQTSHLAPALLHTLERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWWDAVSDTVRATFLTLLQD----------------------IPSFSPI-FLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPIEEDRRKFFQELILHQASMAPPRR---KHTALR-AMEVLPLALPSPPRQLSESEKNRMEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLQDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKRGLSVTAEQIT 1097          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Mouse
Match: Atad2 (ATPase family, AAA domain containing 2 [Source:MGI Symbol;Acc:MGI:1917722])

HSP 1 Score: 546.969 bits (1408), Expect = 3.222e-175
Identity = 312/760 (41.05%), Postives = 446/760 (58.68%), Query Frame = 1
Query:  871 FEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFD-SICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVL-KEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            FE+R  ++  RA +   P+N  K+E++  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRP+IIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+ A++ IRP+++R+       +   +K LL        + + K F  +   ++  LN+ + C  L+     S     S+                          F+PRLL+ G         L   + H +    + + D  +  GI+   S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ + S    P L + T     +     +      ++  I                  N+Q PD  +R  +F +L+   + KP    +     +  A EVL      +P+ L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:   27 FERRTKRNRNRAINRCLPLNFRKDEIR-GIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSRGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWNPKPVDMFLEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDALQKVFPHVEVGTNKSLNSDVSCPFLESDLAYSDDDTPSVYENGLSQKENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKFTVYTLDIPVLFGISTT-SPEEACSQMIREAKRTAPSIVYVPHIHLWWEIVGPTLKATFTTLLQTIPS--FAPVLLLATSEKPYSALPEEVQELFTHDYGEI-----------------FNVQLPDKEERTKFFEDLILKQASKP---PVSQKKAVLQALEVLPVAPPPEPRPLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 761          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Mouse
Match: Atad2 (ATPase family, AAA domain containing 2 [Source:MGI Symbol;Acc:MGI:1917722])

HSP 1 Score: 546.969 bits (1408), Expect = 3.222e-175
Identity = 312/760 (41.05%), Postives = 446/760 (58.68%), Query Frame = 1
Query:  871 FEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFD-SICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVL-KEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            FE+R  ++  RA +   P+N  K+E++  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRP+IIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+ A++ IRP+++R+       +   +K LL        + + K F  +   ++  LN+ + C  L+     S     S+                          F+PRLL+ G         L   + H +    + + D  +  GI+   S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ + S    P L + T     +     +      ++  I                  N+Q PD  +R  +F +L+   + KP    +     +  A EVL      +P+ L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:   27 FERRTKRNRNRAINRCLPLNFRKDEIR-GIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSRGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWNPKPVDMFLEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDALQKVFPHVEVGTNKSLNSDVSCPFLESDLAYSDDDTPSVYENGLSQKENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKFTVYTLDIPVLFGISTT-SPEEACSQMIREAKRTAPSIVYVPHIHLWWEIVGPTLKATFTTLLQTIPS--FAPVLLLATSEKPYSALPEEVQELFTHDYGEI-----------------FNVQLPDKEERTKFFEDLILKQASKP---PVSQKKAVLQALEVLPVAPPPEPRPLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 761          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Mouse
Match: Atad2 (ATPase family, AAA domain containing 2 [Source:MGI Symbol;Acc:MGI:1917722])

HSP 1 Score: 550.436 bits (1417), Expect = 4.437e-173
Identity = 312/760 (41.05%), Postives = 446/760 (58.68%), Query Frame = 1
Query:  871 FEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFD-SICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVL-KEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            FE+R  ++  RA +   P+N  K+E++  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRP+IIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+ A++ IRP+++R+       +   +K LL        + + K F  +   ++  LN+ + C  L+     S     S+                          F+PRLL+ G         L   + H +    + + D  +  GI+   S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ + S    P L + T     +     +      ++  I                  N+Q PD  +R  +F +L+   + KP    +     +  A EVL      +P+ L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:  351 FERRTKRNRNRAINRCLPLNFRKDEIR-GIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSRGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWNPKPVDMFLEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDALQKVFPHVEVGTNKSLNSDVSCPFLESDLAYSDDDTPSVYENGLSQKENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKFTVYTLDIPVLFGIST-TSPEEACSQMIREAKRTAPSIVYVPHIHLWWEIVGPTLKATFTTLLQTIPS--FAPVLLLATSEKPYSALPEEVQELFTHDYGEI-----------------FNVQLPDKEERTKFFEDLILKQASKP---PVSQKKAVLQALEVLPVAPPPEPRPLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 1085          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Mouse
Match: Atad2 (ATPase family, AAA domain containing 2 [Source:MGI Symbol;Acc:MGI:1917722])

HSP 1 Score: 550.436 bits (1417), Expect = 4.437e-173
Identity = 312/760 (41.05%), Postives = 446/760 (58.68%), Query Frame = 1
Query:  871 FEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFD-SICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVL-KEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            FE+R  ++  RA +   P+N  K+E++  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRP+IIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+ A++ IRP+++R+       +   +K LL        + + K F  +   ++  LN+ + C  L+     S     S+                          F+PRLL+ G         L   + H +    + + D  +  GI+   S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ + S    P L + T     +     +      ++  I                  N+Q PD  +R  +F +L+   + KP    +     +  A EVL      +P+ L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:  351 FERRTKRNRNRAINRCLPLNFRKDEIR-GIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSRGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWNPKPVDMFLEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDALQKVFPHVEVGTNKSLNSDVSCPFLESDLAYSDDDTPSVYENGLSQKENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKFTVYTLDIPVLFGIST-TSPEEACSQMIREAKRTAPSIVYVPHIHLWWEIVGPTLKATFTTLLQTIPS--FAPVLLLATSEKPYSALPEEVQELFTHDYGEI-----------------FNVQLPDKEERTKFFEDLILKQASKP---PVSQKKAVLQALEVLPVAPPPEPRPLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 1085          
BLAST of ATPase family AAA domain containing 2B vs. UniProt/SwissProt
Match: sp|Q9ULI0|ATD2B_HUMAN (ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B PE=1 SV=3)

HSP 1 Score: 559.681 bits (1441), Expect = 5.961e-175
Identity = 328/795 (41.26%), Postives = 459/795 (57.74%), Query Frame = 1
Query:  799 RKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF--------------QGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL-------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELV--SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            R+  +  K+     SD   +DE RFE+RK +S+ RAR+   P+N    +L   +  +R    A+ AD++PM ID+S+ F  IGG   +I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++ +KL+L+++ I +   DF  A++ I P+++R+       +   I+ LL + +      + K F              + ++       NA L     +CH  S  +  SS                    ++PRLL++G         L   + H +   ++   D   L   +  + EE    IFREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    KC        ++ IQ P    R  +F EL+    S+ P  +   +   +    EVL  A    P+ LS  E  ++E +E+  LR+ R+ LR +   LA D++FN+F  PVD+ EV DY  +I  P+DLST+  K+D +NY T  +F  D+ LI +NAL YNP ++   K IR  A    D A  I      PEF+++ ++I EAR+ R 
Sbjct:  321 RRSHIRRKKHAIHSSDTTSSDEERFERRKSKSMARARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQKARKHILQIHTRDWNPKLSDAFLGELAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSHKLQLDVSSIVLSAQDFYHAMQNIVPASQRAVMSSGHALSPIIRPLLERSFNNILAVLQKVFPHAEISQSDKKEDIETLILEDSEDENA-LSIFETNCHSGSPKKQSSSAAIHKPYLHFTMSPYHQPTSYRPRLLLSGERGSGQTSHLAPALLHTLERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWWEAVSETVRATFLTLLQD----------------------IPSFSPI-FLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPIEEDRRKFFQELILNQASMAPPRRKHAALCAM----EVLPLALPSPPRQLSESEKSRMEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKRG 1086          
BLAST of ATPase family AAA domain containing 2B vs. UniProt/SwissProt
Match: sp|Q8CDM1|ATAD2_MOUSE (ATPase family AAA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Atad2 PE=1 SV=1)

HSP 1 Score: 546.969 bits (1408), Expect = 2.254e-174
Identity = 312/760 (41.05%), Postives = 446/760 (58.68%), Query Frame = 1
Query:  871 FEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFD-SICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVL-KEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            FE+R  ++  RA +   P+N  K+E++  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRP+IIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+ A++ IRP+++R+       +   +K LL        + + K F  +   ++  LN+ + C  L+     S     S+                          F+PRLL+ G         L   + H +    + + D  +  GI+   S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ + S    P L + T     +     +      ++  I                  N+Q PD  +R  +F +L+   + KP    +     +  A EVL      +P+ L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:   27 FERRTKRNRNRAINRCLPLNFRKDEIR-GIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSRGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWNPKPVDMFLEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDALQKVFPHVEVGTNKSLNSDVSCPFLESDLAYSDDDTPSVYENGLSQKENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKFTVYTLDIPVLFGISTT-SPEEACSQMIREAKRTAPSIVYVPHIHLWWEIVGPTLKATFTTLLQTIPS--FAPVLLLATSEKPYSALPEEVQELFTHDYGEI-----------------FNVQLPDKEERTKFFEDLILKQASKP---PVSQKKAVLQALEVLPVAPPPEPRPLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 761          
BLAST of ATPase family AAA domain containing 2B vs. UniProt/SwissProt
Match: sp|Q5RDX4|ATAD2_PONAB (ATPase family AAA domain-containing protein 2 OS=Pongo abelii OX=9601 GN=ATAD2 PE=2 SV=1)

HSP 1 Score: 547.354 bits (1409), Expect = 5.769e-174
Identity = 313/748 (41.84%), Postives = 443/748 (59.22%), Query Frame = 1
Query:  922 PINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            P+N  K+ELK  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+DAIDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+VA++ + P+++R+       +   +K LL        E + + F    F ++  L++ + C LL+     S     S+                                F+PR+L+ G         L   + H +    + + D   L   +  S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ +      P      +L  +  S+S +        + +Q   I  + G+ F     N+Q P   +R  +F +L+   + KP    I     +  A EVL  A   +P++L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:  220 PLNFRKDELK-GIYKDRMKIGASLADVDPMQLDSSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDAIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPLDTFLEELAENCVGYRGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSATSPEETCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNI------PSFAPVLLLATSDKSHSALP-------EEVQELFI-RDYGEIF-----NVQLPGKEERTKFFEDLILKQAAKP---PISKKKAVLQALEVLPVAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 943          
BLAST of ATPase family AAA domain containing 2B vs. UniProt/SwissProt
Match: sp|Q6PL18|ATAD2_HUMAN (ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 5.019e-172
Identity = 313/748 (41.84%), Postives = 443/748 (59.22%), Query Frame = 1
Query:  922 PINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSL--------------------------------FKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSL--TLSGQ-NLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            P+N  K+ELK  ++ DR    A+ AD++PM +D S+ F  +GG   +I ALKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP++  R++I++IHTRDW P+  D  +  +A    G+ GADIK +  EA LCALRRRYPQIY+   KL+L+L+ I +   DF+VA++ + P+++R+       +   +K LL        E + + F    F ++  L++ + C LL+     S     S+                                F+PR+L+ G         L   + H +    + + D   L   +  S EE    + REA +T+ SIV++PHI + +  +  TL      LLQ + S    P L +           +  D   +   + +Q   I  + G+ F     N+Q PD  +R  +F +L+   + KP    I     +  A EVL  A   +P++L+++E+++LE +E+   R+ R+ LR +   LA D++F VF  PVD  EVPDY ++I  P+DLS++  K+DL+ Y T  ++  D+ LI +NAL YNP R+   + IR  A    D A  I ++    +F+++ ++I E+R  R 
Sbjct:  389 PLNFRKDELK-GIYKDRMKIGASLADVDPMQLDSSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEETCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPS--FAPVLLL-----------ATSDKPHSALPEEVQELFIR-DYGEIF-----NVQLPDKEERTKFFEDLILKQAAKP---PISKKKAVLQALEVLPVAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRG 1112          
BLAST of ATPase family AAA domain containing 2B vs. UniProt/SwissProt
Match: sp|A8X0L9|TBP7_CAEBR (Tat-binding homolog 7 OS=Caenorhabditis briggsae OX=6238 GN=lex-1 PE=3 SV=2)

HSP 1 Score: 429.483 bits (1103), Expect = 3.477e-128
Identity = 284/720 (39.44%), Postives = 399/720 (55.42%), Query Frame = 1
Query:  898 QRARSELNPINLSKNELK------MDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDW---KPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTI------------RPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVT-------GFAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKS---IVFLPHIDITFHSLTLSGQNLLLQMVRSH-NLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNP-ADEVLKEAEMKP-KTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFND 2955
            +R R    PIN+++ EL+      MD     +  +   +DI+PM++D S+ F  +GG   +IQ+LKE V+ P++YPEVF K  I+PP+G++FYGPPG+GKTL+ARAL NEC    N K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS +QDQIH+SIVSTLL+L+DGLD RGE++VIGATNR+D++DPALRRPGRFDRE  F LP+   RR I+ IHT  W   KP  + E +  IA  T G+ GAD+K L  E+ L  LR RYP IY    +L+L++  I + E+ F  A++ I            RP +ER+S  L   + + I L + Q Y        +C +  +  +   L   +           +++   ++   RLL+        G     ++  I  ++  + + S  S+   + +G   EE   +  + A + S +   I+ LP ID     + +S Q++L+  + S     P LF+           S +D  S+ E     +T+++        +N I++       R  YF E V   ++   K  D      P AD+   EA  KP + L+  E  +L      + R+ RM  +  LS L +DR+F  F+ PVD  E  DYY II  PI +  + +K++   YN  D+F  DL LI +NAL YNP      K IR+ A  F D
Sbjct:  354 ERERGRFMPINMTEKELQSAQHILMDRMRKTDAGQGA-SDIDPMSVDSSVGFDQVGGLSHHIQSLKEVVLFPMLYPEVFAKFKINPPKGVVFYGPPGTGKTLVARALANECRRGAN-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYAMRPSIIFFDEIDGLAPVRSSKQDQIHASIVSTLLALMDGLDGRGEVVVIGATNRLDSLDPALRRPGRFDRELRFSLPDLNARRHILDIHTSKWEENKP--TPETLDGIAEKTSGYCGADLKFLCTESVLIGLRSRYPHIYMCSERLKLDITTIKITEEHFGHAMRRITPASRRDLTIPSRPLDERTSILLGDIVKNLISLRIPQGY--------RCVENAMATASTELEQVV----------RALEPNLTVPAIRLLLCGSPSLSDGGQTSYVLPAILAKLDHLPVFSL-SVSSLLTDG-RPEEAFSNAVQSAMRASATGPCIMLLPSIDEWIKVIPVSVQHMLITCLESMTGFTPILFL-----------STLD--SSFEDAPEYATEVFR------HANCISLNPSRRSVRKRYF-EFVIDGVRRKPKVFDPTIYEMPQADDDSPEA--KPSRKLNDDETRELLKMYTALQRQMRMFFKERLSRLIRDRRFVEFVEPVDPEEAEDYYEIIETPICMQDIMEKLNKCEYNHADKFIADLVLIQSNALEYNPSNTKDGKLIRQMANTFRD 1027          
BLAST of ATPase family AAA domain containing 2B vs. TrEMBL
Match: A0A4W3HZQ9 (Bromo domain-containing protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 553.518 bits (1425), Expect = 6.574e-177
Identity = 316/741 (42.65%), Postives = 448/741 (60.46%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFP-SDNPLNAKLDCDLLD-CHWDSS------IQSFSS-----LFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV-SLSIKPLDKSIDSNSNLNPADEVLKEAE-MKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEAR 3030
            RFE+RK +S+ RAR+   P+N+   +L   +  +R    A+ AD++PM ID S+ F  +GG  ++IQALKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NEC   +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI++IGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I +IHTRDW P+L    +  +A    G+ GADIK L  EA L ALRRRYPQIY +  KL+L+++ I +   DF +A++ I P+++R+       + H IK LL     +F E +   ++  +FP ++   N   D    D C W SS      IQ  S+       +PRLL+ G        QL   + H +   ++   D   L   +  + EE    +FREA +T  SI+++PHI   + +++ + +   + +++   + +P L + T           I     V++  I                 I +Q P   +R  +F +L+ + + KP  +   +      A EVL+ A+   PK LS +E +++E +E+  LR+ R+ LR I   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T   F  D+ LI +NAL YNP ++   + IR  A    D +  I      PEF+++ +DI E+R
Sbjct:   30 RFERRKSKSMARARNRCLPMNIRAEDLASGILRERVKVGASLADVDPMNIDTSVWFDSVGGLSQHIQALKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECGQGDK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVIIGATNRLDSIDPALRRPGRFDREFLFNLPDKKARKHIFQIHTRDWNPKLLQPFLEELAEKCVGYCGADIKALCTEAALFALRRRYPQIYESRQKLQLDVSSIVINAQDFYLAMQNIVPASQRAVCSPGQALSHIIKPLLEN---VFNEILIALYK--IFPHAEQTTNENKDGLYSDSCFWSSSHSAPSRIQLLSAHHQPTSHRPRLLLCGDKGCGQSSQLAPALLHSLERFSVHRLDLPALYSVSAKTPEESCAQVFREARRTVPSIIYMPHIREWWDAVSETVKATFMTLLQDIPSFSPILIMATSETAYAELPDEIKCIFAVDYGEI-----------------IVLQRPGEDERTRFFEDLILNQAAKPPPRKKKA------ALEVLQPAQPPTPKQLSEEEQKRMEEQEENTLRELRLFLRDITKRLATDKRFSIFSKPVDIEEVSDYLEVIKQPMDLSTIMTKIDNHQYETVQHFLTDISLICSNALEYNPDKDPGDRIIRHRACTLKDTSHAIVAAELDPEFNKLCEDIRESR 741          
BLAST of ATPase family AAA domain containing 2B vs. TrEMBL
Match: G3PFL0 (ATPase family AAA domain containing 2B OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 555.058 bits (1429), Expect = 1.204e-176
Identity = 314/770 (40.78%), Postives = 446/770 (57.92%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLP-XXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF--------------------QGIVFPSDN--PLNAKLDCDLLDCHWD-------------SSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQ---SNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEM-KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            RFE+RK +S+ RAR+   P+NL+  +L   +  DR    A+ AD++PM +D S+ F  +GG   +IQ+LKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGE++VIGATNR+D+IDPALRRPGRFDREF+F LP +++ R+ I+ IHTRDW P+L++  +  +A    G+ GADIK L  EA L ALRRRYPQIY +  KL L++  I +   DF  AI TI P+++R+  P    +   ++ LL   + L  + + + F                    +  ++  D+  PL+      LL C                SS     + ++PRL++ G         +   + H +  + +   D   L   +  + EE    +FREA ++  S+VF+PHI   + +++ + ++  L +++   + +P L + T                         +Q+  EL   FQ     ++ + AP    R ++F++L+ +        + S       +EVL  AE   P+ LS++E  +L  +E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST   K+D + Y    +F  D+ LI +NAL YNP ++   K IR  A    D A  IF     PEFDR+ ++I EAR  R 
Sbjct:  163 RFERRKGKSMTRARNRCLPMNLTSEDLTSGVLRDRAKVGASLADVDPMNLDSSVKFDQVGGLGNHIQSLKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDR-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNRLDSIDPALRRPGRFDREFLFNLPDKKKARKHILEIHTRDWNPKLAEPFVDELAEKCVGYCGADIKALCTEATLAALRRRYPQIYGSSVKLTLDVASIVLGPADFSKAIGTIVPASQRALAPPGRALSPALRPLLAGSFSLVLKALLRVFPHAQCADRDNAHGSGDNQLLEDDLYSDDDNEPLSTYQGSSLLSCAEGCKTFLLLTHRPLLSSALQRPTAYRPRLMLAGPPGSGQSSHVAPALLHHLDKLPVHRLDLPTLYSVSAKTPEESCAQVFREARRSVPSVVFMPHISEWWETVSDTVKSTFLTLLQDVPSFSPVLILATA--------------------ETHYSQLSEELRSMFQRSYGEVVTLSAPGEEDRKSFFSDLLLVQAARAPPRLRSTGR---CEEVLPAAEAPGPRVLSTEEQRRLAEQEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIDEVSDYLEVIRQPMDLSTAMTKIDTHQYLRVKDFLGDIDLICSNALEYNPDKDPGDKVIRHRACSLKDTAHAIFAAELDPEFDRMCEEIKEARRKRG 908          
BLAST of ATPase family AAA domain containing 2B vs. TrEMBL
Match: G5E7I7 (Bromo domain-containing protein OS=Meleagris gallopavo OX=9103 PE=4 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 2.773e-176
Identity = 335/818 (40.95%), Postives = 467/818 (57.09%), Query Frame = 1
Query:  733 KKSDWRDSLTSPIHNIFNDGKHRKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF-----------QGIV----------------------FPSDNP---LNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKP-KTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            ++S  R S      NI +  + +K  +HS  S+T  SDE+     RFE+RK +S+ RAR+   P+N    +L   +  +R    A+ AD++PM +D+S+ F  IGG   +I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY +  KL+L+++ + +   DF  A++ I P+++R+       +   I+ LL + +    E + K F           +GI                        PS +P    +A +    L  H+  S     + ++PRLL+TG         L   + H +   ++   D   L   +  + EE    IFREA +T  SIV++P I   + +++ + +   L +++                       I ++S + F    S  +++EL    KC        +  IQ P    R  +F  L+ L    +       + L  A EVL  A   P + LS  E +++E +E+  LR+ R+ LR +   LA D++FN+F  PVD+ EV DY  +I  P+DLST+  K+D +NY T  +F  D+ LI +NAL YNP ++   K IR  A    D A  I      PEF+++ ++I EAR  R 
Sbjct:   60 RRSHIRSSAQWQNPNILHLNRRKKHAIHS--SDTTSSDEE-----RFERRKSKSMARARNRCLPLNFRAEDLASGILRERVKVGASLADVDPMIVDKSVRFDSIGGLSHHILALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQKARKHILQIHTRDWNPKLSDPFLGELAEKCVGYCGADIKALCTEAALIALRRRYPQIYVSSQKLQLDVSSVVLSAQDFYHAMQNIVPASQRAVTSSGHALSPVIRPLLERTFADLLEVLHKVFPHAEFSQSDKSEGITDVPSLILDDSEDENASSIFETSCPSGSPKKQSSAAIHKPYL--HFTMSAYHQPTSYRPRLLLTGERGSGQTSHLAPALLHTLEKFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPQIGDWWEAVSETVRATFLTLLQD----------------------IPSFSPI-FLLSTSESMYSELPEEVKCIFRIQYEEVFYIQKPSEEDRLRFFRGLI-LDEAAMPPPRRKQAALR-AMEVLPLALPSPARELSEAEKQRMEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLTDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKMCEEIKEARRKRG 842          
BLAST of ATPase family AAA domain containing 2B vs. TrEMBL
Match: I3NDP9 (ATPase family AAA domain containing 2B OS=Ictidomys tridecemlineatus OX=43179 GN=ATAD2B PE=4 SV=2)

HSP 1 Score: 565.844 bits (1457), Expect = 6.483e-176
Identity = 325/773 (42.04%), Postives = 459/773 (59.38%), Query Frame = 1
Query:  799 RKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDC---HWDSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELG---KCF----QSNLINIQAPDFHQRYTYFNELV--SLSIKPLDKSIDSNSNLNPADEVLKEA-EMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQM 3066
            R+  +  K+     SD   +DE RFE+RK +S+ RAR+   P+N    +L   +  +R    A+ AD++PM ID+S+ F  IGG  ++I ALKE V+ PL+YPE+F+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LSD  +  +A    G+ GADIK L  EA L ALRRRYPQIY++ +KL+L+++ I +   DF  A++ I P+++R+       +   I+ LL + +      + K F        +     +    L C   ++ S     +S ++PRLL++G         L   + H +   ++   D   L   +  + EE    IFREA +T  SIV++PHI   + +++ + +   L +++                       I ++S + F    S  +++EL    KC        ++ IQ P    R  +F EL+    S+ P  +   +   +    EVL  A    P+ LS  E  ++E +E+  LR+ R+ LR +   LA D++FN+F  PVD+ EV DY  +I  P+DLST+  K+D +NY T  +F  D+ LI +NAL YNP ++   K IR  A    D A  I      PEF+++ ++I EAR+ R      +Q+
Sbjct:  321 RRSHIRRKKHAIHSSDTTSSDEERFERRKSKSMARARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSQHIHALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQKARKHILQIHTRDWNPKLSDAFLGELAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSHKLQLDVSSIVLSAQDFYHAMQNIVPASQRAVMSSGHALSPIIRPLLERSFNNILTVLQKVFPHAEISQSDRKEEGIVLKSLLCFYVYYRSPYHQPTS-YRPRLLLSGERGSGQTSHLAPALLHTLERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWWEAVSETVRATFLTLLQD----------------------IPSFSPI-FLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPVEEDRRKFFQELILNQASMPPPRRKHTALCAM----EVLPLALPSPPRQLSESEKNRMEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLQDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKRGLSVTAEQI 1064          
BLAST of ATPase family AAA domain containing 2B vs. TrEMBL
Match: A0A4Y2KMR3 (ATPase family AAA domain-containing protein 2B OS=Araneus ventricosus OX=182803 GN=ATAD2B PE=4 SV=1)

HSP 1 Score: 567.77 bits (1462), Expect = 1.129e-175
Identity = 326/773 (42.17%), Postives = 453/773 (58.60%), Query Frame = 1
Query:  856 NDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPS---------DNPLNAKLDCDLLD---CHW------------------------DSSIQSFSSLF-KPRLLVTGFAIE---QLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELV----SLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            +DE RFEKRK  S+ RAR+   P+N  +++L      DR     + ADI+PM+ID++++F  +GG  K+I++LKE ++ PL+YPEVF++  ISPPRG+LFYG PG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD+RGEI++IGATNR+DAIDPALRRPGRFDRE +F LP  + R  I+RI T+DW P LS+ +++ +A+ T G+ GAD+K L  EA L ALRRRYPQIY++  KL L++  I V+  DF  A+K ++PS +R S      +   +K LL        +K++K F  +   +             NA  D D  D   C +                         S + SF+ +  +P  L++G   +    L   + H    V I   D   L      + EE    IF EA +   S++FLPHI   + +L+ + +   L ++   +L+P L +            ++   S+V +  +   +I    G C    + +++ P   +R  +F++L+     L  KP+ K+          +E+ K      + L+  EL KL   E+  LR+ R+ LR IL+ LAKDR+F VF  PVD TEVPDY+ +I NP+DL TM  K+DL  Y T  +F +D+ L+  NAL YNP RN   K IR  A    D+A  +       EF+++ +DI +AR  R 
Sbjct:  317 DDERRFEKRKAMSMARARNRCLPLNFIEDDLSKGALRDRMKIGCSLADIDPMSIDKTVSFDHVGGLDKHIRSLKEMILFPLMYPEVFQRFKISPPRGVLFYGQPGTGKTLVARALANECSTGDK-RVAFFMRKGADCLSKWVGESERQLRLLFDQAYSMRPSIIFFDEIDGLAPVRSTRQDQIHSSIVSTLLALMDGLDNRGEIVIIGATNRLDAIDPALRRPGRFDRELLFPLPSYQAREKILRIITKDWIPPLSEALLSELAACTTGYCGADLKALCSEAALVALRRRYPQIYASKEKLLLDVETIQVQSVDFVNALKKMKPSVQRCSVVSSKPLSTVVKPLLEPVLHTISQKVSKIFPFLTLTASKFSGQVVNSGEKNASGDIDSDDSESCLYFDEVPKVNNTCLLSPKTRLRLSDIKSHLTSFAPIVHRPYFLLSGKEGQGQGSLAPALLHLFENVTIHRLDIPALYAVTTRAPEEACAQIFHEAQRNVPSVIFLPHIGYWWETLSETVRATFLSLL--QDLDPSLPL------------MLFATSDVIYYQL-PLKIQEIFGGC-ADQVFSMRNPTAEERRAFFSQLIKEIYKLPHKPVQKAT--------LEELPKAPPPACRQLTPAELNKLRQREEATLRELRLFLRDILTKLAKDRRFTVFSRPVDPTEVPDYHLVIKNPMDLETMMTKIDLQRYETVGQFLSDVDLVCQNALDYNPDRNPSDKIIRHRACSLKDVAHALVLTELDAEFEKMCQDIQKARRERG 1064          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Cavefish
Match: atad2b (ATPase family AAA domain containing 2B [Source:NCBI gene;Acc:103025295])

HSP 1 Score: 533.872 bits (1374), Expect = 1.756e-166
Identity = 314/776 (40.46%), Postives = 439/776 (56.57%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGI-------VFPSDNPL----------NAKLDCDLLDC------------------HWDSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQS----NLINIQAPDFHQRYTYFNELVSL-SIKPLDKSIDSNSNLNPADEVLKEAE-MKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKV 3057
            RFE+RK +S+ RAR+   P+NL   +L   +  DR    A+ AD++PM +D S+ F  +GG   +I++LKE V+ PL+YPEVF+K  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P L++  +  +A    G+ GADIK L  EA L ALRRRYPQIY +  + +L++  I +   DF  A+++I P+ +R+  P    +   ++ LL +      + + + F          V  +DN L          +      + D                   H+ +S     + ++PRLL+TG         L   + H +    +   D   L   +  + EE    +FREA ++  S+V++PHI   + +++ + ++  L +++   +  P L + T                          Q   E  KC  S     ++ +Q P    R  +F +L+ + + +P  +      +     EVL  AE   P+ LS  E  +LE +E+  LR+ R+ LR +   LA D++F +F  PVD+ EV DY  +I  P+DLST+  K+D Y Y T  +F  DL LI +NAL YNP ++   K IR  A    D A  +      PEFDR  K+I E+R  R    K 
Sbjct:  317 RFERRKSKSMTRARNRCLPMNLRAEDLASGVLRDRAKVGASLADVDPMNLDTSVKFDNVGGLADHIKSLKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDKKARKHILKIHTRDWSPGLAESFVDELAERCVGYCGADIKALCTEAALAALRRRYPQIYGSSQRYKLDVGSIELGPQDFGRALRSIVPAAQRALAPPGRALSCALQPLLERSLAHALDCLLRVFPHAQLQHKEHVHDTDNQLLEEDSYSEGEDGAGTQSIYDANPGSPKKSDSSTAYKPFLHFTTSAYQQPTSYRPRLLLTGPQGSGQSTHLAPALLHHLDKFTVHRLDLPTLYSVSAKTPEESCAQVFREAQRSMPSVVYMPHISDWWEAISDTVKSTFLTLLQDVPSFTPLLILATAESKY---------------------QQLPEEVKCIFSRSYGEVVCLQTPGEEDRRKFFTDLILVQAARPPPRRRKKVCDY----EVLPLAEDPGPRQLSPVEQRRLEEQEENTLRELRLFLRDVTKRLATDKRFQIFSKPVDIEEVSDYLEVIREPMDLSTIMTKIDTYKYITAKDFLKDLDLICSNALEYNPDKDPGDKIIRHRACSLKDTAHAMIASELDPEFDRTCKEIEESRRKRGKRTKT 1066          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Cavefish
Match: atad2 (ATPase family AAA domain containing 2 [Source:NCBI gene;Acc:103046236])

HSP 1 Score: 527.709 bits (1358), Expect = 2.026e-164
Identity = 317/771 (41.12%), Postives = 455/771 (59.01%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF----QGIVFPSDNPLNAKLDCDLLDCHWD---------------------------SSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNI---QSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEM-------KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            +FE R+ +S  R+ +   P+N  K +L + +  DR    A+ AD++PM ID+++ F  IGG  ++I ALKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDG+APVRS RQDQIHSSIVSTLL+L+DGLD RGE++VIGATNR+D+IDPALRRPGRFDREF+F LP+   R+DI++IHTR W PQ SD  +  +A    G+ GADIK +  EA LCALRRRYPQIY++  KL L++  I V+  DF  A++ I P+++R+       +   IK LL        + + K F    QG+    +N  +A +  DLL  H D                           +++Q  +S F+PRLL+ G         L   I H +    + + D   L   +  S EE    +F EA +T+ SI+++PH+   + +++ + +   L +++   + +P L + T                ++ +D++          E G+ F     N+  P   +R T+F +L+      L+++  + ++   A  VL+  E+        P+ LS QE +KLE +E+  LR+ R+ LR + + LA+D++F  F  PVD  EVPDY ++I  P+DLST+  K+DL+ Y T  +F +D+ LI  NAL YNP ++   + IR  A    D    I +D    +F++I  ++ E+R  R 
Sbjct:  362 KFEMRRSKSRNRSMNRCLPMNFLKEDL-LGVHKDRIKIGASLADVDPMQIDQTVRFDSIGGLGRHISALKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGIAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNRLDSIDPALRRPGRFDREFLFSLPDREARKDILKIHTRQWNPQPSDAFLEELADKCVGYCGADIKAVCAEAALCALRRRYPQIYASSQKLLLDVASINVEGRDFLSAMRKIVPASQRAVVSPARALTSVIKPLLTNTLNSALKALQKLFPHVEQGLKKKRENDGSAGVLDDLL--HSDDEGSYLCTSNPAQKNAGPAGSFLLLNRTALQQPTS-FRPRLLLCGRPGSGQSTHLAPAILHALEKFTVYTLDMAVLFGVSMTSPEEACAQLFCEAKRTAPSILYIPHMQRWWDTVSSALRATFLSLLQDIPSFSPILLLAT---------------CSLSYDDLCPEVQDLFLMEYGEVF-----NVPLPSEEERRTFFEDLI------LNQAAKAPASKREA--VLRAMEILPVAPPPAPRLLSEQEQQKLEQQEEDTLRELRLFLRDVTNRLAQDKRFKAFTKPVDTEEVPDYTTVIKQPMDLSTVLTKIDLHKYETVKDFLHDVDLIWKNALEYNPDKDPSDRLIRHRACTLKDTVHAIIKDELDEDFEKICIEVKESRSKRG 1099          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Cavefish
Match: atad2 (ATPase family AAA domain containing 2 [Source:NCBI gene;Acc:103046236])

HSP 1 Score: 527.709 bits (1358), Expect = 2.185e-164
Identity = 317/771 (41.12%), Postives = 455/771 (59.01%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF----QGIVFPSDNPLNAKLDCDLLDCHWD---------------------------SSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNI---QSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEM-------KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            +FE R+ +S  R+ +   P+N  K +L + +  DR    A+ AD++PM ID+++ F  IGG  ++I ALKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDG+APVRS RQDQIHSSIVSTLL+L+DGLD RGE++VIGATNR+D+IDPALRRPGRFDREF+F LP+   R+DI++IHTR W PQ SD  +  +A    G+ GADIK +  EA LCALRRRYPQIY++  KL L++  I V+  DF  A++ I P+++R+       +   IK LL        + + K F    QG+    +N  +A +  DLL  H D                           +++Q  +S F+PRLL+ G         L   I H +    + + D   L   +  S EE    +F EA +T+ SI+++PH+   + +++ + +   L +++   + +P L + T                ++ +D++          E G+ F     N+  P   +R T+F +L+      L+++  + ++   A  VL+  E+        P+ LS QE +KLE +E+  LR+ R+ LR + + LA+D++F  F  PVD  EVPDY ++I  P+DLST+  K+DL+ Y T  +F +D+ LI  NAL YNP ++   + IR  A    D    I +D    +F++I  ++ E+R  R 
Sbjct:  331 KFEMRRSKSRNRSMNRCLPMNFLKEDL-LGVHKDRIKIGASLADVDPMQIDQTVRFDSIGGLGRHISALKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGIAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNRLDSIDPALRRPGRFDREFLFSLPDREARKDILKIHTRQWNPQPSDAFLEELADKCVGYCGADIKAVCAEAALCALRRRYPQIYASSQKLLLDVASINVEGRDFLSAMRKIVPASQRAVVSPARALTSVIKPLLTNTLNSALKALQKLFPHVEQGLKKKRENDGSAGVLDDLL--HSDDEGSYLCTSNPAQKNAGPAGSFLLLNRTALQQPTS-FRPRLLLCGRPGSGQSTHLAPAILHALEKFTVYTLDMAVLFGVSMTSPEEACAQLFCEAKRTAPSILYIPHMQRWWDTVSSALRATFLSLLQDIPSFSPILLLAT---------------CSLSYDDLCPEVQDLFLMEYGEVF-----NVPLPSEEERRTFFEDLI------LNQAAKAPASKREA--VLRAMEILPVAPPPAPRLLSEQEQQKLEQQEEDTLRELRLFLRDVTNRLAQDKRFKAFTKPVDTEEVPDYTTVIKQPMDLSTVLTKIDLHKYETVKDFLHDVDLIWKNALEYNPDKDPSDRLIRHRACTLKDTVHAIIKDELDEDFEKICIEVKESRSKRG 1068          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Cavefish
Match: atad2 (ATPase family AAA domain containing 2 [Source:NCBI gene;Acc:103046236])

HSP 1 Score: 527.709 bits (1358), Expect = 2.958e-164
Identity = 317/771 (41.12%), Postives = 455/771 (59.01%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF----QGIVFPSDNPLNAKLDCDLLDCHWD---------------------------SSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNI---QSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEM-------KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            +FE R+ +S  R+ +   P+N  K +L + +  DR    A+ AD++PM ID+++ F  IGG  ++I ALKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS  +  K+AFFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDG+APVRS RQDQIHSSIVSTLL+L+DGLD RGE++VIGATNR+D+IDPALRRPGRFDREF+F LP+   R+DI++IHTR W PQ SD  +  +A    G+ GADIK +  EA LCALRRRYPQIY++  KL L++  I V+  DF  A++ I P+++R+       +   IK LL        + + K F    QG+    +N  +A +  DLL  H D                           +++Q  +S F+PRLL+ G         L   I H +    + + D   L   +  S EE    +F EA +T+ SI+++PH+   + +++ + +   L +++   + +P L + T                ++ +D++          E G+ F     N+  P   +R T+F +L+      L+++  + ++   A  VL+  E+        P+ LS QE +KLE +E+  LR+ R+ LR + + LA+D++F  F  PVD  EVPDY ++I  P+DLST+  K+DL+ Y T  +F +D+ LI  NAL YNP ++   + IR  A    D    I +D    +F++I  ++ E+R  R 
Sbjct:  370 KFEMRRSKSRNRSMNRCLPMNFLKEDL-LGVHKDRIKIGASLADVDPMQIDQTVRFDSIGGLGRHISALKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDK-KVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGIAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNRLDSIDPALRRPGRFDREFLFSLPDREARKDILKIHTRQWNPQPSDAFLEELADKCVGYCGADIKAVCAEAALCALRRRYPQIYASSQKLLLDVASINVEGRDFLSAMRKIVPASQRAVVSPARALTSVIKPLLTNTLNSALKALQKLFPHVEQGLKKKRENDGSAGVLDDLL--HSDDEGSYLCTSNPAQKNAGPAGSFLLLNRTALQQPTS-FRPRLLLCGRPGSGQSTHLAPAILHALEKFTVYTLDMAVLFGVSMTSPEEACAQLFCEAKRTAPSILYIPHMQRWWDTVSSALRATFLSLLQDIPSFSPILLLAT---------------CSLSYDDLCPEVQDLFLMEYGEVF-----NVPLPSEEERRTFFEDLI------LNQAAKAPASKREA--VLRAMEILPVAPPPAPRLLSEQEQQKLEQQEEDTLRELRLFLRDVTNRLAQDKRFKAFTKPVDTEEVPDYTTVIKQPMDLSTVLTKIDLHKYETVKDFLHDVDLIWKNALEYNPDKDPSDRLIRHRACTLKDTVHAIIKDELDEDFEKICIEVKESRSKRG 1107          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Cavefish
Match: SPATA5 (spermatogenesis associated 5 [Source:HGNC Symbol;Acc:HGNC:18119])

HSP 1 Score: 211.46 bits (537), Expect = 4.698e-56
Identity = 115/298 (38.59%), Postives = 181/298 (60.74%), Query Frame = 1
Query:  979 TRANFADIEPMAID-----RS-ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDR---GEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKL--ELNLNEIFVKEDDFKVAIKTIRPSNER 1839
            TR +F   +P   +     RS +T+SMIGG    + A++E++ LPL +PE+F+K GI PPRG+L YGPPG+GKT++ RA+ NE   +        +  G + +SK+ GE+E +LR +F +A + +P+IIF DE+D L P R   Q+++   +V++LL+L+DG+      G+++V+GATNR  A+DPALRRPGRFD+E    +P    R DI++   R    ++S E +  +A    G+ GAD+  +  EAGL ALRR    +  +   L     ++ + V   D ++A+K ++PS  R
Sbjct:  302 TRLSFTHSQPQTTEDQGQERSKVTYSMIGGLSAQLAAIRETIELPLKHPEIFRKYGIPPPRGVLLYGPPGTGKTMIGRAVANEVGAH------MTVINGPEIMSKFYGETEARLRQIFAEASQKQPAIIFIDELDALCPKREGAQNEVEKRVVASLLTLMDGIGSEGHSGQLLVLGATNRPHALDPALRRPGRFDKELEVGVPAAEGRMDILQKQLRSVPCEISTEELQELADAAHGYVGADLAAVCKEAGLHALRR----VLGSAPGLCDPEVMDRVKVTASDLRLAMKHVKPSAMR 589          

HSP 2 Score: 141.739 bits (356), Expect = 8.639e-34
Identity = 97/238 (40.76%), Postives = 133/238 (55.88%), Query Frame = 1
Query: 1009 MAID-RSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            +AID   + +S +GG +     LK++V  PL +PE F +LGI+PP+G+L YGPPG  KT++A+AL NE  LN      F   KG + LSK+VGESER +R +F +A  + PSI+FFDEID LA V   R D  HS I S L           +   +   N +    PAL RPGR DR     LP+   RR+I  +  R   P  S   +  + + T+ +SGA+I  +  EA L AL+
Sbjct:  591 VAIDVPKVRWSDVGGMEDVKLKLKQAVEWPLKHPEAFARLGIAPPKGVLLYGPPGCSKTMIAKALANESQLN------FLAIKGPELLSKYVGESERAVREVFRKARTVAPSIVFFDEIDALA-VERGRYDISHSFIHSLLF----------QNKPVSNVNTLHTNRPALMRPGRLDRIVYVPLPDSATRREIFSLQFRSM-PVHSSVHLDDLVTRTERYSGAEITAVCREAALFALQ 810          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Sea Lamprey
Match: atad2b (ATPase family AAA domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-110411-210])

HSP 1 Score: 528.094 bits (1359), Expect = 4.554e-172
Identity = 313/778 (40.23%), Postives = 454/778 (58.35%), Query Frame = 1
Query:  862 EIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCF-----------------QGIV--------------FPS---DNPLNAKLDCDLLD------CHWDSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQ---SNLINIQAPDFHQRYTYFNELV---SLSIKPLDKSIDSNSNLNPADEVLKEAEM-KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            E RF+KR  +S+ RAR+   P+NL   +L   +  +R    A+ AD++PM++D SI F  IGG  ++IQALKE ++ PL+YPE+F+K  I PPRG LF+GPPG+GKTL+ARAL NECS  +  ++AFFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREFMF LP+ + RR I+ IHT  W P LS+  +  +A    G+ GAD+K L  EA L ALRRRYPQIY+   +L ++ + + V   DF+ A+ T+ P+++R+     + +   ++ LL   + +  E++ + F                 QG++               PS   + PL      DL+        ++ SS+    S  +PRLL+ G         +   + H +  + +   D   L   +  + EE    +FREA +T+ S++F PHID  + ++         + VR+       F   +  +      ++   +    D +      AE+ + F+     ++ +Q P   +R T+F +L+   ++   P +K      ++  A EVL  A   +P+ LS++EL++LE +E   LR+ R+ LR + + LA D +F +F  PVD+ EV DY  ++  P+DLST+R K+D + Y T  +F +D+ LI +NAL YNP ++   + IR  A    D    I      PEF+++ ++IHE+R  R 
Sbjct:   26 EERFDKRMSKSMARARNRCLPMNLKAEDLASGVLRERTRVGASLADVDPMSMDSSIGFHSIGGLSRHIQALKEMIVFPLLYPEIFQKYSIQPPRGCLFHGPPGTGKTLVARALANECSRGDR-RMAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFMFNLPDVQARRQILEIHTCKWTPHLSNSFMDELAEKCVGYCGADVKALCTEAVLSALRRRYPQIYATSERLLIDPSSVSVATSDFQRAMDTVVPASQRAVVAPGAALGPVVRPLLATQFMVSLERLLRVFPHGRVVCCNNSGSSTAEQGLMSQMLFDDPYSDEEDAPSIFQNGPLPPNEKQDLVSMANRPFLNFSSSVLRKPSTHRPRLLLAGDPGSGQSSHIAPALIHSLEKLPVHKLDLPLLYGVSARTPEESCAQVFREARRTAPSVIFTPHIDEWWETVP--------EAVRA------TFKSLLYDVPPFMPVLLLATAETRHDAMP-----AEVQQLFRPRYGEVVMLQRPGGKERRTFFQDLLLNQAVRAPPTNK-----MSVLQALEVLPLAPCPEPRKLSAEELQRLEEQEQDTLRELRLFLRDVTNRLATDNRFRMFTKPVDIEEVSDYLDVVRQPMDLSTVRMKIDQHKYETTRQFLDDITLICSNALDYNPDKDPSDRMIRHRACAIKDTTYAIMASELDPEFEKLCEEIHESRTKRG 778          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Sea Lamprey
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 178.333 bits (451), Expect = 9.653e-49
Identity = 110/270 (40.74%), Postives = 162/270 (60.00%), Query Frame = 1
Query: 1030 TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVN--ECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSL---IDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTI 1821
            T+ MIGG  K I+ +KE + LP+ +PE+F+ LGI+ P+G+L YGPPG+GKTLLARA+ +  EC+        F    G++ + K++GE  R +R LF  A +  PSIIF DEID +   R        S +  T+L L   +DG +    I VI ATNRID +DPAL RPGR DR+  F  P E  R DI++IH+R  K  L+  + +  IA +  G SGA++KG+  EAG+ ALR R  +++      E+ + ++  K+ +  ++IK +
Sbjct:  151 TYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT--------FIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSR--KMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRER--RVHVTQEDFEMAVAKVMQKDSEKNMSIKKL 408          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Sea Lamprey
Match: nvl (nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-2871])

HSP 1 Score: 167.933 bits (424), Expect = 3.798e-44
Identity = 101/272 (37.13%), Postives = 155/272 (56.99%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDW-KPQLSDEM---ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPS 1830
            +T+  IG  +   + L  +++ P+ +PE+F+ LG++ P G+L  GPPG GKT+LA+A+ NE  LN      F   KG + L+ +VGESER +R +F +A    P +IFFDEID + P RS  +      +V+ LL+ +DGL+ R ++ ++ ATNR D +D A+ RPGR D+     LP   ER  I+R  TR   KP L  ++   + +    + GFSGAD++ L  EA + ALRR     +   ++      +I V   DF  A + ++PS
Sbjct:  255 VTWDDIGALEAIREELSLAILAPIRHPEMFQVLGLTSPAGILLAGPPGCGKTMLAKAIANESGLN------FISVKGPELLNMYVGESERAVRQVFQRARNSAPCVIFFDEIDAICPRRSDHESGASVRVVNQLLTEMDGLEARKQVFIMAATNRPDILDRAVLRPGRLDKTLYVGLPVMAERAAILRTLTRGGTKPPLEKDVDLNVIAGDGRSDGFSGADLQALTREAAIGALRR-----HLMADRWVKADTDIIVSRKDFDYAFEKVKPS 515          

HSP 2 Score: 110.538 bits (275), Expect = 2.464e-25
Identity = 79/243 (32.51%), Postives = 120/243 (49.38%), Query Frame = 1
Query: 1255 GADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEA------------------------------GLCALRRRYPQIYSNHNKLELN--------------LNEIFVKEDDFKVAIKTIRPSNERSSF 1848
            G + +S   GESE++LR LF  A +  P ++F DEID + P R +    +   +V+ LL+ +DGL   G ++ IGATNR DA+DPALRR GRFDRE    +P+E  R  I+ +  R  +  L +E     +A +T G+ GAD+  L  EA                              GL  LR + P  ++  ++LE                L+ +F++  DF+VA+  ++PS +R  F
Sbjct:   11 GPEVVSGVSGESEQKLRELFQVASESAPCVLFLDEIDAITPKREMASKDMERRLVAQLLTCMDGLHGGGAVLCIGATNRPDALDPALRRAGRFDREICLGIPDENARERILLVLCRGLR--LKEEFNFKRLARLTPGYVGADLMSLCREAAASAVNRALHAIDVAPTQNPAVEPDPAKAQGLETLRNQLP--FAKASELERALRWLRDPSPLPPEVLHSLFLETCDFEVALSCVQPSAKREGF 249          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 165.622 bits (418), Expect = 4.030e-44
Identity = 102/289 (35.29%), Postives = 160/289 (55.36%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDR------SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            ++Q  R +++ I+L    +  ++ N   VT  +F    A   P A+        ++T+  IGG +   + L+E V  P+ +PE F K G++P +G+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A +  P+++F DE+D +A  R         +   +++ +L+ +DG+     + +IGATNR D IDPA+ RPGR D+     LP+E+ R  I++ + R   P   D  I  ++  T GFSGAD+  +   A   A+R
Sbjct:   59 ALQAIRKKMDVIDLDDETIDAEIMNSLAVTMDDFRWALAQSNPSALREMVVEVPNVTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVRDVFDKARQASPTVLFLDELDSIAKARGGGVGDGGGAADRVINQILTEMDGMGVNKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRTAILKANLRK-SPIAKDVDIGYLSKTTNGFSGADLMEICQRACKLAIR 340          

HSP 2 Score: 49.2914 bits (116), Expect = 4.757e-6
Identity = 37/106 (34.91%), Postives = 58/106 (54.72%), Query Frame = 1
Query: 1525 GRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNER 1839
            GRFDRE    +P+   R +I++IHT++ K  + D  +  IA+ T G  GAD+  L  EA L A+R++   I  +   ++   +N + V  DDF+ A+    PS  R
Sbjct:    1 GRFDREVDIGIPDSTGRLEILQIHTKNMKLSV-DVDLEQIANQTHGHVGADLAALCSEAALQAIRKKMDVIDLDDETIDAEIMNSLAVTMDDFRWALAQSNPSALR 105          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001244.1 (pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 gene:ENSPMAG00000001115.1 transcript:ENSPMAT00000001244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 2.238e-43
Identity = 100/237 (42.19%), Postives = 139/237 (58.65%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRK-GADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLI---DGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRR 1725
            +T+S +GG K+ I+ L+E V  PL++PE F  LGI PP+G+L +GPPG+GKTL ARA+ N          A F+R  G++ + K+VGE  R +R LF+ A K    +IFFDEID +   R        + +  T+L LI   DG D RG I V+ ATNR D +DPAL RPGR DR+  F LP+   R  I +IH R    +  D     +A +    +GA+I+ +  EAG+ A+R R
Sbjct:  182 VTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTD-------ACFIRVIGSELVQKYVGEGARMVRELFEMARKA--CLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFGLPDLEGRTHIFKIHARSMSVE-RDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRAR 408          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Yeast
Match: YTA7 (Protein that localizes to chromatin; has a role in regulation of histone gene expression; has a bromodomain-like region that interacts with the N-terminal tail of histone H3, and an ATPase domain; relocalizes to the cytosol in response to hypoxia; potentially phosphorylated by Cdc28p [Source:SGD;Acc:S000003502])

HSP 1 Score: 371.703 bits (953), Expect = 9.217e-109
Identity = 205/459 (44.66%), Postives = 286/459 (62.31%), Query Frame = 1
Query:  991 FADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKI--------------TKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSF--------SSLFKPRLLVT---GFAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHS------LTLSG 2274
             AD++P+ +D ++ F  IGG   YI  LKE V LPL+YPE+++   I+PPRG+LF+GPPG+GKTL+ARAL   CS ++  K+ FFMRKGAD LSKWVGE+ERQLRLLF++A K +PSIIFFDEIDGLAPVRS +Q+QIH+SIVSTLL+L+DG+D+RG++IVIGATNR DA+DPALRRPGRFDREF F LP+ + R  I++I TR W   LS   I  +A +TKG+ GAD++ L  EA L +++R +PQIY +++KL ++ ++I VK  DF +A+K I PS+ RS+      +P  IK LL       K K+              T   Q  +   +     +           SS +S+        S + KPRLL+    G   + + + I + +   N+ + D   L   +  + E  +   F EA K   S+VF+P++DI  ++      L LSG
Sbjct:  398 IADLDPLGVDMNVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALAASCS-SDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLPDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQRSFPQIYRSNDKLLVDPSKIKVKVSDFMLALKKIVPSSARSTGSSPQPLPELIKPLLADQLNNLKNKLDYMLNIKDTTFQRNTSLLQNFIDYEEYSGEEEEHDKYGGNEDTSSFRSYEFFESMAESQICKPRLLINGPKGNGQQYVGAAILNYLEEFNVQNLDLASLVSESSRTIEAAVVQSFMEAKKRQPSVVFIPNLDIWINTIPENVILVLSG 855          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Yeast
Match: CDC48 (AAA ATPase; subunit of polyUb-selective segregase complex involved in ERAD, INM-associated degradation (INMAD), mitotic spindle disassembly, macroautophagy, PMN, ribosome-associated degradation, ribophagy, homotypic ER membrane fusion, SCF complex disassembly, cell wall integrity during heat stress, and telomerase regulation; mobilizes membrane-anchored transcription factors by regulated Ub/proteasome-dependent processing (RUP); human ortholog VCP complements a cdc48 mutant [Source:SGD;Acc:S000002284])

HSP 1 Score: 207.223 bits (526), Expect = 1.232e-55
Identity = 114/276 (41.30%), Postives = 174/276 (63.04%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSSF 1848
            + +  IGG +K +  ++E V LPL +P++FK +GI PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R     ++   +VS LL+L+DG+  R  ++VI ATNR ++IDPALRR GRFDRE    +P+   R +++RIHT++ K  L+D++ + ++A+ T G+ GADI  L  EA +  +R +   I  + ++++   L+ + V  D+F+ A+    PS  R + 
Sbjct:  211 VGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGA------FFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMK--LADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFRFALGNSNPSALRETV 478          

HSP 2 Score: 179.489 bits (454), Expect = 1.126e-46
Identity = 106/291 (36.43%), Postives = 169/291 (58.08%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSITFSM------IGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRD--WKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            ++Q+ R +++ I+L ++E+  ++ +   VT  NF     +  P A+  ++  S+      +GG  +  + LKE+V  P+++P+ + K G+SP +G+LFYGPPG+GKTLLA+A+  E S N      F   KG + LS W GESE  +R +FD+A    P+++F DE+D +A  R         +   +V+ LL+ +DG++ +  + VIGATNR D IDPA+ RPGR D+     LP+E  R  I+    R    +P L    +T+IA  T+GFSGAD+  +V  A   A++
Sbjct:  429 AMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSAN------FISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDENARLSILNAQLRKTPLEPGLE---LTAIAKATQGFSGADLLYIVQRAAKYAIK 710          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Yeast
Match: RPT2 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for normal peptide hydrolysis by the core 20S particle; N-myristoylation of Rpt2p at Gly2 is involved in regulating the proper intracellular distribution of proteasome activity by controlling the nuclear localization of the 26S proteasome [Source:SGD;Acc:S000002165])

HSP 1 Score: 183.726 bits (465), Expect = 1.464e-50
Identity = 110/276 (39.86%), Postives = 167/276 (60.51%), Query Frame = 1
Query: 1009 MAIDRSIT--FSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMR-KGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSL---IDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSN----------HNKLELNLNEIFV 1785
            M +D+S T  +S IGG +  IQ +KESV LPL +PE+++++GI PP+G++ YG PG+GKTLLA+A+ N+ S       A F+R  G++ + K++G+  R  R +F  A +  PSI+F DEID +   R          I  T+L L   +DG DDRG++ VI ATN+I+ +DPAL RPGR DR+ +F  P+   ++ I+ IHT   K  LS+++ + ++ +     SGADI+ +  EAGL ALR R  Q+ +            NK+E NL  +++
Sbjct:  171 MKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTS-------ATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTS--KMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL 437          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Yeast
Match: RPT6 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003016])

HSP 1 Score: 181.03 bits (458), Expect = 4.862e-50
Identity = 106/265 (40.00%), Postives = 158/265 (59.62%), Query Frame = 1
Query: 1030 TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSL---IDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAI 1812
            T+ M+GG  K I+ +KE + LP+ +PE+F+ LGI+ P+G++ YGPPG+GKTLLARA+ +    + +CK  F    GA+ + K++GE  R +R LF  A +  PSIIF DEID +   R        S +  T+L L   +DG +    I +I ATNR+D +DPAL RPGR DR+  F  P    R +I+RIH+R  K  L+  + +  +A    G SGAD+KG+  EAG+ ALR R  +I+      EL + ++  K  +  +++
Sbjct:  146 TYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAH----HTDCK--FIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSR--KMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRER--RIHVTQEDFELAVGKVMNKNQETAISV 400          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Yeast
Match: RIX7 (Putative ATPase of the AAA family; required for export of pre-ribosomal large subunits from the nucleus; distributed between the nucleolus, nucleoplasm, and nuclear periphery depending on growth conditions [Source:SGD;Acc:S000003957])

HSP 1 Score: 187.193 bits (474), Expect = 3.885e-49
Identity = 113/286 (39.51%), Postives = 167/286 (58.39%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLS-----DEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLN-------------EIFVKEDDFKVAIKTIRPS 1830
            +T++ +G  ++    L  +++ P+  PE+++K+GIS P G+L +GPPG GKTLLA+A+ NE   N      F   KG + L+K+VGESER +R +F +A    P +IFFDE+D L P R     +  S +V+TLL+ +DGL+DR  I VIGATNR D IDPA+ RPGR D+     LP   E+ DII+  T+     LS     +E+I +       FSGAD+  LV E+ + AL+R++ Q     + L+ +L+             EI V   DF+ A++ I+PS
Sbjct:  530 VTWANVGALQRVRLELNMAIVQPIKRPELYEKVGISAPGGVLLWGPPGCGKTLLAKAVANESRAN------FISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRN--EKCNNFSGADLAALVRESSVLALKRKFFQSEEIQSVLDNDLDKEFEDLSVGVSGEEIIVTMSDFRSALRKIKPS 807          

HSP 2 Score: 167.162 bits (422), Expect = 1.032e-42
Identity = 95/240 (39.58%), Postives = 141/240 (58.75%), Query Frame = 1
Query: 1042 IGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVR-SVRQDQIHSSIVSTLLSLIDGL----DDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSN 1746
            +GG    +  L E + LP+++PE+F   G+ PPRG+L +GPPG GKT +A AL  E       ++ F        +S   GESE+++R LFD+A  + P ++FFDEID + P R    Q ++   IV+ LL+ +D L     +   +I+IGATNR D++D ALRR GRFDRE    +P E  R  I++  + + K   + +    +A +T GF GAD+K LV  AG CA++R + Q Y+N
Sbjct:  207 LGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANALAGE------LQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNVPNEVSRLHILKKMSDNLKIDGAIDF-AKLAKLTPGFVGADLKALVTAAGTCAIKRIF-QTYAN 438          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Nematostella
Match: EDO39006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBC8])

HSP 1 Score: 202.601 bits (514), Expect = 2.864e-55
Identity = 112/284 (39.44%), Postives = 169/284 (59.51%), Query Frame = 1
Query: 1021 RSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGE---IIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLN--------EIFVKEDDFKVAIKTIRPSNER 1839
            + ++F  IGG K  IQA++E + +PL  PE+F   G+ PPRG+L YGP G+GKT++ARA+ NE  ++      FF   G + LS++ GE+E +LR +F +A    PSI+F DE+D L P R   Q++    +V+TLL+L+DG+  +     ++V+ ATNR DA+DPALRRPGRFDRE    +P   +RRDI+    ++    L DE I+S+A    G+ GAD+     EA L A +R    ++++ N    +L         E+ V  +D + A + +RPS  R
Sbjct:   22 KGVSFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPRGILLYGPSGTGKTMIARAVANETGVH------FFCINGPEVLSRYYGETEARLREIFTEAQNKSPSIVFIDELDALCPRRDKVQNEFERRVVATLLTLMDGMHMKSTDTYVMVLAATNRPDALDPALRRPGRFDREIEIGIPSVTDRRDILVTLLKNVPHSLHDEDISSLAESAHGYVGADLAAACKEASLYAFKR---SLHNHDNGSSQSLEQRDARIKRELLVSSEDMRAAFRCVRPSAMR 296          

HSP 2 Score: 176.022 bits (445), Expect = 2.613e-46
Identity = 108/265 (40.75%), Postives = 152/265 (57.36%), Query Frame = 1
Query:  946 LKMDLFNDRNVTRANFADIEPMAIDR------SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVR-SVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            +K +L       RA F  + P A+         + +S +GGN+   + LKE+V  PL +PE F++LGI PPRG+L YGPPG  KTL+ARAL  E  LN      F   KG +  SKWVGESE+ +R +F +A    PSI+FFDE+D +A  R S     ++  +++ LL+ +DG++   ++I I ATNR D ID AL RPGR DR     LP    RR I+ IH      + S ++   +   T+G+SGA+I  +  EA L AL+
Sbjct:  272 IKRELLVSSEDMRAAFRCVRPSAMREVALEVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPRGILMYGPPGCSKTLIARALATESGLN------FIAIKGPELFSKWVGESEKAVREVFLKARATAPSIVFFDELDAIAGQRNSTGGSDVNDRVLTQLLTELDGVETLKDVIFIAATNRPDMIDKALMRPGRVDRLIYVPLPCWDTRRHILEIHLARTPCEGSLDL-EDLVERTEGYSGAEIAAVCREAALAALQ 529          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Nematostella
Match: EDO36218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ61])

HSP 1 Score: 201.445 bits (511), Expect = 2.275e-53
Identity = 115/275 (41.82%), Postives = 168/275 (61.09%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            + +  IGG +K +  +KE V LPL +P++FK +G+ PPRG+L +GPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R     ++   IVS LL+L+DGL  R  +IV+ ATNR +++D ALRR GRFDRE    +P+   R +I+RIHT++ K  L D++ +  IA+ T G+ G+D+  L  EA L  +R +   I      ++   L+ + V  DDF+ A+    PS  R +
Sbjct:  196 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLMARAVANETGA------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSVDVALRRFGRFDREVDIGIPDATGRLEILRIHTKNMK--LGDDVDLEQIAAETHGYVGSDVASLCSEAALQQIREKMDLIDLEDETIDAEVLDSLAVSMDDFRYAMGVSNPSALRET 462          

HSP 2 Score: 161.384 bits (407), Expect = 1.800e-40
Identity = 98/289 (33.91%), Postives = 161/289 (55.71%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRSI------TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            ++Q+ R +++ I+L    +  ++ +   V+  +F        P A+  ++      ++  IGG +   + L+E V  P+ +P+ F K G++P +G+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A  R         +   +++ +L+ +DG++ +  + +IGATNR D IDPA+ RPGR D+     LP++  R  I++ + R   P   D  +  +A VT GFSGAD+  +   A   A+R
Sbjct:  414 ALQQIREKMDLIDLEDETIDAEVLDSLAVSMDDFRYAMGVSNPSALRETVVEVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVRDVFDKARSAAPCVLFFDELDSIAKSRGGNVGDGGGAADRVINQVLTEMDGMNVKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDGSRSSILKANLRK-SPIAKDVDLDYVAKVTHGFSGADLTEICQRACKLAIR 695          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Nematostella
Match: EDO49524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH4])

HSP 1 Score: 174.866 bits (442), Expect = 1.854e-47
Identity = 109/268 (40.67%), Postives = 160/268 (59.70%), Query Frame = 1
Query: 1030 TFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVN--ECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSL---IDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIK 1815
            T+ M+GG  K I+ +KE + LP+ +PE+F+ LGI  P+G+L YGPPG+GKTLLARA+ +  EC+        F    G++ + K++GE  R +R LF  A +  PSIIF DEID +   R        S +  T+L L   +DG +    I VI ATNRID +D AL RPGR DR+  F  P E  R+DI++IH+R  K  L+  + +  IA +  G SGA+IKG+  EAG+ ALR R  +++      E+ + ++  K+ +  ++IK
Sbjct:  139 TYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLYGPPGTGKTLLARAVAHHTECT--------FIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARQDILKIHSR--KMNLTRGINLKKIAELMPGASGAEIKGVCTEAGMYALRER--RVHVTQEDFEMAVTKVMQKDSEKNMSIK 394          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Nematostella
Match: EDO45694 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS74])

HSP 1 Score: 174.096 bits (440), Expect = 4.573e-45
Identity = 115/306 (37.58%), Postives = 166/306 (54.25%), Query Frame = 1
Query:  973 NVTRANFADIEPMAIDRSITFS--MIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQA-YKMR--PSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHR 1875
            +V++ N  +IE + +  S+     ++ G    I+ LKE V  PL YPE F  LGI+ P+G+L  G PG GKTLL      +C +            G D      GESE  LR +F++A Y  R  P ++F DE+D L P R    ++  + IV+ LL+L+DGL+ RG +IVIGATNR +A+DPALRRPGRFDRE +  +P   +R DI+R H +     + D  +T +A +T G+ GAD+  L  +A   AL+R   +     NK  L+     VK  DF++A+    PS  +    +    P R
Sbjct:  107 SVSKTNI-NIESVKVGSSVDSGNIILSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKGILLVGAPGVGKTLLVHKATVDCGIK------LVSTNGTDVFGPHAGESEENLRRVFNKARYASRFGPCVLFIDELDALCPKRGSSGNEEENRIVAQLLTLMDGLESRGRVIVIGATNRPNALDPALRRPGRFDREVVIGVPSAGQRLDILRAHCKPINLSV-DVDLTHLAEITVGYVGADLASLCQQAAFAALKRSLAK-----NKSGLHT----VKMSDFQLAMCHTVPSTHKGMEGVVRLQPTR 395          

HSP 2 Score: 133.265 bits (334), Expect = 7.128e-32
Identity = 95/272 (34.93%), Postives = 143/272 (52.57%), Query Frame = 1
Query: 1042 IGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGL---------------------DDRGE-------------IIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNK 1755
            +GG +   QAL++++  PL++PE F ++G+  PRG+L YGPPG  KT L RA  +    + +C   F     A   S +VG++ER LR LF +A    P+I+F DE+D LA  R      + + +++TLL+ +DG+                     +DRG              +I++ ATNR +AID AL RPGR D       P+ + R +I+R+HTR + P   D  ++ IA  T+ +SGAD++ L  EA L AL  +     S  NK
Sbjct:  399 VGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTLVRAAAS----STHC--TFMSLSCAQLFSSYVGDAERTLRELFLKARATAPAILFLDELDSLAGKRG-NNLGMETRLLATLLNEMDGVGVSANIYGRECNEREMPQKYKEDRGSKGNIGGESLTNSYLILVAATNRPEAIDGALLRPGRIDCMIYVPPPDMKARLEILRVHTR-FSPLAPDVDLSVIAEGTELYSGADLENLCREAALFALEHKGMDTCSIDNK 662          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Nematostella
Match: EDO37473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ3])

HSP 1 Score: 165.622 bits (418), Expect = 5.987e-44
Identity = 100/237 (42.19%), Postives = 138/237 (58.23%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRK-GADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLI---DGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRR 1725
            +T+S IGG K+ I  L+E V  PL++PE F  LGI PP+G+L +GPPG+GKTL ARA+ N          A F+R  G++ + K+VGE  R +R LF+ A   +  I+FFDEID +   R        + +  T+L LI   DG D RG I V+ ATNR D +DPAL RPGR DR+  F LP+   R  I +IH R    +  D     +A +    +GA+I+ +  EAG+ A+R R
Sbjct:  173 VTYSDIGGCKEQIDKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTD-------ACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRAHIFKIHARSMSVE-RDIRYELLARLCPNSTGAEIRSVCTEAGMFAIRAR 401          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Medaka
Match: atad2b (ATPase family AAA domain containing 2B [Source:NCBI gene;Acc:101173904])

HSP 1 Score: 548.895 bits (1413), Expect = 9.382e-173
Identity = 319/776 (41.11%), Postives = 450/776 (57.99%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFP-----------------------LHSYMPHR---------------IKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFA----IEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLF-XXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEM-KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVK 3060
            RFE+RK +S+ RAR+   P+NL+  +L   +  DR    A+ AD++PM +D S+ F  +GG   +IQ+LKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS  N  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LS+  +  +A    G+ GADIK L  EA L ALRRRYPQIY +  KL+L++  I +   DF  A++TI P+++R+  P                       L    PH                ++  L+ D            Q    P   P ++ +    L  H+ SS     + ++PRLL+ G         L   + H +  + +   D   L   +  + EE    +FREA +++ S+V++PHI   + ++  + ++  + +++   + +P LF        + LS+ V   +  V  + +    +  E  + F S+L+ +QA                   P  +S +  S      EVL+ AE    + LS++E  +L  +E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T  +F  D+ LI +NAL YNP ++   K IR  A    D A  IF     PEFDR+ ++I EAR  R++   V+
Sbjct:  224 RFERRKSKSMTRARNRCLPVNLTAEDLASGVLRDRVKVGASLADVDPMNLDNSVRFDSVGGLSYHIQSLKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGNR-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDCRGEIVVIGATNRLDSIDPALRRPGRFDREFLFRLPDKKARKQILKIHTRDWNPKLSEPFLDELAEKCVGYCGADIKALCTEAALMALRRRYPQIYGSSVKLKLDVASIVLGPGDFSKAMRTIVPASQRALAPPGRALSPVLRPLLDSSLSLVLKALLRVFPHAQPADGDYIQGDDNHPLEEDLYSDDNEDGSASIYEVQPAASPKSQPCSSAMHRTFL--HFSSSALQQPTSYRPRLLLAGAPGSGQSSHLAPALLHHLDKLPVHRLDLPTLYSISAKTPEESCAQVFREARRSTPSVVYMPHISEWWDTVGDTVRSTFITLLQDVPSFSPVLFLATAETPYSKLSDEVRSMFQKVYGEVVVLCPLGEEERRNFFSDLLLVQA---------------ARPPPRLRSTERCS------EVLQAAEAPGQRVLSAEEQRRLAEQEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIEEVSDYLEVIRQPMDLSTIMTKIDTHRYLTVKDFLVDVDLICSNALEYNPDKDPGDKVIRHRACSLKDTAHAIFAAELDPEFDRMCEEIKEARKKRDFQAPVE 975          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Medaka
Match: atad2b (ATPase family AAA domain containing 2B [Source:NCBI gene;Acc:101173904])

HSP 1 Score: 550.051 bits (1416), Expect = 2.560e-172
Identity = 319/776 (41.11%), Postives = 450/776 (57.99%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFP-----------------------LHSYMPHR---------------IKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFA----IEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLF-XXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEM-KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVK 3060
            RFE+RK +S+ RAR+   P+NL+  +L   +  DR    A+ AD++PM +D S+ F  +GG   +IQ+LKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS  N  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LS+  +  +A    G+ GADIK L  EA L ALRRRYPQIY +  KL+L++  I +   DF  A++TI P+++R+  P                       L    PH                ++  L+ D            Q    P   P ++ +    L  H+ SS     + ++PRLL+ G         L   + H +  + +   D   L   +  + EE    +FREA +++ S+V++PHI   + ++  + ++  + +++   + +P LF        + LS+ V   +  V  + +    +  E  + F S+L+ +QA                   P  +S +  S      EVL+ AE    + LS++E  +L  +E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T  +F  D+ LI +NAL YNP ++   K IR  A    D A  IF     PEFDR+ ++I EAR  R++   V+
Sbjct:  318 RFERRKSKSMTRARNRCLPVNLTAEDLASGVLRDRVKVGASLADVDPMNLDNSVRFDSVGGLSYHIQSLKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGNR-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDCRGEIVVIGATNRLDSIDPALRRPGRFDREFLFRLPDKKARKQILKIHTRDWNPKLSEPFLDELAEKCVGYCGADIKALCTEAALMALRRRYPQIYGSSVKLKLDVASIVLGPGDFSKAMRTIVPASQRALAPPGRALSPVLRPLLDSSLSLVLKALLRVFPHAQPADGDYIQGDDNHPLEEDLYSDDNEDGSASIYEVQPAASPKSQPCSSAMHRTFL--HFSSSALQQPTSYRPRLLLAGAPGSGQSSHLAPALLHHLDKLPVHRLDLPTLYSISAKTPEESCAQVFREARRSTPSVVYMPHISEWWDTVGDTVRSTFITLLQDVPSFSPVLFLATAETPYSKLSDEVRSMFQKVYGEVVVLCPLGEEERRNFFSDLLLVQA---------------ARPPPRLRSTERCS------EVLQAAEAPGQRVLSAEEQRRLAEQEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIEEVSDYLEVIRQPMDLSTIMTKIDTHRYLTVKDFLVDVDLICSNALEYNPDKDPGDKVIRHRACSLKDTAHAIFAAELDPEFDRMCEEIKEARKKRDFQAPVE 1069          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Medaka
Match: atad2b (ATPase family AAA domain containing 2B [Source:NCBI gene;Acc:101173904])

HSP 1 Score: 541.576 bits (1394), Expect = 3.077e-169
Identity = 323/779 (41.46%), Postives = 451/779 (57.89%), Query Frame = 1
Query:  868 RFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPL---------NAKLDCDLL-DCHWDSSIQ--------------------------SFSSLFKP-----RLLVTGFA----IEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLF-XXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEM-KPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVK 3060
            RFE+RK +S+ RAR+   P+NL+  +L   +  DR    A+ AD++PM +D S+ F  +GG   +IQ+LKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS  N  K++FFMRKGADCLSKWVGESERQLRLLFDQAY MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGEI+VIGATNR+D+IDPALRRPGRFDREF+F LP+++ R+ I++IHTRDW P+LS+  +  +A    G+ GADIK L  EA L ALRRRYPQIY +  KL+L++  I +   DF  A++TI P+++R+  P     P R    + +        +       VFP   P          N  L+ DL  D + D S                            S S+L +P     RLL+ G         L   + H +  + +   D   L   +  + EE    +FREA +++ S+V++PHI   + ++  + ++  + +++   + +P LF        + LS+ V   +  V  + +    +  E  + F S+L+ +QA                   P  +S +  S      EVL+ AE    + LS++E  +L  +E+  LR+ R+ LR +   LA D++F++F  PVD+ EV DY  +I  P+DLST+  K+D + Y T  +F  D+ LI +NAL YNP ++   K IR  A    D A  IF     PEFDR+ ++I EAR  R++   V+
Sbjct:  318 RFERRKSKSMTRARNRCLPVNLTAEDLASGVLRDRVKVGASLADVDPMNLDNSVRFDSVGGLSYHIQSLKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGNR-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDCRGEIVVIGATNRLDSIDPALRRPGRFDREFLFRLPDKKARKQILKIHTRDWNPKLSEPFLDELAEKCVGYCGADIKALCTEAALMALRRRYPQIYGSSVKLKLDVASIVLGPGDFSKAMRTIVPASQRALAP-----PGRALSPVLRPLLDSSLSLVLKALLRVFPHAQPADGDYIQGDDNHPLEEDLYSDDNEDGSASIYEVQPAASPKSQPCSSAMHRTFLHFSSSALQQPTSYRPRLLLAGAPGSGQSSHLAPALLHHLDKLPVHRLDLPTLYSISAKTPEESCAQVFREARRSTPSVVYMPHISEWWDTVGDTVRSTFITLLQDVPSFSPVLFLATAETPYSKLSDEVRSMFQKVYGEVVVLCPLGEEERRNFFSDLLLVQA---------------ARPPPRLRSTERCS------EVLQAAEAPGQRVLSAEEQRRLAEQEENTLRELRLFLRDVTKRLATDKRFSIFSKPVDIEEVSDYLEVIRQPMDLSTIMTKIDTHRYLTVKDFLVDVDLICSNALEYNPDKDPGDKVIRHRACSLKDTAHAIFAAELDPEFDRMCEEIKEARKKRDFQAPVE 1069          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Medaka
Match: atad2 (ATPase family AAA domain containing 2 [Source:NCBI gene;Acc:101172019])

HSP 1 Score: 540.036 bits (1390), Expect = 2.416e-168
Identity = 311/768 (40.49%), Postives = 442/768 (57.55%), Query Frame = 1
Query:  871 FEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSF-PLHSYMPHRIKLL---LHQDYCLFKEKITKCFQG-----------------IVFPSD-------NPLNAKLDCDLLDCHW----DSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKP-------KTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            F++R+++S  R  +   P+NL K +L + +  DR    A+ AD++PM IDR++ F  IGG  ++I ALKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS     K++FFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGE++VIGATNR+D+IDPALRRPGRFDREF+F LP+   R++I++IHTR W PQ SD  +  +A    G+ GADIK +  EA LCALRRRYPQIYS+  KL L+++ I +   DF  A+  + P+ +R    P  + +P    LL   L     L ++      QG                 ++F  D         L ++    + D +     D S  S    ++PRLL+ G         L   + H +    + + D   L   +  + EE    +F EA +TS SI+++P I   + ++  + +   L ++ S    +P L + T  +     +  +     VE+            G+ FQ     ++ P   +R+ +F +L+      L ++  + S    A   L+  E+ P       + L+ +E +KLE +E+  LR+ R+ LR + + L++D++F  F  PVD+ EVPDY  +I  P+DLST+  K+DL+ Y T  E+  D+ LI  NAL YNP R+   + IR  A    D    I ++    +F++I  DI E+R  R 
Sbjct:  365 FQRRRIKSRSRPVNRCLPMNLIKEDL-LGIHKDRMKIGASLADVDPMHIDRTVRFDSIGGLSRHILALKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGEK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNRLDSIDPALRRPGRFDREFLFGLPDRDARKEILKIHTRQWTPQPSDTFLEELADKCVGYCGADIKAVCSEAALCALRRRYPQIYSSTQKLLLDVDSIVITSKDFVFAMSKMVPAAQRVVVSPAKALIPAIRPLLGATLQSILLLVRKVFPHAEQGLKRKREPDEPCEGFEDDLMFSEDESSEVTSGKLTSQPQLKIKDANGLLNLDRSAFSQPMSYRPRLLLEGRPGSGQSSHLAPAVLHALEKFTVYTLDMAVLFGASACTPEETCAQVFVEAKRTSPSILYIPCIGQWWETVGPALRATFLSLLSSIPAFSPILLLATCSLGYKQLSVEVQELFRVEY------------GEVFQ-----VRVPTRQERWNFFEDLI------LHQAAKAPSTKKKA--ALRALEVLPVAPPPPPRQLTKEESKKLEEQEEDTLRELRLFLRDVTNRLSQDKRFKAFTRPVDLEEVPDYAEVIKRPMDLSTVLSKIDLHQYGTVKEYLEDVDLIWQNALEYNPDRDPSDRQIRHRACALKDTVHAIIQEELDEDFEKICDDIKESRKRRG 1105          
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Medaka
Match: atad2 (ATPase family AAA domain containing 2 [Source:NCBI gene;Acc:101172019])

HSP 1 Score: 540.036 bits (1390), Expect = 2.666e-168
Identity = 311/768 (40.49%), Postives = 442/768 (57.55%), Query Frame = 1
Query:  871 FEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSF-PLHSYMPHRIKLL---LHQDYCLFKEKITKCFQG-----------------IVFPSD-------NPLNAKLDCDLLDCHW----DSSIQSFSSLFKPRLLVTG----FAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRS-HNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKP-------KTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRN 3042
            F++R+++S  R  +   P+NL K +L + +  DR    A+ AD++PM IDR++ F  IGG  ++I ALKE V+ PL+YPEVF++  I PPRG LFYGPPG+GKTL+ARAL NECS     K++FFMRKGADCLSKWVGESERQLRLLFDQAY+MRPSIIFFDEIDGLAPVRS RQDQIHSSIVSTLL+L+DGLD RGE++VIGATNR+D+IDPALRRPGRFDREF+F LP+   R++I++IHTR W PQ SD  +  +A    G+ GADIK +  EA LCALRRRYPQIYS+  KL L+++ I +   DF  A+  + P+ +R    P  + +P    LL   L     L ++      QG                 ++F  D         L ++    + D +     D S  S    ++PRLL+ G         L   + H +    + + D   L   +  + EE    +F EA +TS SI+++P I   + ++  + +   L ++ S    +P L + T  +     +  +     VE+            G+ FQ     ++ P   +R+ +F +L+      L ++  + S    A   L+  E+ P       + L+ +E +KLE +E+  LR+ R+ LR + + L++D++F  F  PVD+ EVPDY  +I  P+DLST+  K+DL+ Y T  E+  D+ LI  NAL YNP R+   + IR  A    D    I ++    +F++I  DI E+R  R 
Sbjct:  370 FQRRRIKSRSRPVNRCLPMNLIKEDL-LGIHKDRMKIGASLADVDPMHIDRTVRFDSIGGLSRHILALKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPGTGKTLVARALANECSQGEK-KVSFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNRLDSIDPALRRPGRFDREFLFGLPDRDARKEILKIHTRQWTPQPSDTFLEELADKCVGYCGADIKAVCSEAALCALRRRYPQIYSSTQKLLLDVDSIVITSKDFVFAMSKMVPAAQRVVVSPAKALIPAIRPLLGATLQSILLLVRKVFPHAEQGLKRKREPDEPCEGFEDDLMFSEDESSEVTSGKLTSQPQLKIKDANGLLNLDRSAFSQPMSYRPRLLLEGRPGSGQSSHLAPAVLHALEKFTVYTLDMAVLFGASACTPEETCAQVFVEAKRTSPSILYIPCIGQWWETVGPALRATFLSLLSSIPAFSPILLLATCSLGYKQLSVEVQELFRVEY------------GEVFQ-----VRVPTRQERWNFFEDLI------LHQAAKAPSTKKKA--ALRALEVLPVAPPPPPRQLTKEESKKLEEQEEDTLRELRLFLRDVTNRLSQDKRFKAFTRPVDLEEVPDYAEVIKRPMDLSTVLSKIDLHQYGTVKEYLEDVDLIWQNALEYNPDRDPSDRQIRHRACALKDTVHAIIQEELDEDFEKICDDIKESRKRRG 1110          
BLAST of ATPase family AAA domain containing 2B vs. Planmine SMEST
Match: SMESG000011785.1 (SMESG000011785.1)

HSP 1 Score: 2374.74 bits (6153), Expect = 0.000e+0
Identity = 1184/1184 (100.00%), Postives = 1184/1184 (100.00%), Query Frame = 1
Query:   97 MVVTRNSGLSENFRASKRILRDIKSRKSLRPRVSIPNYREESPEEGGFAIFHKILEVDVNNKKSVSHKLKFRSSNRKKAFKEFHRFKLTTSANKNNQSADEKEENNNTEFPNKSDEKVDLVSNPKIIKNDDNSKANTATDTPKPDLNTKDTKKFIYSKNNERTFKRRISASYSRLPEKDNSQKCFESGRRYPSRLRRQPKEVYRVNCNFKTDKKSDWRDSLTSPIHNIFNDGKHRKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFXXXXXXXXXXSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIREFLVDLNGCKFGIPNGPLIKTQLMLYDKYYKSEEPFATSKERKSHSDSEASVKRSPMETKYKKSKSINDLDFTQTDNNHSTLMESFKELQSNLGSNALVTIDVDQSISDPKLLEMSPPEPVVIDLSELEEIIHHVASLTDCSTILQLEEIYFVLSKEISKFFICSDRSILPKNLRQIIDSYFQKV 3648
            MVVTRNSGLSENFRASKRILRDIKSRKSLRPRVSIPNYREESPEEGGFAIFHKILEVDVNNKKSVSHKLKFRSSNRKKAFKEFHRFKLTTSANKNNQSADEKEENNNTEFPNKSDEKVDLVSNPKIIKNDDNSKANTATDTPKPDLNTKDTKKFIYSKNNERTFKRRISASYSRLPEKDNSQKCFESGRRYPSRLRRQPKEVYRVNCNFKTDKKSDWRDSLTSPIHNIFNDGKHRKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPEERERRDIIRIHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFIRTILILTTLSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIREFLVDLNGCKFGIPNGPLIKTQLMLYDKYYKSEEPFATSKERKSHSDSEASVKRSPMETKYKKSKSINDLDFTQTDNNHSTLMESFKELQSNLGSNALVTIDVDQSISDPKLLEMSPPEPVVIDLSELEEIIHHVASLTDCSTILQLEEIYFVLSKEISKFFICSDRSILPKNLRQIIDSYFQKV
Sbjct:    1 MVVTRNSGLSENFRASKRILRDIKSRKSLRPRVSIPNYREESPEEGGFAIFHKILEVDVNNKKSVSHKLKFRSSNRKKAFKEFHRFKLTTSANKNNQSADEKEENNNTEFPNKSDEKVDLVSNPKIIKNDDNSKANTATDTPKPDLNTKDTKKFIYSKNNERTFKRRISASYSRLPEKDNSQKCFESGRRYPSRLRRQPKEVYRVNCNFKTDKKSDWRDSLTSPIHNIFNDGKHRKFELHSKQSNTDDSDEQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPEERERRDIIRIHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQDYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKPRLLVTGFAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFREADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFIRTILILTTLSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYTYFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEIEEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPIDLSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYEFNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIREFLVDLNGCKFGIPNGPLIKTQLMLYDKYYKSEEPFATSKERKSHSDSEASVKRSPMETKYKKSKSINDLDFTQTDNNHSTLMESFKELQSNLGSNALVTIDVDQSISDPKLLEMSPPEPVVIDLSELEEIIHHVASLTDCSTILQLEEIYFVLSKEISKFFICSDRSILPKNLRQIIDSYFQKV 1184          
BLAST of ATPase family AAA domain containing 2B vs. Planmine SMEST
Match: SMESG000009924.1 (SMESG000009924.1)

HSP 1 Score: 204.527 bits (519), Expect = 4.914e-54
Identity = 117/275 (42.55%), Postives = 169/275 (61.45%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            + +  IGG +K +  +KE V LPL +P++FK +G+ PPRG+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DE+D +AP R     ++   IVS LL+L+DGL  R  +IV+ ATNR ++IDPALRR GRFDRE    +P+   R +I+RIHT++ +  L D++ +  +AS T G  GAD+  L  EA L  +R +   I     +++   LN + V  +DF+ A+    PS  R +
Sbjct:  198 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGS------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMR--LGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRET 464          

HSP 2 Score: 168.703 bits (426), Expect = 1.520e-42
Identity = 103/289 (35.64%), Postives = 165/289 (57.09%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDRS------ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSS---IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALR 1719
            ++Q+ R++++ I+L + E+  ++ N   VT  +F    +   P A+  +      +T+  IGG +   + L+E V  P+ +P+ F K G++P +G+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ W GESE  +R +FD+A +  P ++FFDE+D +A  R         +   +++ LL+ +DG+  +  + +IGATNR D ID A+ RPGR D+     LP+E+ R  I++ + R   P   D  +  +A VT GFSGAD+  +   A   A+R
Sbjct:  416 ALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRK-SPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIR 697          
BLAST of ATPase family AAA domain containing 2B vs. Planmine SMEST
Match: SMESG000027507.1 (SMESG000027507.1)

HSP 1 Score: 201.06 bits (510), Expect = 3.869e-53
Identity = 116/273 (42.49%), Postives = 169/273 (61.90%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNER 1839
            + +  IGG +K +  +KE V LPL +PE+FK +GI PPRG+L +GPPG+GKT++ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  PSI+F DE+D +AP R     ++   IVS LL+L+DGL  R  ++V+ ATNR ++IDPALRR GRFDRE    +P+   R +I+RIHT++ K  +SD++ +  +A+ T G  GAD+  L  EA L  +R +   I     +++   L+ + V  DDF+ A+    PS  R
Sbjct:  183 VGYDDIGGCRKQLDLIKEMVELPLRHPELFKTIGIKPPRGILLFGPPGTGKTMIARAVANETGA------FFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPSILFIDEVDSIAPKRDKTNGEVEKRIVSQLLTLMDGLKSRSNVVVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMK--ISDDVNLEQVANETHGCVGADLASLCSEAALQHIRGKMDLIDFEEEEIDAEILHSLAVTMDDFRYAMSKNHPSALR 447          

HSP 2 Score: 162.54 bits (410), Expect = 1.205e-40
Identity = 109/333 (32.73%), Postives = 184/333 (55.26%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANF----ADIEPMAIDR------SITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAP---VRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEM-ITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNK---LELNLNEIFVK--EDDFKVAIKTIRPSN 1833
            ++Q  R +++ I+  + E+  ++ +   VT  +F    +   P A+        ++++  +GG +   Q L+E V  P+ +PE+F K G+SP +G+LFYGPPG GKTLLA+A+ NEC  N      F   KG + L+ + GESE  +R +FD+A +  P ++FFDE+D +A      +         +++ LL+ +DG+  +  + +IGATNR D +D A+ RPGR D+     LP+E+ R  I++ + R  K  +S  + +  +A VT GFSGAD+  +       A+R+   +  +  N+   +E  + E+ V   ED  KVA K++  S+
Sbjct:  401 ALQHIRGKMDLIDFEEEEIDAEILHSLAVTMDDFRYAMSKNHPSALREHSVEIPNVSWDDVGGLENVKQELQEMVQYPVQHPEMFLKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQAN------FISIKGPELLTMYFGESEANIREIFDKARQAAPCVLFFDELDSIATARGSGAGDAGGAGDRVINQLLTEMDGMSSKKNVFIIGATNRPDILDGAILRPGRLDQLIYIPLPDEKSRLAILKANLR--KSPVSQRVNLEHLARVTDGFSGADLTEICQRTCKLAIRQCIEEDIAARNRGEEIEDPVPELTVAHFEDAMKVARKSVSASD 725          
BLAST of ATPase family AAA domain containing 2B vs. Planmine SMEST
Match: SMESG000016085.1 (SMESG000016085.1)

HSP 1 Score: 197.208 bits (500), Expect = 9.823e-52
Identity = 115/274 (41.97%), Postives = 165/274 (60.22%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            I +  IGG +K +  +KE V LPL +P++FK +G+ PP G+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R   Q ++   IVS LL+L+DGL  R  ++V+ ATNR ++ID ALRR GRFDRE    +P+   R +I+RIHT++ +  + +  +  IA  T G  GAD+  L  EA L  +R +   I     +++   LN + V  +DF+ A+    PS  R +
Sbjct:  210 IGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPSGILLYGPPGTGKTLIARAVANETGS------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKREKTQGEVERRIVSQLLTLMDGLKQRSHVVVMAATNRPNSIDSALRRFGRFDREVDIGIPDSIGRLEILRIHTKNMR-LVENVDLEIIAKETHGHVGADLAALCSEAALQQIRNKMDLIDLEEEEIDAEVLNSLAVTMEDFRWALDKSNPSALRET 476          

HSP 2 Score: 166.007 bits (419), Expect = 1.010e-41
Identity = 110/315 (34.92%), Postives = 171/315 (54.29%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRS--------------ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVR-SVRQDQIHSS--IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFV 1785
            ++Q+ R++++ I+L + E+  ++ N   VT  +F      A+D+S              + +S +GG     + L+E V  P+ +P+ F K G++P +G+LFYGPPG GKTLLA+A+ +EC  N      F   KG + L+ W GESE  +R LFD+A +  P I+FFDE+D +A  R S   D   +S  +++ LL+ +DG+  +  + +IGATNR D ID A+ RPGR D+     LP+E+ R  I +   R   P   D  +  ++ VT GFSGAD+  +   A   A+R        + N  +   NE  V
Sbjct:  428 ALQQIRNKMDLIDLEEEEIDAEVLNSLAVTMEDFR----WALDKSNPSALRETTVEIPNVLWSDVGGLDNVKKELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIASECQAN------FISIKGPELLTMWFGESEANIRELFDKARQAAPCILFFDELDSIAKSRGSSASDGGGASDRVINQLLTEMDGMSLKKNVFIIGATNRPDIIDSAILRPGRLDQLIYIPLPDEKSRIQIFKAALRK-SPIAKDVDLNYLSKVTHGFSGADLTEICQRACKLAIRESIEAELKSANNPKPKCNEKLV 731          
BLAST of ATPase family AAA domain containing 2B vs. Planmine SMEST
Match: SMESG000016085.1 (SMESG000016085.1)

HSP 1 Score: 197.208 bits (500), Expect = 1.018e-51
Identity = 115/274 (41.97%), Postives = 165/274 (60.22%), Query Frame = 1
Query: 1027 ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELN-LNEIFVKEDDFKVAIKTIRPSNERSS 1845
            I +  IGG +K +  +KE V LPL +P++FK +G+ PP G+L YGPPG+GKTL+ARA+ NE          FF+  G + +SK  GESE  LR  F++A K  P+IIF DEID +AP R   Q ++   IVS LL+L+DGL  R  ++V+ ATNR ++ID ALRR GRFDRE    +P+   R +I+RIHT++ +  + +  +  IA  T G  GAD+  L  EA L  +R +   I     +++   LN + V  +DF+ A+    PS  R +
Sbjct:  210 IGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPSGILLYGPPGTGKTLIARAVANETGS------FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKREKTQGEVERRIVSQLLTLMDGLKQRSHVVVMAATNRPNSIDSALRRFGRFDREVDIGIPDSIGRLEILRIHTKNMR-LVENVDLEIIAKETHGHVGADLAALCSEAALQQIRNKMDLIDLEEEEIDAEVLNSLAVTMEDFRWALDKSNPSALRET 476          

HSP 2 Score: 166.007 bits (419), Expect = 1.075e-41
Identity = 110/315 (34.92%), Postives = 171/315 (54.29%), Query Frame = 1
Query:  892 SVQRARSELNPINLSKNELKMDLFNDRNVTRANFADIEPMAIDRS--------------ITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRGLLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESERQLRLLFDQAYKMRPSIIFFDEIDGLAPVR-SVRQDQIHSS--IVSTLLSLIDGLDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPXXXXXXXXXXXHTRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSNHNKLELNLNEIFV 1785
            ++Q+ R++++ I+L + E+  ++ N   VT  +F      A+D+S              + +S +GG     + L+E V  P+ +P+ F K G++P +G+LFYGPPG GKTLLA+A+ +EC  N      F   KG + L+ W GESE  +R LFD+A +  P I+FFDE+D +A  R S   D   +S  +++ LL+ +DG+  +  + +IGATNR D ID A+ RPGR D+     LP+E+ R  I +   R   P   D  +  ++ VT GFSGAD+  +   A   A+R        + N  +   NE  V
Sbjct:  428 ALQQIRNKMDLIDLEEEEIDAEVLNSLAVTMEDFR----WALDKSNPSALRETTVEIPNVLWSDVGGLDNVKKELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIASECQAN------FISIKGPELLTMWFGESEANIRELFDKARQAAPCILFFDELDSIAKSRGSSASDGGGASDRVINQLLTEMDGMSLKKNVFIIGATNRPDIIDSAILRPGRLDQLIYIPLPDEKSRIQIFKAALRK-SPIAKDVDLNYLSKVTHGFSGADLTEICQRACKLAIRESIEAELKSANNPKPKCNEKLV 731          
The following BLAST results are available for this feature:
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATAD2B1.191e-17541.26ATPase family AAA domain containing 2B [Source:HGN... [more]
ATAD21.045e-17241.84ATPase family AAA domain containing 2 [Source:HGNC... [more]
VCP9.094e-5542.55valosin containing protein [Source:HGNC Symbol;Acc... [more]
SPATA54.425e-5240.07spermatogenesis associated 5 [Source:HGNC Symbol;A... [more]
PSMC11.244e-4843.46proteasome 26S subunit, ATPase 1 [Source:HGNC Symb... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lex-11.540e-12733.60Tat-binding homolog 7 [Source:UniProtKB/Swiss-Pro... [more]
lex-11.910e-12733.60Tat-binding homolog 7 [Source:UniProtKB/Swiss-Pro... [more]
lex-11.910e-12733.60Tat-binding homolog 7 [Source:UniProtKB/Swiss-Pro... [more]
cdc-48.15.147e-5141.45Transitional endoplasmic reticulum ATPase homolog ... [more]
cdc-48.25.543e-5040.00Transitional endoplasmic reticulum ATPase homolog ... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TER945.483e-5241.30gene:FBgn0286784 transcript:FBtr0112905[more]
TER945.567e-5241.16gene:FBgn0286784 transcript:FBtr0088391[more]
TER946.348e-5241.30gene:FBgn0286784 transcript:FBtr0112906[more]
TER946.622e-5241.30gene:FBgn0286784 transcript:FBtr0343852[more]
Rpt64.906e-4840.37gene:FBgn0020369 transcript:FBtr0077189[more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atad2b2.137e-16539.85ATPase family AAA domain containing 2B [Source:ZFI... [more]
atad22.687e-16541.18ATPase family AAA domain containing 2 [Source:ZFIN... [more]
atad2b4.726e-13745.25ATPase family AAA domain containing 2B [Source:ZFI... [more]
vcp4.286e-5542.55valosin containing protein [Source:NCBI gene;Acc:3... [more]
vcp5.235e-5542.55valosin containing protein [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATAD2B6.275e-17240.93ATPase family, AAA domain containing 2B [Source:NC... [more]
ATAD2B2.617e-17140.85ATPase family, AAA domain containing 2B [Source:NC... [more]
ATAD2B4.649e-17141.18ATPase family, AAA domain containing 2B [Source:NC... [more]
tomm224.611e-17041.45translocase of outer mitochondrial membrane 22 hom... [more]
ATAD2B1.454e-16942.05ATPase family, AAA domain containing 2B [Source:NC... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atad2b9.242e-17741.19ATPase family, AAA domain containing 2B [Source:MG... [more]
Atad23.222e-17541.05ATPase family, AAA domain containing 2 [Source:MGI... [more]
Atad23.222e-17541.05ATPase family, AAA domain containing 2 [Source:MGI... [more]
Atad24.437e-17341.05ATPase family, AAA domain containing 2 [Source:MGI... [more]
Atad24.437e-17341.05ATPase family, AAA domain containing 2 [Source:MGI... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULI0|ATD2B_HUMAN5.961e-17541.26ATPase family AAA domain-containing protein 2B OS=... [more]
sp|Q8CDM1|ATAD2_MOUSE2.254e-17441.05ATPase family AAA domain-containing protein 2 OS=M... [more]
sp|Q5RDX4|ATAD2_PONAB5.769e-17441.84ATPase family AAA domain-containing protein 2 OS=P... [more]
sp|Q6PL18|ATAD2_HUMAN5.019e-17241.84ATPase family AAA domain-containing protein 2 OS=H... [more]
sp|A8X0L9|TBP7_CAEBR3.477e-12839.44Tat-binding homolog 7 OS=Caenorhabditis briggsae O... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W3HZQ96.574e-17742.65Bromo domain-containing protein OS=Callorhinchus m... [more]
G3PFL01.204e-17640.78ATPase family AAA domain containing 2B OS=Gasteros... [more]
G5E7I72.773e-17640.95Bromo domain-containing protein OS=Meleagris gallo... [more]
I3NDP96.483e-17642.04ATPase family AAA domain containing 2B OS=Ictidomy... [more]
A0A4Y2KMR31.129e-17542.17ATPase family AAA domain-containing protein 2B OS=... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atad2b1.756e-16640.46ATPase family AAA domain containing 2B [Source:NCB... [more]
atad22.026e-16441.12ATPase family AAA domain containing 2 [Source:NCBI... [more]
atad22.185e-16441.12ATPase family AAA domain containing 2 [Source:NCBI... [more]
atad22.958e-16441.12ATPase family AAA domain containing 2 [Source:NCBI... [more]
SPATA54.698e-5638.59spermatogenesis associated 5 [Source:HGNC Symbol;A... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atad2b4.554e-17240.23ATPase family AAA domain containing 2B [Source:ZFI... [more]
psmc59.653e-4940.74proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
nvl3.798e-4437.13nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
vcp4.030e-4435.29valosin containing protein [Source:NCBI gene;Acc:3... [more]
ENSPMAT00000001244.12.238e-4342.19pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 ge... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YTA79.217e-10944.66Protein that localizes to chromatin; has a role in... [more]
CDC481.232e-5541.30AAA ATPase; subunit of polyUb-selective segregase ... [more]
RPT21.464e-5039.86ATPase of the 19S regulatory particle of the 26S p... [more]
RPT64.862e-5040.00ATPase of the 19S regulatory particle of the 26S p... [more]
RIX73.885e-4939.51Putative ATPase of the AAA family; required for ex... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO390062.864e-5539.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362182.275e-5341.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495241.854e-4740.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456944.573e-4537.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374735.987e-4442.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atad2b9.382e-17341.11ATPase family AAA domain containing 2B [Source:NCB... [more]
atad2b2.560e-17241.11ATPase family AAA domain containing 2B [Source:NCB... [more]
atad2b3.077e-16941.46ATPase family AAA domain containing 2B [Source:NCB... [more]
atad22.416e-16840.49ATPase family AAA domain containing 2 [Source:NCBI... [more]
atad22.666e-16840.49ATPase family AAA domain containing 2 [Source:NCBI... [more]
back to top
BLAST of ATPase family AAA domain containing 2B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011785.10.000e+0100.00SMESG000011785.1[more]
SMESG000009924.14.914e-5442.55SMESG000009924.1[more]
SMESG000027507.13.869e-5342.49SMESG000027507.1[more]
SMESG000016085.19.823e-5241.97SMESG000016085.1[more]
SMESG000016085.11.018e-5141.97SMESG000016085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003605 ID=SMED30003605|Name=ATPase family AAA domain containing 2B|organism=Schmidtea mediterranea sexual|type=transcript|length=3730bp
CTTTGTTATATAACAAAGTATTTGTTTTAATATTGCTTTTTATTTCTTTT
TAAATTGTTATTTTTAGTTTTTTATATTTTATTATATATTATATTTATGG
TAGTTACTAGAAATTCAGGTCTTTCAGAAAATTTTAGAGCTTCTAAAAGA
ATTTTGAGAGATATAAAATCGCGAAAAAGTTTACGACCACGGGTTAGTAT
TCCCAACTATCGAGAAGAATCTCCAGAAGAAGGAGGTTTTGCAATTTTTC
ATAAAATTCTAGAAGTAGATGTAAATAATAAAAAATCAGTATCTCATAAA
TTAAAATTTCGATCATCAAATCGCAAAAAGGCATTTAAAGAATTTCATCG
ATTTAAGCTTACTACTTCAGCAAATAAAAACAATCAATCTGCAGATGAAA
AAGAAGAAAATAATAATACTGAATTCCCGAATAAATCCGATGAAAAAGTT
GATTTAGTTTCGAATCCAAAAATCATTAAAAATGATGACAACTCGAAAGC
AAATACTGCAACAGACACTCCTAAACCCGATTTAAATACTAAGGATACTA
AAAAATTTATTTATTCAAAAAATAACGAAAGAACATTCAAACGTCGAATA
TCTGCGTCATATTCTCGGTTACCCGAGAAAGATAACTCTCAAAAATGCTT
TGAGTCTGGTCGACGATATCCAAGTCGATTAAGGCGACAGCCGAAAGAAG
TTTATAGGGTCAATTGCAACTTCAAGACAGACAAAAAATCCGACTGGCGC
GATTCTCTTACTTCTCCTATTCACAACATATTTAATGACGGCAAACACCG
CAAATTTGAGCTGCATTCGAAACAGTCCAACACCGATGACAGTGACGAAC
AGTTTAACGATGAGATACGATTTGAAAAGCGTAAATTGCAAAGCGTCCAA
AGAGCTCGATCGGAATTAAATCCGATAAATTTATCAAAAAATGAATTGAA
AATGGATCTGTTTAATGACCGGAATGTGACTCGGGCAAACTTTGCTGACA
TCGAGCCAATGGCGATTGATCGCTCAATAACGTTCAGCATGATCGGGGGT
AACAAGAAGTATATACAAGCACTGAAAGAAAGTGTTATTCTTCCTCTTGT
CTATCCGGAAGTGTTCAAAAAACTTGGAATCAGTCCTCCTAGGGGTCTTC
TTTTTTATGGGCCGCCTGGGTCTGGCAAAACTCTGTTAGCGCGCGCATTG
GTTAATGAATGCAGTCTCAATAACAACTGCAAATTAGCGTTTTTTATGCG
CAAAGGTGCCGATTGTTTAAGCAAATGGGTTGGGGAGTCCGAGCGACAAT
TACGCCTGTTATTTGATCAAGCTTATAAGATGAGACCGTCAATCATATTT
TTCGATGAAATCGATGGACTGGCCCCAGTGCGATCAGTGAGACAAGATCA
GATACATTCTAGTATTGTTTCAACACTGCTGAGTCTTATTGATGGGCTTG
ATGATCGTGGAGAGATTATCGTTATAGGTGCTACAAATCGTATAGATGCC
ATTGATCCAGCTTTGCGCCGGCCGGGTAGATTTGATCGGGAATTTATGTT
TATGCTACCTGAGGAAAGAGAGCGTAGGGACATCATTAGGATTCACACGC
GAGACTGGAAGCCACAATTATCCGATGAAATGATAACCAGTATTGCGTCA
GTCACAAAAGGCTTTTCTGGTGCTGATATTAAAGGATTGGTTGTTGAAGC
CGGGTTGTGTGCGTTACGTCGTCGTTACCCACAAATATACAGCAATCACA
ATAAATTGGAATTGAATTTGAATGAAATATTCGTTAAAGAAGATGATTTC
AAAGTGGCTATCAAGACTATTCGACCTTCAAATGAACGAAGCAGTTTTCC
ATTACATAGTTACATGCCACATCGTATTAAGTTACTTCTGCACCAAGACT
ATTGTTTATTCAAAGAAAAGATTACTAAATGTTTCCAAGGAATAGTGTTT
CCATCGGATAATCCTTTGAATGCAAAATTGGATTGTGATTTGCTTGATTG
TCATTGGGATTCCTCTATTCAGTCATTTTCATCACTTTTCAAACCTCGAT
TGCTTGTGACTGGCTTTGCGATTGAACAGTTAATCTCAGGGATATTTCAT
GAAATTTCTGGTGTCAATATTTTGTCTTTCGATTCTATTTGTCTTGGAAT
CAATAATGGCCTTTCAGCTGAAGAGAAATTGTGTCACATATTTCGAGAGG
CTGATAAAACCTCAAAATCCATCGTGTTCTTACCGCATATAGATATAACA
TTTCATAGTCTGACGTTATCCGGTCAAAATCTCCTGCTGCAAATGGTGCG
GTCACATAACTTGAACCCTGACCTATTTATTCGAACAATCCTTATTCTTA
CAACTCTCTCAAACAGCGTAATTGATAATTGGAGTAATGTAGAATTTGAC
AACATTCAATCTACTCAAATTTGGGCAGAATTGGGGAAATGTTTCCAATC
CAATCTCATTAATATCCAAGCTCCTGATTTCCACCAACGCTACACATATT
TCAATGAGTTGGTTTCTCTCTCCATCAAACCCTTGGATAAGAGTATCGAT
TCAAATTCAAATTTAAATCCTGCCGACGAGGTATTAAAAGAAGCCGAAAT
GAAACCAAAAACTTTGAGCTCACAGGAATTGGAGAAATTGGAAATCGAAG
AAGATGTCGTGCTGAGGAAATTCCGAATGCTTTTGCGAATAATTCTATCT
AGTTTGGCTAAAGATCGCAAATTTAACGTGTTCCTCAATCCAGTTGACGT
GACTGAAGTTCCGGACTACTATTCCATAATTTCCAATCCAATAGATTTGA
GCACAATGAGACAAAAAGTCGATCTGTACAATTACAACACATTTGATGAA
TTTAAAAATGATCTACACCTCATAACCGCTAATGCTTTGCTATATAATCC
ACCAAGAAATTCCTATTTAAAAGATATTCGTCGTCATGCTTATGAATTCA
ATGATATTGCTGAAACCATTTTCGAAGATCACTGGAGTCCTGAGTTCGAT
AGAATCGTCAAAGATATCCATGAAGCTCGGTTGAATCGCAATTACTATGA
TAAAGTTAAGCAAATGGTCAACAATCAGACTGAGGAAATACGAGAATTTC
TTGTCGATTTGAATGGATGCAAATTTGGAATACCAAATGGACCTTTGATT
AAAACTCAATTAATGTTATATGATAAATATTATAAATCCGAGGAACCATT
CGCAACTAGCAAAGAGCGCAAATCTCATTCAGACAGCGAAGCAAGTGTGA
AAAGATCACCAATGGAAACGAAATATAAAAAATCCAAATCCATTAATGAT
CTCGATTTCACACAAACAGATAATAACCATTCCACATTGATGGAATCGTT
TAAGGAGCTACAATCTAATTTAGGAAGCAATGCCCTTGTGACCATTGATG
TGGATCAGTCTATTTCTGATCCGAAATTATTGGAAATGTCGCCTCCTGAG
CCAGTTGTAATAGATTTGTCGGAACTGGAGGAAATTATCCATCATGTTGC
CAGTCTAACTGATTGCTCAACAATTCTCCAGCTTGAAGAAATTTATTTCG
TTCTATCAAAAGAAATTTCCAAATTTTTCATTTGTTCAGACCGATCGATT
TTACCGAAGAATCTTCGTCAAATTATCGACAGCTATTTTCAAAAAGTTTA
GGGATTTTTATACTGTTGATATCAATTTTGTATTATGTTGTAACTCTGGG
AATCTTTGCCATTCCTTTTGGTTTTTTTAC
back to top

protein sequence of SMED30003605-orf-1

>SMED30003605-orf-1 ID=SMED30003605-orf-1|Name=SMED30003605-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1185bp
MVVTRNSGLSENFRASKRILRDIKSRKSLRPRVSIPNYREESPEEGGFAI
FHKILEVDVNNKKSVSHKLKFRSSNRKKAFKEFHRFKLTTSANKNNQSAD
EKEENNNTEFPNKSDEKVDLVSNPKIIKNDDNSKANTATDTPKPDLNTKD
TKKFIYSKNNERTFKRRISASYSRLPEKDNSQKCFESGRRYPSRLRRQPK
EVYRVNCNFKTDKKSDWRDSLTSPIHNIFNDGKHRKFELHSKQSNTDDSD
EQFNDEIRFEKRKLQSVQRARSELNPINLSKNELKMDLFNDRNVTRANFA
DIEPMAIDRSITFSMIGGNKKYIQALKESVILPLVYPEVFKKLGISPPRG
LLFYGPPGSGKTLLARALVNECSLNNNCKLAFFMRKGADCLSKWVGESER
QLRLLFDQAYKMRPSIIFFDEIDGLAPVRSVRQDQIHSSIVSTLLSLIDG
LDDRGEIIVIGATNRIDAIDPALRRPGRFDREFMFMLPEERERRDIIRIH
TRDWKPQLSDEMITSIASVTKGFSGADIKGLVVEAGLCALRRRYPQIYSN
HNKLELNLNEIFVKEDDFKVAIKTIRPSNERSSFPLHSYMPHRIKLLLHQ
DYCLFKEKITKCFQGIVFPSDNPLNAKLDCDLLDCHWDSSIQSFSSLFKP
RLLVTGFAIEQLISGIFHEISGVNILSFDSICLGINNGLSAEEKLCHIFR
EADKTSKSIVFLPHIDITFHSLTLSGQNLLLQMVRSHNLNPDLFIRTILI
LTTLSNSVIDNWSNVEFDNIQSTQIWAELGKCFQSNLINIQAPDFHQRYT
YFNELVSLSIKPLDKSIDSNSNLNPADEVLKEAEMKPKTLSSQELEKLEI
EEDVVLRKFRMLLRIILSSLAKDRKFNVFLNPVDVTEVPDYYSIISNPID
LSTMRQKVDLYNYNTFDEFKNDLHLITANALLYNPPRNSYLKDIRRHAYE
FNDIAETIFEDHWSPEFDRIVKDIHEARLNRNYYDKVKQMVNNQTEEIRE
FLVDLNGCKFGIPNGPLIKTQLMLYDKYYKSEEPFATSKERKSHSDSEAS
VKRSPMETKYKKSKSINDLDFTQTDNNHSTLMESFKELQSNLGSNALVTI
DVDQSISDPKLLEMSPPEPVVIDLSELEEIIHHVASLTDCSTILQLEEIY
FVLSKEISKFFICSDRSILPKNLRQIIDSYFQKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041569AAA_lid_3
IPR036427Bromodomain-like_sf
IPR001487Bromodomain
IPR003593AAA+_ATPase
IPR003959ATPase_AAA_core
IPR027417P-loop_NTPase
IPR003960ATPase_AAA_CS
IPR018359Bromodomain_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003682chromatin binding
GO:0016887ATPase activity
GO:0070577lysine-acetylated histone binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: biological process
TermDefinition
GO:0031936negative regulation of chromatin silencing
GO:0045944positive regulation of transcription from RNA polymerase II promoter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 922..941
score: 33.7
coord: 874..887
score: 30.75
coord: 888..904
score: 49.74
coord: 904..922
score: 22.54
IPR001487BromodomainSMARTSM00297bromo_6coord: 852..960
e-value: 9.4E-22
score: 88.3
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 866..945
e-value: 2.6E-21
score: 75.5
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 879..941
score: 18.447
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 347..490
e-value: 2.9E-18
score: 76.7
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 515..550
e-value: 1.7E-9
score: 37.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 309..582
e-value: 4.7E-82
score: 277.4
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 488..575
e-value: 4.7E-82
score: 277.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 88..146
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..124
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 126..144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1035..1062
NoneNo IPR availablePANTHERPTHR23069:SF0TAT-BINDING HOMOLOG 7coord: 70..984
NoneNo IPR availablePANTHERPTHR23069TAT-BINDING HOMOLOG 7coord: 70..984
NoneNo IPR availableCDDcd00009AAAcoord: 317..487
e-value: 8.855E-26
score: 102.224
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 351..485
e-value: 6.1E-39
score: 133.5
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 848..982
e-value: 8.0E-35
score: 121.3
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 854..964
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 457..475
IPR018359Bromodomain, conserved sitePROSITEPS00633BROMODOMAIN_1coord: 876..933
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 309..582