FYVE_2 domain-containing protein
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30003595 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of FYVE_2 domain-containing protein vs. TrEMBL
Match: A0A267DWZ0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009117g1 PE=4 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 4.985e-8 Identity = 23/43 (53.49%), Postives = 31/43 (72.09%), Query Frame = 2 Query: 104 SRIDDLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLL 232 S+ + +CSICQKKRH+ +SSG W+HGL H P +S+Q LL Sbjct: 269 SKFAEWMCSICQKKRHLAMSSGAWYHGLRHQP----ISLQTLL 307 HSP 2 Score: 30.0314 bits (66), Expect = 4.985e-8 Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = 3 Query: 51 CVNCGRKVCNECGMYNSDPGS 113 C +C R VC +CG + +D GS Sbjct: 249 CTDCNRLVCYDCGNFCNDSGS 269
BLAST of FYVE_2 domain-containing protein vs. TrEMBL
Match: A0A267DFR7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014632g1 PE=4 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 4.986e-8 Identity = 23/43 (53.49%), Postives = 31/43 (72.09%), Query Frame = 2 Query: 104 SRIDDLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLL 232 S+ + +CSICQKKRH+ +SSG W+HGL H P +S+Q LL Sbjct: 269 SKFAEWMCSICQKKRHLAMSSGAWYHGLRHQP----ISLQTLL 307 HSP 2 Score: 30.0314 bits (66), Expect = 4.986e-8 Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = 3 Query: 51 CVNCGRKVCNECGMYNSDPGS 113 C +C R VC +CG + +D GS Sbjct: 249 CTDCNRLVCYDCGNFCNDSGS 269
BLAST of FYVE_2 domain-containing protein vs. TrEMBL
Match: A0A1I8JL15 (FYVE_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 5.057e-8 Identity = 23/43 (53.49%), Postives = 31/43 (72.09%), Query Frame = 2 Query: 104 SRIDDLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLL 232 S+ + +CSICQKKRH+ +SSG W+HGL H P +S+Q LL Sbjct: 66 SKFAEWMCSICQKKRHLAMSSGAWYHGLRHQP----ISLQTLL 104 HSP 2 Score: 30.0314 bits (66), Expect = 5.057e-8 Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = 3 Query: 51 CVNCGRKVCNECGMYNSDPGS 113 C +C R VC +CG + +D GS Sbjct: 46 CTDCNRLVCYDCGNFCNDSGS 66
BLAST of FYVE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1) HSP 1 Score: 97.0561 bits (240), Expect = 3.506e-25 Identity = 43/51 (84.31%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 83 MWNVQ**SRIDDLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 235 M+N S DLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL Sbjct: 182 MYNSDPGSTFADLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 232 HSP 2 Score: 86.2705 bits (212), Expect = 1.887e-21 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 3 Query: 3 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 116 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST Sbjct: 153 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 190
BLAST of FYVE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1) HSP 1 Score: 97.0561 bits (240), Expect = 3.575e-25 Identity = 43/51 (84.31%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 83 MWNVQ**SRIDDLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 235 M+N S DLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL Sbjct: 182 MYNSDPGSTFADLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 232 HSP 2 Score: 89.3521 bits (220), Expect = 1.639e-22 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 3 Query: 3 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 116 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST Sbjct: 153 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 190
BLAST of FYVE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1) HSP 1 Score: 97.0561 bits (240), Expect = 3.577e-25 Identity = 43/51 (84.31%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 83 MWNVQ**SRIDDLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 235 M+N S DLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL Sbjct: 182 MYNSDPGSTFADLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 232 HSP 2 Score: 89.3521 bits (220), Expect = 1.640e-22 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 3 Query: 3 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 116 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST Sbjct: 153 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 190
BLAST of FYVE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1) HSP 1 Score: 97.0561 bits (240), Expect = 3.583e-25 Identity = 43/51 (84.31%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 83 MWNVQ**SRIDDLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 235 M+N S DLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL Sbjct: 182 MYNSDPGSTFADLLCSICQKKRHIILSSGMWFHGLCHDPFPKTLSIQDLLL 232 HSP 2 Score: 88.9669 bits (219), Expect = 2.055e-22 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 3 Query: 3 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 116 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST Sbjct: 153 ICSKSVIQTDSTVNLACVNCGRKVCNECGMYNSDPGST 190 The following BLAST results are available for this feature:
BLAST of FYVE_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 3
BLAST of FYVE_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of FYVE_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 4
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30003595 ID=SMED30003595|Name=FYVE_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=235bpback to top Annotated Terms
The following terms have been associated with this transcript:
|