Structural maintenance of chromosomes protein

Overview
NameStructural maintenance of chromosomes protein
Smed IDSMED30003593
Length (bp)3778
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Structural maintenance of chromosomes protein (SMED30003593) t-SNE clustered cells

Violin plots show distribution of expression levels for Structural maintenance of chromosomes protein (SMED30003593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Structural maintenance of chromosomes protein (SMED30003593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Structural maintenance of chromosomes protein (SMED30003593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003593SMESG000017173.1 SMESG000017172.1 SmedASXL_007932SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003593SMESG000017173.1 SMESG000017172.1 SmedASXL_007932SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v4_3809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003593SMESG000017173.1 Contig34662uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003593SMESG000017173.1 Contig34662newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
central nervous systemSMED30003593SMESG000017173.1 DN314844ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30003593SMESG000017173.1 DN314844ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30003593SMESG000017173.1 DN314844ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30003593SMESG000017173.1 SMESG000017172.1 dd_Smed_v6_3809_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30003593SMESG000017176.1 SMESG000017172.1 SMESG000017171.1 Contig14728uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003593SMESG000017176.1 SMESG000017172.1 SMESG000017171.1 Contig14728newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC3 (structural maintenance of chromosomes 3 [Source:HGNC Symbol;Acc:HGNC:2468])

HSP 1 Score: 1142.1 bits (2953), Expect = 0.000e+0
Identity = 619/1222 (50.65%), Postives = 871/1222 (71.28%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E +  +  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V++ FR K G + HV  GY+G ++    C   FYT VEVTAG RLFYH+V+++E+  KIL E NK N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + +   + L+  +E  ++ EK++ D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRK-GINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG 1217          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC2 (structural maintenance of chromosomes 2 [Source:HGNC Symbol;Acc:HGNC:14011])

HSP 1 Score: 94.7449 bits (234), Expect = 7.567e-19
Identity = 53/175 (30.29%), Postives = 91/175 (52.00%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHI 3660
            I+  ++ LD +K +A+ + +++V+  F  IF  L+P   A L   +G+   T+LD                  G+E     G+   +++ +LSGGQ+SLVAL+LI ++    PAP Y+ DE+DAALD  + + +  M++     +QFI  + +  M   A   +  KF + VS +
Sbjct: 1015 ILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQ---TVLD------------------GLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTV 1168          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC2 (structural maintenance of chromosomes 2 [Source:HGNC Symbol;Acc:HGNC:14011])

HSP 1 Score: 94.7449 bits (234), Expect = 7.567e-19
Identity = 53/175 (30.29%), Postives = 91/175 (52.00%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHI 3660
            I+  ++ LD +K +A+ + +++V+  F  IF  L+P   A L   +G+   T+LD                  G+E     G+   +++ +LSGGQ+SLVAL+LI ++    PAP Y+ DE+DAALD  + + +  M++     +QFI  + +  M   A   +  KF + VS +
Sbjct: 1015 ILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQ---TVLD------------------GLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTV 1168          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC2 (structural maintenance of chromosomes 2 [Source:HGNC Symbol;Acc:HGNC:14011])

HSP 1 Score: 94.7449 bits (234), Expect = 7.567e-19
Identity = 53/175 (30.29%), Postives = 91/175 (52.00%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHI 3660
            I+  ++ LD +K +A+ + +++V+  F  IF  L+P   A L   +G+   T+LD                  G+E     G+   +++ +LSGGQ+SLVAL+LI ++    PAP Y+ DE+DAALD  + + +  M++     +QFI  + +  M   A   +  KF + VS +
Sbjct: 1015 ILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQ---TVLD------------------GLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTV 1168          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC4 (structural maintenance of chromosomes 4 [Source:HGNC Symbol;Acc:HGNC:14013])

HSP 1 Score: 84.7297 bits (208), Expect = 1.055e-15
Identity = 177/696 (25.43%), Postives = 303/696 (43.53%), Query Frame = 1
Query: 1684 VQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRL--HARESVYPETNDAIPMMSRLTF--DAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKE-TVRAKH---EM--TFDKLKKDIY-LWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRE---SYQVELGTDLLTQLSTSEQREVDKLNETIQGLT---IKAKEAYTERM------CLEAEKTENETL--LDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQL----ENLRSQEKDYADSI-----QDDQQNXXXXXXXXXXXXXXXXXTLRKIR-----EIGSLPADALEKF-NDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVS----YNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            + G YG L +L    D  Y     +    L Y VV++ ++  + +  + + N  G   F  ++++   A++    +T +  P +  L    D K +         TLV  +++ AT +A  K+  +  VTL G  + + GT+TGG       R+      +  E E+ + E+  QN    K+ +   I E   K+Q +E  V+ +H   EM  T +K    I  L ++E++   + K + E  + +   D ++ K   E   +++ E   D + + +   + EV +L+ TI  +    +KA++   +++      C  A       +   D NL + +D +     E+ +T+  + + +   EL++++++     K  N++EE L E+Q+E R L  +L    EN  + +KD A SI     Q D    E     +    +  + +L  I      EI  L  + LE   N  ++     LL+    E+K     N  A+ ++      Y +   +L K   E D   QA  DL K    Q+    +  F  +++  +E ++ L   G AEL           L D  DP S           GI  S        K +  LSGG+K+L +L L+FA+    P P Y  DEIDAALD +    VA  I   +K+AQFI  + R  M E ++R  G+
Sbjct:  612 IPGIYGRLGDL-GAIDEKYDVAISSCCHALDYIVVDSIDIAQECVNFLKRQNI-GVATFIGLDKMAVWAKKMTEIQTPENTPRLFDLVKVKDEKIRQAFYFALRDTLVADNLDQATRVAYQKDRRWRVVTLQGQIIEQSGTMTGGGSKVMKGRMGSSLVIEISEEEVNKMESQLQN--DSKKAMQ--IQE--QKVQLEERVVKLRHSEREMRNTLEKFTASIQRLIEQEEYLNVQVK-ELEANVLATAPDKKKQKLLEENVSAFKTEY--DAVAEKAGKVEAEVKRLHNTIVEINNHKLKAQQDKLDKINKQLDECASAITKAQVAIKTADRNLQKAQDSVLRTEKEIKDTE--KEVDDLTAELKSLEDKAAEVVKNTNAAEESLPEIQKEHRNLLQELKVIQENEHALQKD-ALSIKLKLEQIDGHIAEHNSKIKYWHKEISKISLHPIEDNPIEEISVLSPEDLEAIKNPDSITNQIALLEARCHEMKP----NLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK----QRLNEFMAGFYIITNKLKENYQMLTLGGDAEL----------ELVDSLDPFSE----------GIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGI 1265          

HSP 2 Score: 58.151 bits (139), Expect = 1.299e-7
Identity = 48/180 (26.67%), Postives = 78/180 (43.33%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPR-VVSAYVEIIFDNSDNR-------IPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLA-------TAPDNQRLKLLREVAGT 591
            + I  ++ Q F+SY  +   G F    + I+G NGSGKSN   ++ FV       +  ++   L+H     + + S  VE+ F    ++       IP     VS R    +    Y +  K  T  DV NLL S G    +  +++ QG++ Q+A       T  D   L+ L ++ G 
Sbjct:   82 LMITHIVNQNFKSYAGEKILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVIPNSNFYVS-RTACRDNTSVYHISGKKKTFKDVGNLLRSHGIDLDHNRFLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGC 260          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-3 (Structural maintenance of chromosomes protein 3 [Source:UniProtKB/Swiss-Prot;Acc:B2FDA8])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 497/1229 (40.44%), Postives = 772/1229 (62.82%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRI-PFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDI---KRKLDE------IKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRL-KEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAI---KDKENTIRKLSDEIDSDIKR-IEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFRE--KFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHA-RESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETEN--VQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTG--GDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            M IK+V I GFRSY+D T    F P  N++VGRNGSGKSNFF AIQFVLSDEY+HL  ++R+ LLHE TGP+V  A VEI FDNS+ R+  F+ +EV + R +G KKDQY++D KMV + +V+NL+ESAGFSRSNPYYIVKQGKI +LAT+PD  +LKLLREVAGTRVYDERKEES +I KE++ K ++I  LL  ID+RL+TLE+E ++LKEYQK D+ +RS+E+T++D   K+    K KLDE       KD   +S +N  D+     K   D +KLE   R LR  KE    +E + ++          +     +N+  T +R G   R  A+  LQ V  +I + ++ L+ IKP+Y     +E  +   +   E R KE+ AKQG+ +QF S   RD++++ +++ ++  I   K++E TI+K   E+ +D++R  E L NE+      ++  R E++  + +   L+++ D     +QT  R+E  ++ ++ N   +++     LR I  + + NG+  VR+VIE F+   + G    V+ GYYGT+IEL   PD F T+VEV A  RLFYHVVE + +  KIL++ N+   PGEINFFP+NR+ A R+      ++A PM   + ++ ++  V        ++ R+++ A    +N  FD V++DGDQ+S++G +TGG+ D++ S+LEL  +K +   E+ E +    +   + R+   ++   +I +++Q+ E           +L +      ++ +  T  K  K+ +L  +++ L ++   +E+++ E+G+++ +QL++ E++ V KL + +  +T +       RM L   K   E LL   L + K+ L A + ++S+ +   +L+ A  +L ++  R+E+ +KQ+ ++  +L + + +++ L+  ++N+  Q++D      D Q   +K+ +K+ ++ +K+E++L+K+R +G+LP D   K+ +   ++L K L +   E+K+Y +VNKKALDQ+++ + +KE+L KR  E  K   +I +L+K L+++KYEAI LTFKQV   F+++FK+LVP GR ++ +R  +      DDEE     I  VE + G+ + VSF    GD++ ++M QLSGGQKSLVAL +IF+IQKCDPAPFYLFDEIDAALD Q+RK+VADMI+ LS  AQF+TTTFRPE+L  AE+FYGV+FRNKVSHID V++E+A DFVEDD THG
Sbjct:    1 MKIKEVRITGFRSYKDNTNVSGFSPRSNVVVGRNGSGKSNFFHAIQFVLSDEYAHLKEEQRLGLLHESTGPKVAHARVEITFDNSEKRLMAFENSEVKIVRQVGKKKDQYYIDNKMVPRAEVVNLMESAGFSRSNPYYIVKQGKINELATSPDAYKLKLLREVAGTRVYDERKEESLKILKETKMKTEKIQGLLKYIDERLQTLENEKEDLKEYQKLDKTKRSVEYTMYDNTNKEAIKEKTKLDEQKVELNQKDNNVKSQLN--DVIAEMAKLKTDKKKLESLGRGLREDKETLQAEETKMVEE-----KMTLKLEIDSLNEENTRERQG---RQNAEHSLQGVGDEIFKNEEELDTIKPEYAKLLEEESRLKTDIRIDESRAKEILAKQGQRSQFSSVDDRDKFLRNEIRRISGLIADNKEREETIQK---EL-ADVEREDEKLNNEIQSISRTIDENRYEMDTFAAKSTSLKQEYDAAYVAQQTAAREEKAIRDKIGNTEQDISAANDQLRRIVARPVYNGITGVRKVIEEFKHDNRNGQHDDVINGYYGTVIELAEVPDMFRTAVEVIAQNRLFYHVVETDRIATKILRKFNEMQLPGEINFFPMNRVSAPRQRDLSNNSNARPMSDVIDYEVQYDKVFKSITANVIIVRTLDQAARDLRNEGFDVVSVDGDQMSKKGVMTGGFIDKKRSKLELHTQKDRFTKELAELQKSLAEAEKMVRERTQEA--EKIRNRMQQHENQIGDFHRKHRELTEAKNAISQQFYMVTSTKEPKKDQLLGIKNHLRELLAQKENFEQEIGSNMSSQLTSDEEQTVKKLRKKVDEMTKQLATVSRRRMDLMHRKNAIENLLTKKLYKTKESLTARVDDISDNERRHKLENANAQLTSLLTRMESTRKQLATAISELQDYETKEKALQINIDNVLEQQRDLEKQQADFQLQYDKITAKEDEVKQKREDSLKKMRLLGALPTDTFSKWQNVKPRELEKKLLECVNELKKYENVNKKALDQYMTASSQKEELTKRMAEQKKSEDSIEELLKVLENRKYEAIDLTFKQVKKNFEQVFKQLVPHGRGKMQMRAREQ----RDDEE----GINSVELYEGISVLVSFVSDDGDSETREMTQLSGGQKSLVALAIIFSIQKCDPAPFYLFDEIDAALDAQHRKSVADMIQSLSDQAQFVTTTFRPELLATAEKFYGVRFRNKVSHIDSVTREQAYDFVEDDTTHG 1205          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-3 (Structural maintenance of chromosomes protein 3 [Source:UniProtKB/Swiss-Prot;Acc:B2FDA8])

HSP 1 Score: 292.352 bits (747), Expect = 3.415e-89
Identity = 163/337 (48.37%), Postives = 242/337 (71.81%), Query Frame = 1
Query: 2713 IEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTG--GDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            +E+ +KQ+ ++  +L + + +++ L+  ++N+  Q++D      D Q   +K+ +K+ ++ +K+E++L+K+R +G+LP D   K+ +   ++L K L +   E+K+Y +VNKKALDQ+++ + +KE+L KR  E  K   +I +L+K L+++KYEAI LTFKQV   F+++FK+LVP GR ++ +R  +  D    DEE     I  VE + G+ + VSF    GD++ ++M QLSGGQKSLVAL +IF+IQKCDPAPFYLFDEIDAALD Q+RK+VADMI+ LS  AQF+TTTFRPE+L  AE+FYGV+FRNKVSHID V++E+A DFVEDD THG
Sbjct:    1 MESTRKQLATAISELQDYETKEKALQINIDNVLEQQRDLEKQQADFQLQYDKITAKEDEVKQKREDSLKKMRLLGALPTDTFSKWQNVKPRELEKKLLECVNELKKYENVNKKALDQYMTASSQKEELTKRMAEQKKSEDSIEELLKVLENRKYEAIDLTFKQVKKNFEQVFKQLVPHGRGKMQMRAREQRD----DEE----GINSVELYEGISVLVSFVSDDGDSETREMTQLSGGQKSLVALAIIFSIQKCDPAPFYLFDEIDAALDAQHRKSVADMIQSLSDQAQFVTTTFRPELLATAEKFYGVRFRNKVSHIDSVTREQAYDFVEDDTTHG 329          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-3 (Structural maintenance of chromosomes protein 3 [Source:UniProtKB/Swiss-Prot;Acc:B2FDA8])

HSP 1 Score: 284.648 bits (727), Expect = 1.194e-78
Identity = 147/267 (55.06%), Postives = 197/267 (73.78%), Query Frame = 1
Query: 2923 IREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTG--GDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            +R +G+LP D   K+ +   ++L K L +   E+K+Y +VNKKALDQ+++ + +KE+L KR  E  K   +I +L+K L+++KYEAI LTFKQV   F+++FK+LVP GR ++ +R  +  D    DEE     I  VE + G+ + VSF    GD++ ++M QLSGGQKSLVAL +IF+IQKCDPAPFYLFDEIDAALD Q+RK+VADMI+ LS  AQF+TTTFRPE+L  AE+FYGV+FRNKVSHID V++E+A DFVEDD THG
Sbjct: 1003 MRLLGALPTDTFSKWQNVKPRELEKKLLECVNELKKYENVNKKALDQYMTASSQKEELTKRMAEQKKSEDSIEELLKVLENRKYEAIDLTFKQVKKNFEQVFKQLVPHGRGKMQMRAREQRD----DEE----GINSVELYEGISVLVSFVSDDGDSETREMTQLSGGQKSLVALAIIFSIQKCDPAPFYLFDEIDAALDAQHRKSVADMIQSLSDQAQFVTTTFRPELLATAEKFYGVRFRNKVSHIDSVTREQAYDFVEDDTTHG 1261          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: mix-1 (Mitotic chromosome and X-chromosome-associated protein mix-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09591])

HSP 1 Score: 107.457 bits (267), Expect = 4.384e-23
Identity = 69/227 (30.40%), Postives = 118/227 (51.98%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS----DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRI-PFDK---TEVSLRRIIGNKKD------QYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELL-SSIDDRLRTLESETKELKE 732
            M+IK + + GF+SY+  T   +F P  N I G NGSGKSN   +I F++     D     S  E I+  H GT      A V++ FDN+D R  PF      E+ ++RII  +         Y L+    T   + +     G + +NP++++ QG+IT +      + L ++ E AGT++YD++K+++++     +AK+ +++ +  SSID R+     + K + E
Sbjct:    1 MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAKSMHELIS--HGGT-----KAIVQVRFDNTDKRCSPFGMEHLDEIVVQRIITAQATGKGCATSYTLNGHAATNGKMQDFFRGVGLNVNNPHFLIMQGRITTVLNMKPEEILGMVEEAAGTKMYDQKKKDAEKTMFLKDAKLKEVDRIFQSSIDPRMVKFREDRKNMVE 220          

HSP 2 Score: 93.2041 bits (230), Expect = 7.924e-19
Identity = 56/165 (33.94%), Postives = 88/165 (53.33%), Query Frame = 1
Query: 3148 MKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKD-MNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKF 3639
            +  LD +K + ++   + V+  F +IF  L+PD  A L+  +GK              ++ E     G+ ++VSF G    +KD +++LSGGQ+SLVAL+LI A+ K  PAP Y+ DE+DAALD  +   +  MIK      QFI  + +  M   A+  +  +F
Sbjct: 1034 IATLDKKKVDELIRAHESVNKDFGQIFNCLLPDAHASLVPPEGK--------------TVCE-----GLEVKVSFGG---VVKDSLHELSGGQRSLVALSLILAMLKFKPAPLYILDEVDAALDLSHTANIGMMIKTHFHHNQFIIVSLKQGMFSNADVLFQTRF 1176          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-4 (Structural maintenance of chromosomes protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q20060])

HSP 1 Score: 75.8702 bits (185), Expect = 1.950e-13
Identity = 37/93 (39.78%), Postives = 52/93 (55.91%), Query Frame = 1
Query: 3355 GIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            GI           K +  LSGG+K+L +L LIFA+    P PFY+ DEIDAALD +    +A  ++  +++AQFI  + R  M E A R  G+
Sbjct: 1260 GISFMVRPAKKAWKQIQFLSGGEKTLSSLALIFALHMFRPTPFYVMDEIDAALDYRNVSIIAQYVRQKTENAQFIIISLRNNMFELANRLVGI 1352          

HSP 2 Score: 58.151 bits (139), Expect = 5.002e-8
Identity = 39/153 (25.49%), Postives = 68/153 (44.44%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPR----VVSAYVEIIFDNSDNRIPFDKTEVSLRRI-IGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLA 540
            + I+ V +  F+SY  +   G F      I+G NGSGKSN   ++ FV     S +   +  NL+H+  G       V+ + + I D   +      +E ++ R    N    Y +D +  TK +V   L        +  +++ QG++ Q+A
Sbjct:   90 LMIRNVEVDNFKSYFGKASIGPFHKSFTSIIGPNGSGKSNLIDSLLFVFGFRASKIRSAKVSNLIHKSAGRNPDKCTVTIHFQRIVDIPGHYEVVKDSEFTISRTAFQNNSSSYAIDGRPATKNEVEARLRRVDIDIEHNRFLILQGEVEQIA 242          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC3 (gene:FBgn0015615 transcript:FBtr0074290)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 563/1211 (46.49%), Postives = 837/1211 (69.12%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSS----VNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            M+IK++IIQGF+SY+DQT    FD  HN++VGRNGSGKSNFF AIQFVLSDE++HL P++R +LLHEGTG RV+SAYVEIIFDNSDNR+P DK E+ LRR+IG KKDQYFL+KK+V + +V+NLLESAGFS SNPYYIVKQGKI Q+ATA D+ RLKLLREVAGTRVYDERKEES  + +E+++K+++I+E L +I+DRL+TLE E +ELKEYQK D+ RR+LE+  ++ ELKD K+ LDE++ +R+ SS    +  ++++KA +K  D    ++++ ++ + K     +E   + +   + L+ + +L L + D     +G   ++ RA ++L+ + + I + +K L+++KP+YE  + KE++    L   E +RKEL+AKQGR +QF SR  RD+WI  ++KS++K  +DK     KL +++  D    +DL  ++    + +E +R +++  +++  +L++ KD+ Q+ R  ++R+E+++ QQL   ++EL+R +  LRS+ GK ILNG DSVR+V++ F E+ G    + + YYG +IE  +C  T YT+VEVTA  RLF+H+VE+E    +IL+E+NK   PGE+ F P+NRL  +   YP+  D+IPM+S+L +D +    + + FGKTL+CR++E AT LAK+   DCVTLDGDQVS +G+LTGGY++   SRLE+QK++ +   +I E E          +  ++ IN I+ ++Q+ ET + K +  F+K++ +I L KEE     + +  KE  L   +  LE M  T+ S + EL  +L++ LS+ +QRE+D+LN+ I+ L  + KEA+T+RM  E  K + + LL +NL R++D+L   + E+S  D   +L   + EL + ++RI+     +   E+++ E  + ++ L+ +LE    +EK+  +++  D + LEK  +K++ L +K +E   KI  +G++P      +   ++K ++K L+KAN+ +K+Y+HVNKKALDQF+S++E+KEKL +RKEELD G Q I  L+++L+ QK EAI  TF+QV+  F ++FKKLVP G   LI++   ++   ++ E + S +      FTG+GI VSFTG +A+M++MNQLSGGQKSLVAL LIF+IQKCDPAPFYLFDEID ALD  +RKAVA+MI  LS  AQFITTTFRPE+LE A +FYGV+FRNKVSHID V++EEA DFVEDD TH 
Sbjct:    1 MHIKQIIIQGFKSYKDQTVVEPFDKRHNVVVGRNGSGKSNFFYAIQFVLSDEFTHLRPEQRQSLLHEGTGARVISAYVEIIFDNSDNRVPIDKEEIFLRRVIGAKKDQYFLNKKVVPRNEVVNLLESAGFSSSNPYYIVKQGKINQMATAADSYRLKLLREVAGTRVYDERKEESLNLLRETDSKVEKISEYLKTIEDRLQTLEEEKEELKEYQKWDKTRRTLEYIRYETELKDTKKALDELQLQRKSSSDKKKIYNIEIQKAQEKIKD----VQKNLKEAKKKVQSTKEERSVLMTEQQQLLREKTKLDLTIVDLNDEVQGDNKSKERADQELKNLKVTIAEREKELDDVKPKYEAMKRKEEDCSRELQLKEQKRKELYAKQGRGSQFSSREDRDKWITNELKSISKQTRDKIAHHAKLVEDLKKDATSEKDLGQKIEEHSSELEQLRLQIDEHNKKYYELKKTKDQHQSMRNELWRKETQMTQQLQTHKEELSRADQALRSMAGKPILNGCDSVRKVLDSFVERGGQSAEIARAYYGPVIENFSCDKTIYTAVEVTAANRLFHHIVESEYEGTQILKEMNKLKLPGEVTFMPLNRLQVKIHDYPDDPDSIPMISKLKYDEQHDKALRYIFGKTLICRNLERATELAKSTGLDCVTLDGDQVSSKGSLTGGYFNTSRSRLEMQKKRTEYTSQIAEFEKKLSKLRNELKSTENNINSIVSEMQKTETKQGKSKDVFEKVQGEIRLMKEELVRIEQYRAPKERSLAQCKASLESMTSTKSSLEAELKQELMSTLSSQDQREIDQLNDDIRRLNQENKEAFTQRMQFEVRKNKLDNLLINNLFRRRDELIQALQEISVEDRKRKLNNCKTELVSAEKRIKKVNSDLEEIEKRVMEAVQLQKELQQELETHVRKEKEAEENLNKDSKQLEKWSTKENMLNEKIDECTEKIASLGAVPL-VDPSYTRMSLKNIFKELEKANQHLKKYNHVNKKALDQFLSFSEQKEKLYRRKEELDIGDQKIHMLIQSLEMQKVEAIQFTFRQVAQNFTKVFKKLVPMGAGFLILKTKDNEGDEMEKEVENSDA------FTGIGIRVSFTGVEAEMREMNQLSGGQKSLVALALIFSIQKCDPAPFYLFDEIDQALDAMHRKAVANMIHELSDTAQFITTTFRPELLENAHKFYGVRFRNKVSHIDCVTREEAKDFVEDDSTHA 1200          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC1 (gene:FBgn0040283 transcript:FBtr0084541)

HSP 1 Score: 105.531 bits (262), Expect = 2.177e-22
Identity = 169/735 (22.99%), Postives = 321/735 (43.67%), Query Frame = 1
Query:   94 TMYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGT--GPRVVSAYVEIIFD-NSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRV----YDERKEE--------------SKQIFKE-SEAKMDQINELLSSIDDRLRTLESETKELK-EYQ-----KCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQ----MKSLNKAIKDKENTI--------------RKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRR-----VIEIFREKFGSDCHVVQGYYGTLIELINCPDT---FYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDA-KF-----QNVMLHNFGKTLVCRSIEIATTLAKNLN---FDCVTLDGDQVSRRGTLTGGYYD 2109
            T +++ + ++ F+SYR     G      N ++G NGSGKSNF  AI FV+ ++ S L  +   +L+H  +   P   S YV   F  N +  + F       R +IG    +Y ++ + V+ +  +N LE  G +     ++V QG +  +A     +R  L  E++G+ +    Y+  K+E               K I  E  EAK +++        DR   L++E  E + EYQ       +RD R      F  +L+  ++++  ++ R+E +     + +K A K   D+ K++++ R+    E QM ++   +     EK+   ++  + +     T R   NA     + L++ +  ++ ++KR              EDE+ N   +++ R K +  ++G V ++    Q  E    Q    + S+N+  K +++T+              +KL+ + +  +KR + L++ +  ++A +E              +  R KDE++ D  T   + ++ Q++L ++RD+L           G +  +  +  RR     V+E+F+++       V G Y  +I +  C  T   +  +V    G  +   +V+ E+     +Q + +     E  F P++ L  +       N + P   RL FD  KF     +  +L   G  LVC + E A  +A  ++   FD + LDG    + G ++GG +D
Sbjct:   24 TAFLEYIEMENFKSYRGHIVVGPL-KQFNAVIGPNGSGKSNFMDAISFVMGEKTSSLRVKRLNDLIHGSSIGKPVSRSCYVTAKFVLNEERHMDFQ------RAVIGG-SSEYRINGESVSSSTYLNKLEKIGINVKAKNFLVFQGAVENIAMKTPKERTALFEEISGSGLLKDDYNRLKQEMIVAEEETQFTYQKKKGIAAERKEAKHEKMEA------DRYTRLQNEYNEKQVEYQLFRLFHVERDIRK-----FTSDLEVRQQEVKAVEQRKEAADEILREKKKDAGKITRDLAKIDQEIREF---ETQM-NKRRPLYIKAKEKVTHCKKKLISLQKTLETAREADNAHQSDIRKLEKQLADVEALKKRF-------------EDEIEN---ESQRRGKSVNMEEGLVQEYDRLKQEAEATATQYRSELDSVNREQKSEQDTLDGETNRRASVEESFKKLTLQREEAVKRRDKLMDHIKSSQAALE--------------EQNRIKDELRRDVGTSKEKIAEKQRELEDVRDQL-----------GDAKSDKHEDARRKKKQEVVELFKKQ-------VPGVYDRMINM--CQPTHKRYNVAVTKVLGKFMEAIIVDTEKTARHCIQILKEQMLEVE-TFLPLDYLQVKPLKERLRNISDPRNVRLVFDVLKFEPQEIERAVLFATGNALVCETPEDAMKVAYEIDRSRFDALALDGTFYQKSGLISGGSHD 684          

HSP 2 Score: 71.2478 bits (173), Expect = 5.135e-12
Identity = 43/151 (28.48%), Postives = 67/151 (44.37%), Query Frame = 1
Query: 3181 IVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
             V   + +S     I+KKL  +  A+  I     ++  LD                  GI  +      + + MN LSGG+K++ AL L+F+     PAPF++ DEIDAALD      VA  I+  + + Q I  + + E    A+   G+
Sbjct: 1083 FVACCQHISDAIDGIYKKLARNEAAQAYIGPDNPEEPYLD------------------GINYNCVAPGKRFQPMNNLSGGEKTIAALALLFSTHSFHPAPFFVLDEIDAALDNTNIGKVASYIRDHTTNLQTIVISLKEEFYGHADALVGI 1215          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC2 (gene:FBgn0027783 transcript:FBtr0087461)

HSP 1 Score: 86.2705 bits (212), Expect = 1.354e-16
Identity = 53/161 (32.92%), Postives = 81/161 (50.31%), Query Frame = 1
Query: 3199 QVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHID-QVSKE 3678
            +V+  F  IF  L+P   A+L      H +  L                TG+ I+V F G     + + +LSGGQKSLVAL+L+ A+ K  PAP Y+ DE+DAALD  + + +  M+K    ++QF+  + +  +   A   +   F   VS I  QVS++
Sbjct: 1034 EVNTNFSGIFSSLLPGAEAKL---NPVHTNGCL----------------TGLEIKVGFNG--IWKESLGELSGGQKSLVALSLVLAMLKFSPAPLYILDEVDAALDMSHTQNIGSMLKQHFTNSQFLIVSLKDGLFNHANVLFRTLFEEGVSTITRQVSRQ 1173          

HSP 2 Score: 62.3882 bits (150), Expect = 3.179e-9
Identity = 44/162 (27.16%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 1684 VQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRL-----------HARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDC--VTLDGDQVSRRGTLTGGYYDQRFSRLE 2130
            V+G  G L ++ +  ++   ++  TAG  L+ +V +++    KILQ   + N    +   PIN++           +A+  V  E  +    MS + +D  ++ VM   FG TL+C+ + +A  ++ +   +C  VTL+GD V   GT++GG   +  + LE
Sbjct:  520 VRGLVGKLFQVKDMQNSM--ALVQTAGGSLYSYVTDDDVTSKKILQ---RGNLQRRVTLIPINKIQSGSLNRNVVEYAQNKVGAE--NVQWAMSLIDYDRYYEPVMKFCFGGTLICKDLIVAKQISYDPRINCRSVTLEGDVVDPHGTVSGGAAPKGANVLE 674          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: glu (gene:FBgn0015391 transcript:FBtr0080935)

HSP 1 Score: 75.8702 bits (185), Expect = 2.624e-13
Identity = 49/156 (31.41%), Postives = 75/156 (48.08%), Query Frame = 1
Query: 3166 QKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            ++Y+  +  F  ++   +E+++ +   G AEL           L D  DP         FT  G+  +        K ++ LSGG+K+L +L L+FA+    P+P Y  DEIDAALD +    V   IK  +K+AQFI  + R  M E A    G+
Sbjct: 1145 RRYKEFMDGFSIITRKLKEMYQMITLGGDAEL----------ELVDSMDP---------FTE-GVNFTVRPPKKSWKYISNLSGGEKTLSSLALVFALHYYKPSPLYFMDEIDAALDFKNVSIVGHYIKERTKNAQFIIVSLRVNMFELANFLVGI 1280          

HSP 2 Score: 56.9954 bits (136), Expect = 1.404e-7
Identity = 53/227 (23.35%), Postives = 100/227 (44.05%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTG-PRVVSAYVEIIF-------DNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATA-PDNQR------LKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKE 732
            + I K++ + F+SY  +   G F      I+G NGSGKSN   ++ FV     + +  +    L+H  +  P + S  V + F       D +   +P D + V  R  + +    Y ++ K     DV  LL+       +  +++ QG++  +A   P  Q       L+ L ++ GT+ Y    ++  Q       ++DQ+ +  +   +R +  E E K+L++
Sbjct:   87 LIISKIVNRNFKSYAGEVELGPFHQSFTAIIGPNGSGKSNVIDSMMFVFGCRANRIRCKRVSTLIHSSSSYPNLRSCSVAVHFKQIVDKGDGTCEDVP-DSSIVIERTAMSDNSSYYQINDKRAQLKDVAKLLKKHHVDLEHNRFLILQGEVESIAMMKPKGQTENETGMLEYLEDIVGTQRYIRPLQQINQ-------RVDQLTDDRTEKHNRCKLAEREMKDLEQ 305          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc3 (structural maintenance of chromosomes 3 [Source:ZFIN;Acc:ZDB-GENE-030131-3196])

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 618/1221 (50.61%), Postives = 867/1221 (71.01%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSS---------IPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE     +  +R A +   D +E+ ER  R+L+ +   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L+E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++   +  E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++    C   FYT VEVTAGTRLFYH+VE +E+  KIL E NK N PGE+ F P+++L  R++ YPETNDAIPM+S+L +   F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +QR VD LN+ I+ L    ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL  I++RI+    +    +  + + + E +  +  +E  ++ EK+  ++I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   T+KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR++ELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  +     DE +   S         +P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID +S E+A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTVVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEDEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKSRISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNTVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEQNKERNLEQYNKLDQDLNEVKTRVEELDKKYYEVKNRKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFECEPAFYTCVEVTAGTRLFYHIVETDEVSTKILMEFNKMNLPGEVTFLPLSKLDVRDTAYPETNDAIPMISKLRYSQNFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDMRKAEEELGELEAKLNENLRRNI----ETINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQRRVDDLNDEIRQLQQDNRQLLNERIKLEGIMTRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELDGINKRIKDTMARSEDLDTLIDKTEVEIKEHQKSMERWKNIEKEQNEAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLTLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQDELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDTEGGQSQDEGEGGDSERASSSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAGHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVISAEQAKDFVEDDTTHG 1216          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc3 (structural maintenance of chromosomes 3 [Source:ZFIN;Acc:ZDB-GENE-030131-3196])

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 564/1151 (49.00%), Postives = 807/1151 (70.11%), Query Frame = 1
Query:  295 EGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSS---------IPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            EGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE     +  +R A +   D +E+ ER  R+L+ +   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L+E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++   +  E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++    C   FYT VEVTAGTRLFYH+VE +E+  KIL E NK N PGE+ F P+++L  R++ YPETNDAIPM+S+L +   F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK  ++  E   +    + +N+ +    +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +QR VD LN+ I+ L    ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL  I++RI+    +    +  + + + E +  +  +E  ++ EK+  ++I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   T+KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR++ELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  +     DE +   S         +P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID +S E+A DFVEDD THG
Sbjct:   16 EGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEDEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKSRISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNTVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEQNKERNLEQYNKLDQDLNEVKTRVEELDKKYYEVKNRKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFECEPAFYTCVEVTAGTRLFYHIVETDEVSTKILMEFNKMNLPGEVTFLPLSKLDVRDTAYPETNDAIPMISKLRYSQNFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDMRKAEEELGELEAKLNENFSS---PINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQRRVDDLNDEIRQLQQDNRQLLNERIKLEGIMTRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELDGINKRIKDTMARSEDLDTLIDKTEVEIKEHQKSMERWKNIEKEQNEAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLTLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQDELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDTEGGQSQDEGEGGDSERASSSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAGHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVISAEQAKDFVEDDTTHG 1162          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 94.3597 bits (233), Expect = 6.999e-19
Identity = 52/182 (28.57%), Postives = 92/182 (50.55%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGV--GIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSK 3675
            I++ ++ LD +K EA+ + +++V+  F  IF  L+P   A L   +G                        GV  G+E     G+   +++ +LSGGQ+SLVAL+LI A+    PAP Y+ DE+DAALD  + + +  M++     +QF+  + +  M   A   +  KF + +S + + ++
Sbjct: 1015 ILETIEELDQKKNEALNVAWQKVNKDFGSIFSTLLPGANARLAPPEG-----------------------CGVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFVVVSLKDGMFTNANVLFKTKFVDGISTVTRTAQ 1173          

HSP 2 Score: 65.4698 bits (158), Expect = 5.110e-10
Identity = 49/161 (30.43%), Postives = 79/161 (49.07%), Query Frame = 1
Query: 1684 VQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHAR-----------ESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRL 2127
            V+G    L  + +  +   T++EV AG RL+  VV+NE    K+L+   K          P+N++ AR           + V P  ++    +S + ++++ +  M + FG TLVC S++ A  +A  K ++   VTL GD    +GTLTGG   Q  S L
Sbjct:  522 VKGLVANLFTVTDVSNA--TALEVVAGGRLYNVVVDNEVTGKKLLE---KGELRRRYTIIPLNKISARTLNDNVVRTAKKLVGP--DNVHTALSLVGYESELRKAMEYVFGTTLVCDSLDNAKKVAFDKGVSTKTVTLGGDVFDPQGTLTGGARAQTASVL 675          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 94.3597 bits (233), Expect = 6.999e-19
Identity = 52/182 (28.57%), Postives = 92/182 (50.55%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGV--GIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSK 3675
            I++ ++ LD +K EA+ + +++V+  F  IF  L+P   A L   +G                        GV  G+E     G+   +++ +LSGGQ+SLVAL+LI A+    PAP Y+ DE+DAALD  + + +  M++     +QF+  + +  M   A   +  KF + +S + + ++
Sbjct: 1015 ILETIEELDQKKNEALNVAWQKVNKDFGSIFSTLLPGANARLAPPEG-----------------------CGVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFVVVSLKDGMFTNANVLFKTKFVDGISTVTRTAQ 1173          

HSP 2 Score: 65.4698 bits (158), Expect = 5.110e-10
Identity = 49/161 (30.43%), Postives = 79/161 (49.07%), Query Frame = 1
Query: 1684 VQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHAR-----------ESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRL 2127
            V+G    L  + +  +   T++EV AG RL+  VV+NE    K+L+   K          P+N++ AR           + V P  ++    +S + ++++ +  M + FG TLVC S++ A  +A  K ++   VTL GD    +GTLTGG   Q  S L
Sbjct:  522 VKGLVANLFTVTDVSNA--TALEVVAGGRLYNVVVDNEVTGKKLLE---KGELRRRYTIIPLNKISARTLNDNVVRTAKKLVGP--DNVHTALSLVGYESELRKAMEYVFGTTLVCDSLDNAKKVAFDKGVSTKTVTLGGDVFDPQGTLTGGARAQTASVL 675          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc4 (structural maintenance of chromosomes 4 [Source:ZFIN;Acc:ZDB-GENE-020419-21])

HSP 1 Score: 77.7962 bits (190), Expect = 7.903e-14
Identity = 53/159 (33.33%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 3157 LDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            L  Q+    +  F  +++  +E ++ L   G AEL           L D  DP S           GI  S        K +  LSGG+K+L +L L+FA+    P P Y  DEIDAALD +    VA  I   +K+AQFI  + R  M E A+R  G+
Sbjct: 1126 LRKQRLHEFMAGFNIITNKLKENYQMLTLGGDAEL----------ELVDSLDPFSE----------GIMFSVRPPKKSWKKIYNLSGGEKTLSSLALVFALHHFKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKNAQFIIISLRNNMFEMADRLIGI 1264          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cryba4 (crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998932])

HSP 1 Score: 1104.74 bits (2856), Expect = 0.000e+0
Identity = 605/1225 (49.39%), Postives = 853/1225 (69.63%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETE---------NVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            Y  +VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+ + K   M +E EQ+ S   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  ++ +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++   +C   FYT VEVTAG RLFYH+V+++E+  KIL E N+ N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK  +K+E E+   E         N++      K         +++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + + E + L   ++  ++ EK++ ++I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL   L  + R++         A+DQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG  A+M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E+A DFVEDD THG
Sbjct:   13 YSFQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETSGEKSRQLRDAQQDARDKMEDIERQVREFKSKISAMKEEKEQLSSERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFSSVKQKEESGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAINKDLEDTEANKEKNLEQYTKLDQDLSEVKARVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFDCEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNRMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNHRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKVEDELHALEAKLNENLRRNIENILCEHKYSYTCDSEPLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLDDQKRVDALNDEIRQLQQENRQLLNERIKLEGTITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTLARSEGLDGTIDKTEVEIKDLVKSMDRWKNMEKEHMEAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLMGPLPPSVRQL--------SAMDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSAEGERGSGAHSSVPSVDQFTGVGIRVSFTGKQAEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELASHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEQAKDFVEDDTTHG 1228          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cryba4 (crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998932])

HSP 1 Score: 1103.2 bits (2852), Expect = 0.000e+0
Identity = 611/1236 (49.43%), Postives = 859/1236 (69.50%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKME-----MEIQETENVQQN-----------YITRKEVLDSGINEIIDKL----QRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            Y  +VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+ + K   M +E EQ+ S   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  ++ +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++   +C   FYT VEVTAG RLFYH+V+++E+  KIL E N+ N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK  +K+E     +E +  EN+++N           Y    E L + IN  ID+L    Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + + E + L   ++  ++ EK++ ++I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQ +  +D +   +         A+DQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG  A+M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E+A DFVEDD THG
Sbjct:   13 YSFQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETSGEKSRQLRDAQQDARDKMEDIERQVREFKSKISAMKEEKEQLSSERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFSSVKQKEESGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAINKDLEDTEANKEKNLEQYTKLDQDLSEVKARVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFDCEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNRMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNHRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKVEDELHALEAKLNENLRRNIENILCEHKYSYTCDSEPLAARINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLDDQKRVDALNDEIRQLQQENRQLLNERIKLEGTITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTLARSEGLDGTIDKTEVEIKDLVKSMDRWKNMEKEHMEAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQ-WGAVDCSTDWL--------SAMDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSAEGERGSGAHSSVPSVDQFTGVGIRVSFTGKQAEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELASHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEQAKDFVEDDTTHG 1238          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cryba4 (crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998932])

HSP 1 Score: 1086.25 bits (2808), Expect = 0.000e+0
Identity = 590/1225 (48.16%), Postives = 829/1225 (67.67%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETE---------NVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            Y  +VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+ + K   M +E EQ+ S   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  ++ +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++   +C   FYT VEVTAG RLFYH+V+++E+  KIL E N+ N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK  +K+E E+   E         N++      K         +++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + + E + L   ++  ++ EK++ ++I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQ  + L K   E+ R                               G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG  A+M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E+A DFVEDD THG
Sbjct:   13 YSFQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETSGEKSRQLRDAQQDARDKMEDIERQVREFKSKISAMKEEKEQLSSERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFSSVKQKEESGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAINKDLEDTEANKEKNLEQYTKLDQDLSEVKARVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFDCEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNRMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNHRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKVEDELHALEAKLNENLRRNIENILCEHKYSYTCDSEPLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLDDQKRVDALNDEIRQLQQENRQLLNERIKLEGTITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTLARSEGLDGTIDKTEVEIKDLVKSMDRWKNMEKEHMEAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQQKEKLIKRQEELDR-------------------------------GYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSAEGERGSGAHSSVPSVDQFTGVGIRVSFTGKQAEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELASHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEQAKDFVEDDTTHG 1205          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cryba4 (crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998932])

HSP 1 Score: 1068.53 bits (2762), Expect = 0.000e+0
Identity = 596/1215 (49.05%), Postives = 841/1215 (69.22%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKME-----MEIQETENVQQN-----------YITRKEVLDSGINEIIDKL----QRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVS 3654
            Y  +VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+ + K   M +E EQ+ S   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  ++ +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++   +C   FYT VEVTAG RLFYH+V+++E+  KIL E N+ N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK  +K+E     +E +  EN+++N           Y    E L + IN  ID+L    Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + + E + L   ++  ++ EK++ ++I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQ +  +D +   +         A+DQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG  A+M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNK S
Sbjct:   13 YSFQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETSGEKSRQLRDAQQDARDKMEDIERQVREFKSKISAMKEEKEQLSSERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFSSVKQKEESGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAINKDLEDTEANKEKNLEQYTKLDQDLSEVKARVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFDCEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNRMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNHRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKVEDELHALEAKLNENLRRNIENILCEHKYSYTCDSEPLAARINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLDDQKRVDALNDEIRQLQQENRQLLNERIKLEGTITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTLARSEGLDGTIDKTEVEIKDLVKSMDRWKNMEKEHMEAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQ-WGAVDCSTDWL--------SAMDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSAEGERGSGAHSSVPSVDQFTGVGIRVSFTGKQAEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELASHAQFITTTFRPELLESADKFYGVKFRNKES 1217          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cryba4 (crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998932])

HSP 1 Score: 1053.12 bits (2722), Expect = 0.000e+0
Identity = 584/1204 (48.50%), Postives = 831/1204 (69.02%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETE---------NVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVS 3654
            Y  +VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+ + K   M +E EQ+ S   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  ++ +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++   +C   FYT VEVTAG RLFYH+V+++E+  KIL E N+ N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK  +K+E E+   E         N++      K         +++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + + E + L   ++  ++ EK++ ++I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQ +  +D +   +         A+DQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG  A+M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYG  FR  +S
Sbjct:   13 YSFQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETSGEKSRQLRDAQQDARDKMEDIERQVREFKSKISAMKEEKEQLSSERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFSSVKQKEESGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAINKDLEDTEANKEKNLEQYTKLDQDLSEVKARVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFDCEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNRMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNHRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKVEDELHALEAKLNENLRRNIENILCEHKYSYTCDSEPLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLDDQKRVDALNDEIRQLQQENRQLLNERIKLEGTITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTLARSEGLDGTIDKTEVEIKDLVKSMDRWKNMEKEHMEAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQ-WGAVDCSTDWL--------SAMDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSAEGERGSGAHSSVPSVDQFTGVGIRVSFTGKQAEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELASHAQFITTTFRPELLESADKFYG--FRGLLS 1204          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc3 (structural maintenance of chromosomes 3 [Source:MGI Symbol;Acc:MGI:1339795])

HSP 1 Score: 1144.03 bits (2958), Expect = 0.000e+0
Identity = 620/1222 (50.74%), Postives = 871/1222 (71.28%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E +  +  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV  GY+G ++    C   FYT VEVTAG RLFYH+V+++E+  KIL E NK N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + +   + L+  +E  ++ EK++ D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG 1217          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 133.65 bits (335), Expect = 5.766e-31
Identity = 178/709 (25.11%), Postives = 320/709 (45.13%), Query Frame = 1
Query: 1699 GTLIELINCPD-TFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPET-----NDAIP-----MMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRL-----------ELQKRKQKM---EMEIQETENVQQNYITRKEVLDSGINEIIDKLQRK--ETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRES--YQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLD---HNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADA--LEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            G +  LIN  D +  T++EV AG RL+  VV+ E    K+L+   K          P+N++ AR  + PET     N   P      +S + +  + Q  M   FG T VC +++ A  +A  K +    VTL GD     GTL+GG   Q  S L           EL+ ++ ++   E E+   +NV + Y   K+  +    E  D LQ K  ++   K +   D LKK I   +E   +  E + + E K  +L + ++  +  RE      +   D     + +  +++ +  + ++ +T++ +E       L+ E   NE  LD     +   + Q+E    EV++    E + +A+DEL    + I A   Q N  ++K AEV   K  L+     L+ +E D++ S     +      + +   +    + +   + +   P  A   +  N K   Q  + L +   ++ R  +VN +A++      E    L+K+K  ++     I+  ++ LD +K +A+ + +++V+  F  IF  L+P   A L   +G+   T+LD                  G+E     G+   +++ +LSGGQ+SLVAL+LI ++    PAP Y+ DE+DAALD  + + +  M++     +QFI  + +  M   A   +  KF + VS + + ++ +A    ++ ++ G
Sbjct:  524 GLVASLINVKDNSTATALEVVAGERLYNVVVDTEVTAKKLLE---KGELKRRYTIIPLNKISAR-CIAPETLRVAQNLVGPDNVHVALSLVDYKPELQKGMEFVFGTTFVCNNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQEVKDVQDELRTKENELRALEEELAGLKNVAEKYRQLKQQWEMKTEEG-DLLQTKLQQSSYHKQQEELDALKKTIEESEETLKSTKEIQKKAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEE-------LKREHASNEQQLDAVNEAIKAYEGQIEKMAAEVAKNK--ESVNKAQDELMKQKQIITA---QDNIIKDKCAEVA--KHNLQNNESQLKIKELDHSIS---KHKREADDAAAKVSKMLSDYDWINAEKHLFGQPNSAYDFKTNNPKEAGQRLQKLQEVKEKLGR--NVNLRAMNVLTEAEERYNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQ---TVLD------------------GLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQSQAGKIPKEAKSRG 1187          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 133.65 bits (335), Expect = 5.766e-31
Identity = 178/709 (25.11%), Postives = 320/709 (45.13%), Query Frame = 1
Query: 1699 GTLIELINCPD-TFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPET-----NDAIP-----MMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRL-----------ELQKRKQKM---EMEIQETENVQQNYITRKEVLDSGINEIIDKLQRK--ETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRES--YQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLD---HNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADA--LEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            G +  LIN  D +  T++EV AG RL+  VV+ E    K+L+   K          P+N++ AR  + PET     N   P      +S + +  + Q  M   FG T VC +++ A  +A  K +    VTL GD     GTL+GG   Q  S L           EL+ ++ ++   E E+   +NV + Y   K+  +    E  D LQ K  ++   K +   D LKK I   +E   +  E + + E K  +L + ++  +  RE      +   D     + +  +++ +  + ++ +T++ +E       L+ E   NE  LD     +   + Q+E    EV++    E + +A+DEL    + I A   Q N  ++K AEV   K  L+     L+ +E D++ S     +      + +   +    + +   + +   P  A   +  N K   Q  + L +   ++ R  +VN +A++      E    L+K+K  ++     I+  ++ LD +K +A+ + +++V+  F  IF  L+P   A L   +G+   T+LD                  G+E     G+   +++ +LSGGQ+SLVAL+LI ++    PAP Y+ DE+DAALD  + + +  M++     +QFI  + +  M   A   +  KF + VS + + ++ +A    ++ ++ G
Sbjct:  524 GLVASLINVKDNSTATALEVVAGERLYNVVVDTEVTAKKLLE---KGELKRRYTIIPLNKISAR-CIAPETLRVAQNLVGPDNVHVALSLVDYKPELQKGMEFVFGTTFVCNNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQEVKDVQDELRTKENELRALEEELAGLKNVAEKYRQLKQQWEMKTEEG-DLLQTKLQQSSYHKQQEELDALKKTIEESEETLKSTKEIQKKAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEE-------LKREHASNEQQLDAVNEAIKAYEGQIEKMAAEVAKNK--ESVNKAQDELMKQKQIITA---QDNIIKDKCAEVA--KHNLQNNESQLKIKELDHSIS---KHKREADDAAAKVSKMLSDYDWINAEKHLFGQPNSAYDFKTNNPKEAGQRLQKLQEVKEKLGR--NVNLRAMNVLTEAEERYNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQ---TVLD------------------GLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQSQAGKIPKEAKSRG 1187          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 122.479 bits (306), Expect = 1.276e-28
Identity = 73/227 (32.16%), Postives = 126/227 (55.51%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS-DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNR---IPF---DKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELL-SSIDDRLRTLESETKELKEYQKCDRD 753
            MY+K +I++GF+SY  +T    FDP  N I G NGSGKSN   +I F+L     S +      +L+++     +  A V I FDNSD +   + F   D+  V+ + +IG + ++Y ++      T V +L  S G + +NP++++ QG+IT++      + L ++ E AGTR+Y+ +K  +++  ++ EAK+ +I  +L   I   ++ L+ E     EYQK  R+
Sbjct:    1 MYVKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEAHDEITVTRQVVIGGR-NKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMRE 226          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc4 (structural maintenance of chromosomes 4 [Source:MGI Symbol;Acc:MGI:1917349])

HSP 1 Score: 77.0258 bits (188), Expect = 1.584e-13
Identity = 56/168 (33.33%), Postives = 77/168 (45.83%), Query Frame = 1
Query: 3130 QAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            QA  DL K    Q+    +  F  +++  +E ++ L   G AEL           L D  DP S           GI  S        K +  LSGG+K+L +L L+FA+    P P Y  DEIDAALD +    VA  I   +K+AQFI  + R  M E ++R  G+
Sbjct: 1095 QAYEDLRK----QRLNEFMAGFYVITNKLKENYQMLTLGGDAEL----------ELVDSLDPFSE----------GIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGI 1238          

HSP 2 Score: 59.6918 bits (143), Expect = 2.626e-8
Identity = 149/722 (20.64%), Postives = 311/722 (43.07%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPR-VVSAYVEIIFDNSDNR-------IPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLA-------TAPDNQRLKLLREVAGT-RVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRE-------LKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGR--------VNQFQSRTQ---RDEWIKE-QMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRT---EHNLRSIT---------GKSILNGLDSVRRVIE-IFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRL--HARESVYPETNDAIPMMSRL--TFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGG 2100
            + I  ++ Q F+SY  +   G F    + I+G NGSGKSN   ++ FV       +  ++   L+H     + + S  VE+ F    ++       +P     VS R    +    Y +  K  T  DV NLL S G    +  +++ QG++ Q+A       T  D   L+ L ++ G  R+ +  K   +++   +E + +++N        R++ +E E   L+  +    +  +LE  +F ++       + D++ ++ EI  ++E+   +T ++ + +   +++++      +D+  K  ++   +EQ                   N  K T+    + + R +  L+    K ++++K+L++ K + E  ++   +    +++   R   L  ++ +        ++  +  TQ   +++ I+E ++   NK++ +  + +     E+D  + R    V++LS A       ++ L   SE L+       E +A  + +  +  + QQ+L     EL +    E NL+S+           KS L    S  +V++ I +EK       + G YG L +L    D  Y     +    L Y VV++ +   + +  + KHN  G   F  ++++   A++    +T +  P +  L    + + +         TLV  +++ AT +A  ++  +  VTL G  + + GT++GG
Sbjct:   55 LMITHIVNQNFKSYAGEKVLGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVLPNSNFYVS-RTAYRDSTSVYHISGKKKTFKDVGNLLRSHGIDLDHNRFLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGCGRLNEPIKVLCRRVEILNEHRGEKLN--------RVKMVEKEKDALEGEKNIAIEFLTLENEMFKKKNHICQYYIYDLQNRIAEITTQKEKIHEDTKEITEKSNVLSNEMKAKNSAVKDVEKKLNKVTKFIEQ-------------------NKEKFTQLDLEDVQVREK--LKHATSKAKKLEKQLQKDKEKVEELKSVPAKSKTVINETTTRNNSLEKEREKEEKKLKEVMDSLKQETQGLQKEKEIQEKELMGFNKSVNEARSKMEVAQSELDIYLSRHNTAVSQLSKA-------KEALITASETLK-------ERKAAIKDINTKLPQTQQELKEKEKELQKLTQEEINLKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGR---IPGIYGRLGDL-GAIDEKYDIAISSCCHALDYIVVDSIDTAQECVNFLKKHNI-GIATFIGLDKMTVWAKKMSKIQTPENTPRLFDLVKVKNEEIRQAFYFALRDTLVANNLDQATRVAYQRDRRWRVVTLQGQIIEQSGTMSGG 727          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|O93309|SMC3_XENLA (Structural maintenance of chromosomes protein 3 OS=Xenopus laevis OX=8355 GN=smc3 PE=1 SV=2)

HSP 1 Score: 1170.99 bits (3028), Expect = 0.000e+0
Identity = 626/1210 (51.74%), Postives = 876/1210 (72.40%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETE-NVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS--SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K D+INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E++ER  R+L+ K   M +E EQ+ S   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  ++ +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++   +C   FYT VEVTAG RLFYH+VE++E+  KIL E NK N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK  +K+E E+   E  + +N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + + E + L   ++  ++ EKD+ D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR+EELD+GH++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S  SS+P V++FTGVGI VSFTG  A+M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E+A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKRDKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETSGEKSRQLRDAQQDARDKMEEIERQVRELKSKISAMKEEKEQLSSERQEQIKQRTKLELKTKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFSSVKQKEESGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAINKDLEETEVNKEKNLEQYTKLDQDLNEVKTRVEELDKKYYEVKNKKDELQSERNYLWREENAEQQSLAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFDCEPAFYTCVEVTAGNRLFYHIVESDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNLRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKVEDELHALEAKLNENLRRNIERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGTITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTLARSEGLDITIDKTEVESKDLVKSMDRWKNMEKDHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGHKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSTQSSVPSVDQFTGVGIRVSFTGKQAEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELASHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEQAKDFVEDDTTHG 1209          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q9CW03|SMC3_MOUSE (Structural maintenance of chromosomes protein 3 OS=Mus musculus OX=10090 GN=Smc3 PE=1 SV=2)

HSP 1 Score: 1144.03 bits (2958), Expect = 0.000e+0
Identity = 620/1222 (50.74%), Postives = 871/1222 (71.28%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E +  +  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV  GY+G ++    C   FYT VEVTAG RLFYH+V+++E+  KIL E NK N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + +   + L+  +E  ++ EK++ D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG 1217          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q5R4K5|SMC3_PONAB (Structural maintenance of chromosomes protein 3 OS=Pongo abelii OX=9601 GN=SMC3 PE=2 SV=1)

HSP 1 Score: 1142.1 bits (2953), Expect = 0.000e+0
Identity = 619/1222 (50.65%), Postives = 871/1222 (71.28%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E +  +  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V++ FR K G + HV  GY+G ++    C   FYT VEVTAG RLFYH+V+++E+  KIL E NK N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + +   + L+  +E  ++ EK++ D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRK-GINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG 1217          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q9UQE7|SMC3_HUMAN (Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2)

HSP 1 Score: 1142.1 bits (2953), Expect = 0.000e+0
Identity = 619/1222 (50.65%), Postives = 871/1222 (71.28%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E +  +  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V++ FR K G + HV  GY+G ++    C   FYT VEVTAG RLFYH+V+++E+  KIL E NK N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + +   + L+  +E  ++ EK++ D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DE + S          SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRK-GINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG 1217          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|O97594|SMC3_BOVIN (Structural maintenance of chromosomes protein 3 OS=Bos taurus OX=9913 GN=SMC3 PE=1 SV=1)

HSP 1 Score: 1137.48 bits (2941), Expect = 0.000e+0
Identity = 617/1223 (50.45%), Postives = 870/1223 (71.14%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGK---------HDDTLLDDE--EDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE S   +  +R A +   D +E +ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E +  +  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V++ FR K G + HV  GY+G ++    C   FYT VEVTAG RLFYH+V+++E+  KIL E NK N PGE+ F P+N+L  R++ YPETNDAIPM+S+L ++ +F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +Q+ VD LN+ I+ L  + ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL AI++R++    +    +  + + +   + L+  +E  ++ EK++ D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   ++KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR+EELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++K +          +  ++  E    P SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRK-GINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKRRXERQSGLRMKEKGVVKGERGSGPQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG 1218          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A5K4F4P2 (Putative rootletin (Ciliary rootlet coiled-coil protein) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1749.95 bits (4531), Expect = 0.000e+0
Identity = 902/1210 (74.55%), Postives = 1054/1210 (87.11%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDP---SSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIKKVIIQGFRSYRDQTCP EF PHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLS QER NLLHEGTGPRV+SAYVE+IFDNSDNRIPFDK EVSLRRIIG+KKDQYFLDKKMVTK DVMN+LESAGFSRSNPYYIVKQGKITQLATAPD+QRLKLLREVAGTRVYDERKEESKQIFKESEAK +QI+ELL+SI+DRLRTLE+ETKELKEYQ  DRDRR+LEFTI+DRELK+ ++KL+EI+ RREQSS +T ++R+AAK CAD IEKLERD RD RLKE QM DEVEQ+Q+ +S+ LQRREQLQL + DY  T RGG +AR RA ++L RV  +I QV++RL E++PQY+ A+  EDE+ N+LSDAEHRRKELFAKQGRVNQFQSR+QRDEWIK+QMKSL+KAIKDKENTI KL++EI  D +R E L  +L  AE NM  VR+ELE VSEE R+LRR+KDE+Q DRQTVYR+E+++  +LNNLRDEL RTEHNLRSITGK ILNGLDSVR+V+EIFR+++G DC +VQGY+GTLIELI+CP+TFYTSVEVTAG+RLFYHVV+N++LVI+++ E+NKHN PGE+NF PINRL  +ES YPETNDAIPM+SRL FD KF+ VMLH FGKTL+CRSIEIAT LA+  NFDC+TLDGDQVSR+GTLTGGYYD R SRLELQKRKQK E+EIQETENV++N   RKE +D+ IN IID +QRK+TVR+KHEMTFDKLKKDI++WKEE   K E KPQKE+KL+SLRHDL+QMKYT ESY+VELGTDLL+QLS  EQREVD+LN+ IQ LT +AK+AY +R+ LE EK E ET L+HNL+RK++QLE+E+ E SE D+ +RL E+E+ELR ++  IE  Q+ V+  E +L+ +  E+R+LE+++E  + +EK+YA+ IQDDQQNLEKMQSKQSQLLKKKEE ++KIR++GSLPA+  +KF DK MKQL+KLLDKANRE+KRYSHVNKKALDQFVS++EEKEKLLKRKEELDKG QAI DLM ALDHQKYEAI LTFKQVS  FQ+IFK+LVP+GRAEL+++KG   +     +ED    SS IP+VERF GVGI VSFTG  A M+DMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALD QYRKAVADMIK L  +AQFITTTFRPE+LE+AE+FYGVKFRNKVSHI+ V+K EALDFVEDDQTHG
Sbjct:    1 MYIKKVIIQGFRSYRDQTCPEEFSPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSNQERQNLLHEGTGPRVISAYVEMIFDNSDNRIPFDKNEVSLRRIIGSKKDQYFLDKKMVTKADVMNMLESAGFSRSNPYYIVKQGKITQLATAPDHQRLKLLREVAGTRVYDERKEESKQIFKESEAKREQISELLNSIEDRLRTLENETKELKEYQHWDRDRRALEFTIYDRELKETRKKLEEIQTRREQSSESTAEIRRAAKDCADAIEKLERDLRDNRLKEAQMQDEVEQVQASVSDVLQRREQLQLTIADYSATLRGGKSARERASEELSRVREQINQVERRLAELRPQYKKAKQFEDELANALSDAEHRRKELFAKQGRVNQFQSRSQRDEWIKDQMKSLSKAIKDKENTINKLTEEIKRDDERREKLQQDLEVAEENMTCVRKELETVSEEQRRLRREKDEIQTDRQTVYREETRIAHELNNLRDELARTEHNLRSITGKGILNGLDSVRKVVEIFRDRYGPDCDIVQGYHGTLIELIDCPETFYTSVEVTAGSRLFYHVVQNDKLVIRMIAEINKHNLPGEVNFLPINRLCVQESSYPETNDAIPMISRLNFDEKFRGVMLHIFGKTLICRSIEIATQLARTKNFDCITLDGDQVSRKGTLTGGYYDSRLSRLELQKRKQKTEIEIQETENVRENNAKRKEQVDAQINRIIDDVQRKDTVRSKHEMTFDKLKKDIHMWKEELRGKQETKPQKEYKLSSLRHDLDQMKYTMESYKVELGTDLLSQLSVQEQREVDRLNDKIQELTREAKDAYKKRITLETEKNEKETQLEHNLLRKQEQLESEVAEASEQDLQDRLTESEEELREVERLIEGAQRTVDEVETRLSALLHEQRQLESEMERKKQEEKEYAERIQDDQQNLEKMQSKQSQLLKKKEENMKKIRDLGSLPANTFDKFQDKNMKQLFKLLDKANRELKRYSHVNKKALDQFVSHSEEKEKLLKRKEELDKGCQAIKDLMNALDHQKYEAIQLTFKQVSKNFQDIFKRLVPEGRAELVMKKGVRQEGEGSSDEDGGADSSVIPDVERFIGVGIRVSFTGDSADMRDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDAQYRKAVADMIKDLKSEAQFITTTFRPELLESAEKFYGVKFRNKVSHIECVTKGEALDFVEDDQTHG 1210          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A4Z2DHG4 (Structural maintenance of chromosomes protein OS=Schistosoma japonicum OX=6182 GN=EWB00_000916 PE=3 SV=1)

HSP 1 Score: 1741.86 bits (4510), Expect = 0.000e+0
Identity = 899/1211 (74.24%), Postives = 1051/1211 (86.79%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKG----KHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIKKVIIQGFRSYRDQTCP EF PHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLS QER NLLHEGTGPRV+SAYVE+IFDNSDNRIPFDK EVSLRRIIG+KKDQYFLDKKMVTK DVMN+LESAGFSRSNPYYIVKQGKITQLATAPD+QRLKLLREVAGTRVYDERKEESKQIFKESEAK +QI+ELL+SI+DRLRTLE+ETKELKEYQ  DRDRR+LEFTI+DRELK+ ++KL+EI+ RREQSS +T ++R+AAK CA+ IEKLERD RD RLKE QM DEVEQ+Q+ +S+ LQRREQLQL + DY  T RGG +AR RA ++L RV  +I QV++RL E++PQY+ A+  EDE+ N+LSDAEHRRKELFAKQGRVNQFQSR QRDEWIK+QMKSL+KAIKDKENTI KL++EI  D +R E L  +L  AE NM  VR+ELE VSEE R+LRR+KDE+Q DRQTVYR+E+++  +LNNLRDEL RTEHNLRSITGK ILNGLDSVR+V+EIFR+++G DC +VQGY+GTLIELI+CP+TFYTSVEVTAG+RLFYHVV+N++LVI+++ E+NKHN PGE+NF PINRL  +E  YPETNDAIPM+SRL FD KF+ VMLH FGKTL+CRSIEIAT LA+  NFDC+TLDGDQVSR+GTLTGGYYD R SRLELQKRKQK E+EIQETENV++N   RKE +D+ IN IID +QRK+TVR+KHEMTFDKLKKDI++WKEE   K E KPQKE+KL+SLRHDL+QMKYT ESY+VELGTDLL+QLS  EQREVD+LN+ IQ LT +AKEAY +R+ LE EK E ET L+HNL+RK++QLE+E+ E SE D+ +RL E+E+ELR ++  IE  Q+ V+  E +L+ +  E+R+LE+++E  + +EK+YA+ IQDDQQNLEKMQSKQSQLLKKKEE ++KIR++GSLPA+  +KF DK MKQL+KLLDKANRE+KRYSHVNKKALDQFVS++EEKEKLLKRKEELDKG QAI DLM ALDHQKYEAI LTFKQVS  FQ+IFK+LVP+GRAEL+++KG        +  D   D  S+IP+VERF GVGI VSFTG  A M+DMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALD QYRKAVADMI+ L  +AQFITTTFRPE+LE+AE+FYGVKFRNKVSHI+ V+K EALDFVEDDQTHG
Sbjct:    1 MYIKKVIIQGFRSYRDQTCPEEFSPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSNQERQNLLHEGTGPRVISAYVEMIFDNSDNRIPFDKNEVSLRRIIGSKKDQYFLDKKMVTKADVMNMLESAGFSRSNPYYIVKQGKITQLATAPDHQRLKLLREVAGTRVYDERKEESKQIFKESEAKREQISELLNSIEDRLRTLENETKELKEYQHWDRDRRALEFTIYDRELKETRKKLEEIQTRREQSSESTAEIRRAAKDCANAIEKLERDLRDNRLKEAQMQDEVEQVQASVSDVLQRREQLQLTIADYSATLRGGKSARERASEELNRVKEQISQVERRLAELRPQYKKAKQFEDELANALSDAEHRRKELFAKQGRVNQFQSRGQRDEWIKDQMKSLSKAIKDKENTINKLTEEIKRDDERREKLQQDLEVAEENMTCVRKELETVSEEQRRLRREKDEIQTDRQTVYREETRIAHELNNLRDELARTEHNLRSITGKGILNGLDSVRKVVEIFRDRYGPDCDIVQGYHGTLIELIDCPETFYTSVEVTAGSRLFYHVVQNDKLVIRMIAEINKHNLPGEVNFLPINRLCVQECSYPETNDAIPMISRLNFDEKFRGVMLHIFGKTLICRSIEIATQLARTKNFDCITLDGDQVSRKGTLTGGYYDSRLSRLELQKRKQKTEIEIQETENVRENNAKRKEQVDAQINRIIDDVQRKDTVRSKHEMTFDKLKKDIHMWKEELRGKQETKPQKEYKLSSLRHDLDQMKYTMESYKVELGTDLLSQLSVQEQREVDRLNDKIQELTREAKEAYKKRITLETEKNEKETQLEHNLLRKQEQLESEVAETSEQDLQDRLTESEEELREVERLIEGAQRTVDEVETRLSALLHEQRQLESEMERKKQEEKEYAERIQDDQQNLEKMQSKQSQLLKKKEENMKKIRDLGSLPANTFDKFQDKNMKQLFKLLDKANRELKRYSHVNKKALDQFVSHSEEKEKLLKRKEELDKGCQAIKDLMNALDHQKYEAIQLTFKQVSKNFQDIFKRLVPEGRAELVMKKGVLQEGEGSSDEDGGADGGSAIPDVERFIGVGIRVSFTGDSADMRDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDAQYRKAVADMIRDLKSEAQFITTTFRPELLESAEKFYGVKFRNKVSHIECVTKGEALDFVEDDQTHG 1211          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A095C3F2 (Structural maintenance of chromosomes protein OS=Schistosoma haematobium OX=6185 GN=MS3_04508 PE=3 SV=1)

HSP 1 Score: 1734.92 bits (4492), Expect = 0.000e+0
Identity = 899/1221 (73.63%), Postives = 1054/1221 (86.32%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNII-----------VGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDP---SSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIKKVIIQGFRSYRDQTCP EF PHHNII           VGRNGSGKSNFFQAIQFVLSDEYSHLS QER NLLHEGTGPRV+SAYVE+IFDNSDNRIPFDK EVSLRRIIG+KKDQYFLDKKMVTK DVMN+LESAGFSRSNPYYIVKQGKITQLATAPD+QRLKLLREVAGTRVYDERKEESKQIFKESEAK +QI+ELL+SI+DRLRTLE+ETKELKEYQ  DRDRR+LEFTI+DRELK+ ++KL+EI+ RREQSS +T ++R+AAK CAD IEKLERD RD RLKE QM DEVEQ+Q+ +S+ LQRREQLQL + DY  T RGG +AR RA ++L RV  +I QV++RL E++PQY+ A+  EDE+ N+LSDAEHRRKELFAKQGRVNQFQSR+QRDEWIK+QMKSL+KAIKDKENTI KL++EI  D +R E L  +L  AE NM  VR+ELE VSEE R+LRR+KDE+Q DRQTVYR+E+++  +LNNLRDEL RTEHNLRSITGK ILNGLDSVR+V+EIFR+++G DC +VQGY+GTLIELI+CP+TFYTSVEVTAG+RLFYHVV+N++LVI+++ E+NKHN PGE+NF PINRL  +ES YPETNDAIPM+SRL FD KF+ VMLH FGKTL+CRSIEIAT LA+  NFDC+TLDGDQVSR+GTLTGGYYD R SRLELQKRKQK E+EIQETENV++N   RKE +D+ IN IID +QRK+TVR+KHEMTFDKLKKDI++WKEE   K E KPQKE+KL+SLRHDL+QMKYT ESY+VELGTDLL+QLS  EQREVD+LN+ IQ LT +AK+AY +R+ LE EK E ET L+HNL+RK++QLE+E+ E SE D+ +RL E+E+ELR ++  IE  Q+ V+  E +L+ +  E+R+LE+++E  + +EK+YA+ IQDDQQNLEKMQSKQSQLLKKKEE ++KIR++GSLPA+  +KF +K +KQL+KLLDKANRE+KRYSHVNKKALDQFVS++EEKEKLLKRKEELDKG QAI DLM ALDHQKYEAI LTFKQVS  FQ+IFK+LVP+GRAEL+++KG   +     +ED    SS IP+VERF GVGI VSFTG  A M+DMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALD QYRKAVADMI+ L  +AQFITTTFRPE+LE+AE+FYGVKFRNKVSHI+ V+K EALDFVEDDQTHG
Sbjct:    1 MYIKKVIIQGFRSYRDQTCPEEFSPHHNIIGMICLTSIIPIVGRNGSGKSNFFQAIQFVLSDEYSHLSNQERQNLLHEGTGPRVISAYVEMIFDNSDNRIPFDKNEVSLRRIIGSKKDQYFLDKKMVTKADVMNMLESAGFSRSNPYYIVKQGKITQLATAPDHQRLKLLREVAGTRVYDERKEESKQIFKESEAKREQISELLNSIEDRLRTLENETKELKEYQHWDRDRRALEFTIYDRELKETRKKLEEIQTRREQSSESTAEIRRAAKDCADAIEKLERDLRDNRLKEAQMQDEVEQVQASVSDVLQRREQLQLTIADYSATLRGGKSARERASEELNRVREQINQVERRLAELRPQYKKAKQFEDELANALSDAEHRRKELFAKQGRVNQFQSRSQRDEWIKDQMKSLSKAIKDKENTINKLTEEIKRDDERREKLQQDLEVAEENMTCVRKELETVSEEQRRLRREKDEIQTDRQTVYREETRIAHELNNLRDELARTEHNLRSITGKGILNGLDSVRKVVEIFRDRYGPDCDIVQGYHGTLIELIDCPETFYTSVEVTAGSRLFYHVVQNDKLVIRMIAEINKHNLPGEVNFLPINRLCVQESSYPETNDAIPMISRLNFDEKFRGVMLHIFGKTLICRSIEIATQLARTKNFDCITLDGDQVSRKGTLTGGYYDSRLSRLELQKRKQKTEIEIQETENVRENNAKRKEQVDAQINRIIDDVQRKDTVRSKHEMTFDKLKKDIHMWKEELRGKQETKPQKEYKLSSLRHDLDQMKYTMESYKVELGTDLLSQLSVQEQREVDRLNDKIQELTREAKDAYKKRITLETEKNEKETQLEHNLLRKQEQLESEVAEASEQDLQDRLTESEEELREVERLIEGAQRTVDEVETRLSALLHEQRQLESEMERKKQEEKEYAERIQDDQQNLEKMQSKQSQLLKKKEENMKKIRDLGSLPANTFDKFQEKNIKQLFKLLDKANRELKRYSHVNKKALDQFVSHSEEKEKLLKRKEELDKGCQAIKDLMNALDHQKYEAIQLTFKQVSKNFQDIFKRLVPEGRAELVMKKGVRQEGEGSSDEDGGADSSVIPDVERFIGVGIRVSFTGDSADMRDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDAQYRKAVADMIRDLKSEAQFITTTFRPELLESAEKFYGVKFRNKVSHIECVTKGEALDFVEDDQTHG 1221          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A0X3PK78 (SMC hinge domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR126009 PE=4 SV=1)

HSP 1 Score: 1734.54 bits (4491), Expect = 0.000e+0
Identity = 888/1215 (73.09%), Postives = 1044/1215 (85.93%), Query Frame = 1
Query:   88 SCTMYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEED-----PSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            +  MYIKKVIIQGFRSYRDQTCP EF PHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLS QER NLLHEGTGPRV+SAYVE+IFDNSDNRIPFDK EVSLRRIIG+KKDQYFLDKKMVTK DVMN+LESAGFSRSNPYYIVKQGKITQLAT+PD+QRLKLLREVAGTRVYDERKEESKQIF+ESEAK +QI+ELL+SI++RLRTLE+ETKELKEYQK DRDRR+LE+TI+DRELK+ ++KL+E++ +REQSS +T + R+AAK+ AD IE+LER+ RD RLKE Q+ DEVEQ+Q  +SE LQRREQLQL   DY  T R G +AR RA ++L RV  +I+ V++RL E+KP+Y+ AR KED++ N+LSDAEHRRKELFAKQGR+NQF+SR QRD+WIK QMK L+KAIKDKENTI KL+DEI  D  R   L  +L+ AE N+  VR ELE VSE+ R+LRR+KDE+Q DRQTVYR+E+K+ Q+LNN RDEL RTEH+LRSITGK ILNGLDSVR+ IEIFR+K+G +C +VQGYYGTLIEL+ CP+ FYTSVEVTAG+RLFYHVV+N++ VI+I+ E+NKHN PGE++F PINRL  +E  YPET  AIPM+SRL FD KF+ VMLH FGKTL+C SI++A  LA+  NFDC+TLDGDQVSR+GTLTGGYYD R SRLELQ+RKQK EMEIQETENV++N   RKE +D+ IN IID+LQRKETVR+K EMT+DKLKKDI+LWKEE   KTE +PQKE KL SLRHDLEQMKYT ESY+VELGTDLL+QLS  EQREVD+LN+ IQ LT  AKE+Y +RM LE EKTE ET L+HNL RK++QLEAE+ E SE D+ ERL+EAEDEL+ ++ RIEA Q+ V+  E +L  +  ++RRLET LE+ + +EK++ + +QDDQQ+LEKMQSKQSQL+KKKEE ++KIR++GSLPADA +KF DK++KQL+KLLDKANRE+KRYSHVNKKALDQFVS++EEKEKLLKRKEELDK HQAIIDLM ALDHQKYEAI LTFKQVS  FQ+IFK+LVP+GRAEL++ KGK D    DDE+D     PS  +P+VERFTGVGI VSFTG  A M+DMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALD QYR AVADMI+ L  +AQFITTTFRPE+LE+AE++YGVKFRNKVSHI+ V+KEEALDFVEDDQTHG
Sbjct:   19 AAVMYIKKVIIQGFRSYRDQTCPEEFSPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSNQERQNLLHEGTGPRVISAYVEMIFDNSDNRIPFDKNEVSLRRIIGSKKDQYFLDKKMVTKADVMNMLESAGFSRSNPYYIVKQGKITQLATSPDSQRLKLLREVAGTRVYDERKEESKQIFRESEAKREQISELLNSIEERLRTLENETKELKEYQKWDRDRRALEYTIYDRELKETRKKLEELQAKREQSSESTAETRRAAKETADQIERLERELRDTRLKEAQLQDEVEQVQHSVSEVLQRREQLQLTCADYSATLRSGKSARERAAEELARVNSQIELVEQRLTELKPEYKAARQKEDDIANALSDAEHRRKELFAKQGRLNQFRSRGQRDDWIKNQMKGLSKAIKDKENTIAKLTDEISKDDDRKTKLQADLTVAEDNINCVRTELETVSEDSRRLRREKDEIQTDRQTVYREETKIAQELNNWRDELARTEHSLRSITGKVILNGLDSVRKCIEIFRDKYGPECDIVQGYYGTLIELLECPEDFYTSVEVTAGSRLFYHVVQNDKYVIRIIAEINKHNLPGEVHFLPINRLSVKEFRYPETEGAIPMISRLKFDEKFRPVMLHIFGKTLICSSIDVAAQLARKQNFDCITLDGDQVSRKGTLTGGYYDNRLSRLELQRRKQKTEMEIQETENVRENNAKRKEQVDAQINRIIDELQRKETVRSKLEMTYDKLKKDIHLWKEELRTKTEGRPQKERKLASLRHDLEQMKYTMESYKVELGTDLLSQLSVQEQREVDRLNDKIQELTRDAKESYKQRMKLETEKTEKETQLEHNLFRKREQLEAELAEASEQDLCERLREAEDELKEVEHRIEAAQRTVDEVESRLEALMNDQRRLETDLESKKYEEKEFTERMQDDQQSLEKMQSKQSQLIKKKEENMKKIRDLGSLPADAFDKFKDKSLKQLFKLLDKANRELKRYSHVNKKALDQFVSHSEEKEKLLKRKEELDKAHQAIIDLMNALDHQKYEAITLTFKQVSKNFQDIFKRLVPEGRAELVMHKGKKDANASDDEDDVPTGGPSMPLPDVERFTGVGIRVSFTGDSADMRDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDAQYRVAVADMIRDLKSEAQFITTTFRPELLESAEKYYGVKFRNKVSHIECVTKEEALDFVEDDQTHG 1233          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A4Z2DHJ9 (Structural maintenance of chromosomes protein OS=Schistosoma japonicum OX=6182 GN=EWB00_000916 PE=3 SV=1)

HSP 1 Score: 1707.58 bits (4421), Expect = 0.000e+0
Identity = 882/1190 (74.12%), Postives = 1032/1190 (86.72%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKG----KHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVS 3654
            MYIKKVIIQGFRSYRDQTCP EF PHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLS QER NLLHEGTGPRV+SAYVE+IFDNSDNRIPFDK EVSLRRIIG+KKDQYFLDKKMVTK DVMN+LESAGFSRSNPYYIVKQGKITQLATAPD+QRLKLLREVAGTRVYDERKEESKQIFKESEAK +QI+ELL+SI+DRLRTLE+ETKELKEYQ  DRDRR+LEFTI+DRELK+ ++KL+EI+ RREQSS +T ++R+AAK CA+ IEKLERD RD RLKE QM DEVEQ+Q+ +S+ LQRREQLQL + DY  T RGG +AR RA ++L RV  +I QV++RL E++PQY+ A+  EDE+ N+LSDAEHRRKELFAKQGRVNQFQSR QRDEWIK+QMKSL+KAIKDKENTI KL++EI  D +R E L  +L  AE NM  VR+ELE VSEE R+LRR+KDE+Q DRQTVYR+E+++  +LNNLRDEL RTEHNLRSITGK ILNGLDSVR+V+EIFR+++G DC +VQGY+GTLIELI+CP+TFYTSVEVTAG+RLFYHVV+N++LVI+++ E+NKHN PGE+NF PINRL  +E  YPETNDAIPM+SRL FD KF+ VMLH FGKTL+CRSIEIAT LA+  NFDC+TLDGDQVSR+GTLTGGYYD R SRLELQKRKQK E+EIQETENV++N   RKE +D+ IN IID +QRK+TVR+KHEMTFDKLKKDI++WKEE   K E KPQKE+KL+SLRHDL+QMKYT ESY+VELGTDLL+QLS  EQREVD+LN+ IQ LT +AKEAY +R+ LE EK E ET L+HNL+RK++QLE+E+ E SE D+ +RL E+E+ELR ++  IE  Q+ V+  E +L+ +  E+R+LE+++E  + +EK+YA+ IQDDQQNLEKMQSKQSQLLKKKEE ++KIR++GSLPA+  +KF DK MKQL+KLLDKANRE+KRYSHVNKKALDQFVS++EEKEKLLKRKEELDKG QAI DLM ALDHQKYEAI LTFKQVS  FQ+IFK+LVP+GRAEL+++KG        +  D   D  S+IP+VERF GVGI VSFTG  A M+DMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALD QYRKAVADMI+ L  +AQFITTTFRPE+LE+AE+FYGVKFRNKVS
Sbjct:    1 MYIKKVIIQGFRSYRDQTCPEEFSPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSNQERQNLLHEGTGPRVISAYVEMIFDNSDNRIPFDKNEVSLRRIIGSKKDQYFLDKKMVTKADVMNMLESAGFSRSNPYYIVKQGKITQLATAPDHQRLKLLREVAGTRVYDERKEESKQIFKESEAKREQISELLNSIEDRLRTLENETKELKEYQHWDRDRRALEFTIYDRELKETRKKLEEIQTRREQSSESTAEIRRAAKDCANAIEKLERDLRDNRLKEAQMQDEVEQVQASVSDVLQRREQLQLTIADYSATLRGGKSARERASEELNRVKEQISQVERRLAELRPQYKKAKQFEDELANALSDAEHRRKELFAKQGRVNQFQSRGQRDEWIKDQMKSLSKAIKDKENTINKLTEEIKRDDERREKLQQDLEVAEENMTCVRKELETVSEEQRRLRREKDEIQTDRQTVYREETRIAHELNNLRDELARTEHNLRSITGKGILNGLDSVRKVVEIFRDRYGPDCDIVQGYHGTLIELIDCPETFYTSVEVTAGSRLFYHVVQNDKLVIRMIAEINKHNLPGEVNFLPINRLCVQECSYPETNDAIPMISRLNFDEKFRGVMLHIFGKTLICRSIEIATQLARTKNFDCITLDGDQVSRKGTLTGGYYDSRLSRLELQKRKQKTEIEIQETENVRENNAKRKEQVDAQINRIIDDVQRKDTVRSKHEMTFDKLKKDIHMWKEELRGKQETKPQKEYKLSSLRHDLDQMKYTMESYKVELGTDLLSQLSVQEQREVDRLNDKIQELTREAKEAYKKRITLETEKNEKETQLEHNLLRKQEQLESEVAETSEQDLQDRLTESEEELREVERLIEGAQRTVDEVETRLSALLHEQRQLESEMERKKQEEKEYAERIQDDQQNLEKMQSKQSQLLKKKEENMKKIRDLGSLPANTFDKFQDKNMKQLFKLLDKANRELKRYSHVNKKALDQFVSHSEEKEKLLKRKEELDKGCQAIKDLMNALDHQKYEAIQLTFKQVSKNFQDIFKRLVPEGRAELVMKKGVLQEGEGSSDEDGGADGGSAIPDVERFIGVGIRVSFTGDSADMRDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDAQYRKAVADMIRDLKSEAQFITTTFRPELLESAEKFYGVKFRNKVS 1190          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc3 (structural maintenance of chromosomes 3 [Source:NCBI gene;Acc:103034304])

HSP 1 Score: 1136.71 bits (2939), Expect = 0.000e+0
Identity = 620/1222 (50.74%), Postives = 866/1222 (70.87%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS----------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE     +  +R A +   D +E+ ER  R+L+ +   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L+E +P++   + KE+     L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++    C   FYT VEVTAGTRLFYH+VE +E+  KIL E NK N PGE+ F P+++L  R++ YPETNDAIPM+S+L +   F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +QR VD LN+ I+ L    ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL  I++RI+    +    +  + + + E +     +E  ++ EK+  D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   T+KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR++ELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  +     DE +            SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID +S E+A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTVVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEDEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKARISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNTVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKTRVEELDKKYYEVKNRKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFECEPAFYTCVEVTAGTRLFYHIVETDEVSTKILMEFNKMNLPGEVTFLPLSKLDVRDTAYPETNDAIPMISKLRYSPNFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDMRKAEEELSELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQRRVDDLNDEIRQLQQDNRQLLNERIKLEGIMTRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELDGINKRIKDTMARSEDLDSLIDKTEIEIKDHIKSMERWKNIEKEQNDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLTLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQDELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDAEGGQSQDEGEGGADSEKGSASQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIVELAGHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVISAEQAKDFVEDDTTHG 1217          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 96.6709 bits (239), Expect = 1.195e-19
Identity = 54/177 (30.51%), Postives = 89/177 (50.28%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGV--GIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHI 3660
            I++ +K LD +K EA+ + +++V+  F  IF  L+P   A L   +G                        GV  G+E     G+   +++ +LSGGQ+SLVAL+LI A+    PAP Y+ DE+DAALD  + + +  M++     +QF+  + +  M   A   +  KF + VS +
Sbjct:  997 ILETIKELDQKKNEALNVAWQKVNKDFGSIFSTLLPGANARLAPPEG-----------------------CGVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFVVVSLKDGMFTNANVLFKTKFVDGVSTV 1150          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc1a (structural maintenance of chromosomes 1A [Source:NCBI gene;Acc:103021942])

HSP 1 Score: 79.337 bits (194), Expect = 2.228e-14
Identity = 54/181 (29.83%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGT--GPRVVSAYVEIIF--DNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGT----RVYDERKEE 618
            Y+K + I+ F+SY+ +   G F      I+G NGSGKSN   AI FVL+++ S+L  +   +L+H      P    A+V +++  +N+D R        +  R+I     +Y +D K+V+ +D    LE  G       ++V QG +  +A     +R  L  E++ +    + YD RK+E
Sbjct:    3 YLKLIEIENFKSYKGRQIIGPFH-KFTAIIGPNGSGKSNLMDAISFVLAEKTSNLRVKTLKDLIHGAPVGKPAANRAFVSMVYCEENADER--------TFTRVIIGSSSEYRIDSKVVSLSDYSEELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKE 174          

HSP 2 Score: 73.559 bits (179), Expect = 1.367e-12
Identity = 46/157 (29.30%), Postives = 74/157 (47.13%), Query Frame = 1
Query: 3166 QKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLS-KDAQFITTTFRPEMLEAAERFYGV 3633
            ++++     F+ V+    EI+K L  +  A+  +     ++  LD                  GI  +      + + M+ LSGG+K++ AL L+FAI    PAPF++ DEIDAALD      VA+ IK  S ++ Q I  + + E    A+   GV
Sbjct: 1064 ERFDRFNTCFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLD------------------GINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKDQSVQNFQAIVISLKEEFYTKADSLIGV 1202          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:103045898])

HSP 1 Score: 78.9518 bits (193), Expect = 3.018e-14
Identity = 53/159 (33.33%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 3157 LDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            L  Q+    +  F  +++  +E ++ L   G AEL           L D  DP S           GI  S        K +  LSGG+K+L +L L+FA+    P P Y  DEIDAALD +    VA  I   +K+AQFI  + R  M E A+R  G+
Sbjct:  985 LRKQRLNEFMAGFNIITNKLKENYQMLTLGGDAEL----------ELVDSLDPFSE----------GIMFSVRPPKKSWKKIYNLSGGEKTLSSLALVFALHHFKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKNAQFIIISLRNNMFEMADRLIGI 1123          

HSP 2 Score: 58.5362 bits (140), Expect = 5.069e-8
Identity = 47/181 (25.97%), Postives = 81/181 (44.75%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPR-VVSAYVEIIFDNSDNR-------IPFDKTEVSLRRIIG-NKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLA-------TAPDNQRLKLLREVAGT 591
            + I  ++ + F+SY  +   G F    + I+G NGSGKSN   ++ FV       +  ++   L+H     + + S  VE+ F    ++       IP  K  VS  R  G +    Y ++ K  T  DV  +L S G    +  +++ QG++ Q+A       T  D   L+ L ++ G+
Sbjct:   10 LMITHIVNRNFKSYAGEQILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSKKLSVLIHSSDEHKDIQSCTVEVHFQKIVDKEGDDYDVIPNSKFHVS--RTAGKDNSSAYHINGKKATFKDVGTVLRSHGIDLDHNRFLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGS 188          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 78.1814 bits (191), Expect = 4.897e-14
Identity = 54/181 (29.83%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGT--GPRVVSAYVEIIF--DNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGT----RVYDERKEE 618
            Y+K + I+ F+SY+ +   G F      I+G NGSGKSN   AI FVL+++ S+L  +   +L+H      P    AYV +++  DN ++         +  RII     +Y ++ K+V  +D    LE  G       ++V QG +  +A     +R  L  E++ +    + YD RK+E
Sbjct:    3 YLKLIEIENFKSYKGKQIIGPFH-KFTAIIGPNGSGKSNLMDAISFVLAEKTSNLRVKTLKDLIHGAPVGKPAANRAYVSMVYHEDNGED--------CTFTRIIIGSSSEYRINSKVVGLSDYSEALEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKE 174          

HSP 2 Score: 61.6178 bits (148), Expect = 5.075e-9
Identity = 41/163 (25.15%), Postives = 69/163 (42.33%), Query Frame = 1
Query: 3166 QKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAAL-------DPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            ++++     F+ V+    EI+K L  +  A+  +     ++  LD                  GI  +      + + M+ LSGG+K++ AL L+FAI    PAPF++ DEID          DP+  K         +K+ Q I  + + E    A+   GV
Sbjct: 1065 ERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLD------------------GINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDVGFHQSQCLNDPKLYK---------NKNFQAIVISLKEEFYTKADSLVGV 1200          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 124.405 bits (311), Expect = 6.427e-29
Identity = 74/230 (32.17%), Postives = 127/230 (55.22%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS-DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNR---IPFD-KTEVSL-RRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELL-SSIDDRLRTLESETKELKEYQKCDRDRRSL 765
            MYIK +++ GF+SY  +T   ++DP  N I G NGSGKSN   A+ FVL     S +       L+++     V  A V I FDN D +   + F+   E+++ R+++   +++Y ++    T   V +L  S G + +NP++++ QG+IT++      + L ++ E AGTR+Y+ +K  +++  ++ EAK+ +IN++L   I   L  L+ E     EY K  R+  SL
Sbjct:    1 MYIKSIVVDGFKSYAQRTEISDWDPLFNAITGLNGSGKSNILDAVCFVLGISNLSRVRAASLQELVYKNGQAGVTKATVSITFDNRDRKQSPLGFEGHAEITVTRQVVIGGRNKYLINGVNATTARVQDLFRSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYESKKLAAQKTIEKKEAKLKEINDVLDEEISPTLEKLKQERTSYLEYSKLCRELDSL 230          

HSP 2 Score: 90.1225 bits (222), Expect = 2.521e-18
Identity = 55/177 (31.07%), Postives = 92/177 (51.98%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQ 3666
            I   M+ LD +K EA+ L ++QV+  F  IF  L+P  +A L         T ++     +SS+ +       G+E     G    +++++LSGGQ+SLVAL+LI A+    PAP Y+ DE+DAALD  + + +  M++     +QF+  + +  M   A   +  +F   VS + +
Sbjct: 1014 IFSAMQELDLKKNEALNLAWRQVNGDFSSIFSTLLPGSQARL---------TPVESSSSSTSSLLQ-------GLEFRVALGSVWKENLSELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGHMLRTHFLTSQFVVVSLKDGMFNNANVLFKTRFVEGVSTVTR 1174          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008608.1 (pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 gene:ENSPMAG00000007778.1 transcript:ENSPMAT00000008608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.582e-14
Identity = 202/984 (20.53%), Postives = 400/984 (40.65%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTG-PRVVSAYVEIIFDNSDNR-------IPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLA-------TAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLK--IQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKD-------KENTIRKLSDEIDSDIKRIEDLVNEL-------SGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSI-----TGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRL-----TFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLE-------LQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEI----------IDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGT---------DLLTQLS----TSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDY 2829
            + I  ++ + F+SY  +   G F    + I+G NGSGKSN   ++ FV       +  ++   L+H     P + S  VE+ F    ++       IP  +  VS R    +    Y +     T  DV  LL S G    +  +++ QG++ Q+A       T  D   L+ + ++ G+  +       K   +    +++Q+NEL     +R++ +E E   L E +K +    ++ F + + ++ ++K  L + K +  + ++ T + +KA      DIE+  +D ++      +M + V+  +    E     +     +N +    +     +   Q DLQ V ++  ++    + +++  Q      K  E+ N  + ++   K   A + +     S++  +E +K  M +  K  K        K+  +  LS E++    R+E   +EL       + A A +   +Q L + +E L   R    +++    +  ++ ++ Q +L  L    N     +R++       KS L    S  +V+++  ++       + G YG L +L    + +  ++    G  L   VV+  +     +  + KHN  G   F  ++++   E    ++      + RL       D   +         TLV  ++E A+ +A      +  VTL G  +   GT++GG       R+         Q+  ++ME ++QE     + Y  ++  L+  +  +          + KL     V+ + E++  KL+      KE +     A P K  +L  L   LE  K   E      G           L+ +++     ++Q +VDK+N+ I        +A        A KT      D NL + ++ L    TE  + +  + +    +EL++++E      K+   ++E+  EV E +R L  +L+ L  +E+ Y
Sbjct:   89 LMITHIVNENFKSYAGKQVLGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSKKLSVLIHNSEAHPDLYSCTVEVHFQKIVDKEGDDFDVIPSSEFYVS-RSATKDSVSSYTVSGHKATFRDVGQLLRSHGIDLDHNRFLILQGEVEQIALMKPKAQTEHDEGMLEYMEDIIGSGRF-------KPAIEACCRRVEQLNELRGEKLNRVKVVEKEKDGL-EAEKNN----AVAFLMAENDITNLKNSLVQHKMQTARKALATEERKKA------DIEEASKDLKE------KMAELVQAKKGKAKELQAIDKWKLNKINAFIEEHK-----KTFVQYDLQDVKMRENLKNCASKEKKLAKQLVKDTDKLKEIRNVPAASDRTIK--VATECKAKLEASKSVEEEKLKSVMANFEKETKGLQEEKEVKQQELLALSKEVNERCSRMEVAQSELDLYMSRHTSALAALNEAKQALTSTTEGLCGRRENIRKLETTIPSTEKELAQAQLELEKLAPLENAARAEVRALRQKTEEAKSSLCASRSRNKVLQLLMDQKNKGS--LPGIYGRLGDLGAIEEKYDVAISSCCGA-LDNIVVDTMDTAQACVTYLKKHNI-GSATFIGLDKMRVWEGTMKKSVQGPEGVLRLFDLVRVGDEAVRTAFYFTLRDTLVANNLEQASRVAFQHQRRWRVVTLQGQVIETSGTMSGGGTRVMKGRMGSSVVSEVPQEEVERMEHKLQEESAKMEQYQQQRSQLEERVQTLQTSLRDMKYNLQKLSAGVKVQVEQEVSL-KLQ-----VKELEANVVAAAPDKN-QLKKLEKTLEGFKKEYEKVSSRTGKIEAEVKRIHGLIMEITQGRLKAQQDKVDKINQQIDECVSDITKAQV------ALKTA-----DRNLKKAEEALAK--TEREQEENRQAIVRLNEELKSLEEAAAEIMKECTHAQERGKEVSELQRELMGELKALSEEEQGY 1016          

HSP 2 Score: 74.3294 bits (181), Expect = 1.589e-13
Identity = 49/147 (33.33%), Postives = 69/147 (46.94%), Query Frame = 1
Query: 3193 FKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            F  +++  +E ++ L   G AEL           L D  DP S           GI  S        K +  LSGG+K+L +L L+FA+    P P Y  DEIDAALD +    VA  +   +K+AQFI  + R  M E ++R  G+
Sbjct: 1149 FNVITNKLKENYQMLTQGGDAEL----------ELVDSLDPFSE----------GIVFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVALYVYEQTKNAQFIIISLRNNMFEMSDRLIGI 1275          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000346.1 (pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 gene:ENSPMAG00000000296.1 transcript:ENSPMAT00000000346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.493e-12
Identity = 44/149 (29.53%), Postives = 71/149 (47.65%), Query Frame = 1
Query: 3190 TFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLS-KDAQFITTTFRPEMLEAAERFYGV 3633
              + +S    +I+KKL  +  A+  +     ++  LD                  GI  +      + + M+ LSGG+K++ AL L+FAI    P+PF++ DEIDAALD      VA+ IK  S ++ Q I  + + E+   A+   GV
Sbjct: 1065 CLEHLSIAIDDIYKKLAQNNSAQAFLGPENAEEPYLD------------------GINYNCVAPGKRYQPMDNLSGGEKTVAALALLFAIHSYRPSPFFVLDEIDAALDNTNIGKVANYIKEQSVENFQVIVISLKEELFARADALIGV 1195          

HSP 2 Score: 59.3066 bits (142), Expect = 6.640e-9
Identity = 41/165 (24.85%), Postives = 83/165 (50.30%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVS--AYVEIIF-DNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVA 585
            Y++ + ++ F+SY+ +   G F    + ++G NGSGKSN   AI FVL ++  +L  +   +L++     R V+  A+V +++ +   +   F +T      IIG+   +Y +DK+++  ++    L   G       ++V QG +  +A     +R  L  +++
Sbjct:    3 YLQLIEVENFKSYQGKQTIGPF-TRFSAVIGPNGSGKSNLMDAISFVLGEQKRNLRVRSLRDLVYGAPVGRPVATRAHVSMMYAEEGGSHTVFTRT------IIGS-TSEYRVDKRVLNFSEYSAQLAKRGILTKARNFLVFQGAVESIAMKTPKERTWLFEQIS 159          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002584.1 (pep scaffold:Pmarinus_7.0:GL477247:652:6382:-1 gene:ENSPMAG00000002354.1 transcript:ENSPMAT00000002584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.818e-12
Identity = 48/166 (28.92%), Postives = 83/166 (50.00%), Query Frame = 1
Query:  100 YIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGT--GPRVVSAYVEIIF--DNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVA 585
            ++K + ++ F+SY+ +   G F      I+G NGSGKSN   AI FVL ++ S+L  +   +L+H      P    AYV +++  DN + +       V  R IIG+   +Y ++ K+V   +  + LE  G       ++V QG +  +A     +R +L  E++
Sbjct:    3 FLKLIELENFKSYKGKQIIGPFK-RFAAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKTLKDLIHGAPVGKPAANKAYVSMVYAEDNGEEK-------VFTRYIIGS-SSEYRINSKVVQLQEYSSELEKLGILIKARNFLVFQGAVESIAMKNPKERTQLFEEIS 159          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 63.929 bits (154), Expect = 1.906e-10
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = 1
Query: 3157 LDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALD 3516
            +  ++++     F+ VS    EI+K L  +  A+  +     ++  LD                  GI  +      + + M+ LSGG+K++ AL L+FA     PAPF++ DEIDAALD
Sbjct:  693 IKKERFDRFNACFEAVSTNIDEIYKALSRNASAQAFLGPENPEEPYLD------------------GINYNCVAPGKRFRPMDNLSGGEKTVAALALLFATHSYKPAPFFVLDEIDAALD 794          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC3 (Subunit of the multiprotein cohesin complex; required for sister chromatid cohesion in mitotic cells; also required, with Rec8p, for cohesion and recombination during meiosis; phylogenetically conserved SMC chromosomal ATPase family member [Source:SGD;Acc:S000003610])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 414/1259 (32.88%), Postives = 697/1259 (55.36%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKT-------EVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRD----LRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKD----------KENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESV-YPETNDA----IPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEV--LDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGT---DLL----TQLSTSEQREVDKLNETIQG------LTIKAKEAYTERM-CLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRL---ETQ----LENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADAL-EKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRK-----GKHDDTL---LDDEEDPSSSIPEVE-RFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFV 3696
            MYIK+VII+GF++YR++T    F PH N+I+G NGSGKSNFF AI+FVLSD+YS+L  +ER  L+H+G+G  V+SA VEI+F + D+ +            EV++RR +G KKD Y L+ + VTK D++ +LE+AGFS +NPY IV QGKI  L  A D +RL+LL +V G + ++ + + S +  +E+E K  QIN+ +  ++ +L  +E E KEL++Y + +R+R+  +FT++DREL ++  +++ +      +  ++    +   K  D I+++ +        L++K      +++Q +   SE  Q+   + + + D +         R      L+ +   I+Q +++L +I P+Y+    +E      L+  + ++++L  K+G   +F+S+ +RD WI  +++ L  +I++             ++RK    ID +I   E+L++ ++G +      + +LE    EL  L+++  E    R+ ++R+E K+Q  L  L  ++N+ + N+     +S+ NG+ +V+ + E  +          +  +GTL ELI   D + T  EV  G  LF+ VV+ EE    I+ E+ +    G + F P+NRL     V +P          P++ ++ ++ +F+  + H FGKT+V + +     LAK    + +TLDGD+  +RG LTGGY DQ   R  L+  K   E   Q  + +++    R E+  +D+ I+++   +++    R       + +  +I +++   + K   K   E  L ++   LE++   R   Q +L T   DLL    ++LS  E+  ++ L + I        +T  A E  T  +  L AE       L+  L+ +++ LE++M+EV +  I       +DEL+ +    E+ +KQ  ++  +L  VQ E   L   ET     LE   +Q++     + + Q+++EK   K++ L+ ++EE  ++IREIG LP DAL   F+D T  QL + L+  N EI    +VNK+A + F  +NE ++ L +R  ELD+   +I DL+  L  QK  A+  TF++VS  F+ +F++LVP G A+LII +       HD+++   +D E + S +  + E  +TGV I VSF     +   + QLSGGQK++ A+ LI AIQ  DPA FYLFDEIDAALD QYR AVA ++K LSK+AQFI TTFR +ML+ A++F+ VK+ NK+S + +V++EEA+ F+
Sbjct:    1 MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNAT---DLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNELESQLQMDRTSLRKQYSAIDEEI---EELIDSINGPDT-----KGQLEDFDSELIHLKQKLSESLDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKIS-------PESVFGTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMK-GGRVTFIPLNRLSLDSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAITLDGDRADKRGVLTGGYLDQH-KRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKIDQVNGNIRKVSNDR-------ESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQEKLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNAE-------LESKLIPQENDLESKMSEVGDAFIFG----LQDELKELQLEKESVEKQHENAVLELGTVQREIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIGLLPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRVKYENKISTVIEVNREEAIGFI 1221          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC4 (Subunit of the condensin complex; condensin reorganizes chromosomes during both mitosis and meiosis; forms a subcomplex with Smc2p that has ATP-hydrolyzing and DNA-binding activity, but other condensin subunits are required for chromatin binding; required for tRNA gene clustering at the nucleolus; potential Cdc28p substrate [Source:SGD;Acc:S000004076])

HSP 1 Score: 102.834 bits (255), Expect = 2.217e-22
Identity = 154/732 (21.04%), Postives = 321/732 (43.85%), Query Frame = 1
Query:   55 IYESLTGFKRCSCTMYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTG-PRV----VSAYVEIIFDNSDNRIPFDKTEVSL---RRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATA-------PDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDL---RLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQG-RVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQAD--RQTVYRQESK-----VQQQLNNLRDELNRTEHNL-------------------RSITGKSILNGLDSVRRVIEIFR--EKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLT--FDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLN-FDCVTLDGDQVSRRGTLTGG 2100
            IY+      +    ++I +++++ F+SY  +   G F    + +VG NGSGKSN   ++ FV     + +      +L+H+    P +    V+ + + + D S      D+ +  L   R+   N   +Y++++K  + T+V  LL++ G    +  +++ QG++  +A          D+  L+ L ++ GT  Y       K + +E   +++ +NE+    ++R   ++ E   L+  ++      +LEF   +++L  ++ KL + K            + ++  K A  +EK+    +DL   ++K  + + +V++I++   E   R              +R     R   ++  + ++ K+++ +K L+  K              +S+S+AE+  +EL  +Q     + +  TQ  E  +  +  +  ++KDK    + +S EI    K +E    +L   E+ ++    EL  + E   KL++  + ++     +  ++QE +     ++++LN+L+DE ++ E N                    R++  +S L+   +  +V+      +K G     + G++G L +L    D+F  ++  TA  RL   VV+  E     +  + K+   G   F  ++RL         T + +P +  L    + KF N        TLV ++++ A  +A     F  VT+DG  +   GT++GG
Sbjct:  140 IYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANY-------KPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKET-----ALEFLEKEKQLTLLRSKLFQFK------------LLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTK--------------HSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKDK---TKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGR----INGFHGRLGDLGVIDDSFDVAIS-TACPRLDDVVVDTVECAQHCIDYLRKNKL-GYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGG 824          

HSP 2 Score: 89.3521 bits (220), Expect = 2.926e-18
Identity = 53/163 (32.52%), Postives = 82/163 (50.31%), Query Frame = 1
Query: 3157 LDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRN 3645
            L  ++++  +  F  +S   +E+++ +   G AEL           L D  DP S           G+  S        +++  LSGG+K+L +L L+FA+ K  P P Y+ DEIDAALD +    VA+ IK  +K+AQFI  + R  M E A++  GV  R+
Sbjct: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAEL----------ELVDSLDPFSE----------GVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRD 1401          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC2 (Subunit of the condensin complex; condensin reorganizes chromosomes during both mitosis and meiosis; essential SMC chromosomal ATPase family member that forms a subcomplex with Smc2p that has ATP-hydrolyzing and DNA-binding activity, but other condensin subunits are required for chromatin binding; required for clustering of tRNA genes at the nucleolus [Source:SGD;Acc:S000001927])

HSP 1 Score: 95.1301 bits (235), Expect = 3.651e-20
Identity = 53/168 (31.55%), Postives = 88/168 (52.38%), Query Frame = 1
Query: 3157 LDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHI 3660
            L+  K E +V T+++V+  F  IF  L+P+  A+L+  +GK                         G+EV    G+   + + +LSGGQ+SL+AL+LI A+ +  PAP Y+ DE+DAALD  + + +  +IK   K +QFI  + +  M   A R +  +F++  S +
Sbjct: 1021 LNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKD---------------------VTQGLEVKVKLGNIWKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFANANRVFRTRFQDGTSVV 1167          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC1 (Subunit of the multiprotein cohesin complex; essential protein involved in chromosome segregation and in double-strand DNA break repair; SMC chromosomal ATPase family member, binds DNA with a preference for DNA with secondary structure [Source:SGD;Acc:S000001886])

HSP 1 Score: 84.7297 bits (208), Expect = 7.030e-17
Identity = 50/151 (33.11%), Postives = 80/151 (52.98%), Query Frame = 1
Query: 3190 TFKQVSHYFQEIFKKLV--PDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMI-KGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            TF  VS +   I+++L   P+   EL    G +    ++DE++P ++          GI+   T    + KDM  LSGG+K++ AL L+FAI    P+PF++ DE+DAALD    + +A  I +  + D QFI  + +  M E ++   GV
Sbjct: 1067 TFDYVSDHLDAIYRELTKNPNSNVEL---AGGNASLTIEDEDEPFNA----------GIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGV 1204          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO34136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ80])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 501/1123 (44.61%), Postives = 738/1123 (65.72%), Query Frame = 1
Query:  112 VIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS-DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDY----RDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGH-----------QAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDP----------SSSIPEVERFTGVGIEVSFTGGDAQMKDM 3402
            VIIQGFRSYRDQT    F   HN+IVGRNGSGKSNFF AIQFVLS DE+S+L  +ER  LLHEGTGPRVVSA+VE+IFDNSDNR+P +K EVSLRR+IG KKDQYFLDKK VTK+DVMNLLESAGFSRSNPYYIVKQG+I QLA A DN+RLKLLREVAGTRVYDERKEESKQI K+SE K ++I ELL  I+DRL+TLE E +ELK YQK DR+RR LE+TI D+EL+D + KL+E+ D         L+     K+  D  EKLE  Y    RDL  KE  +  E +Q++    E +++R +L+L + D +T+    A  +   +++L+R+   I Q Q+ L+ + P Y   RA+E++    LS  E RR EL+AKQGR NQF S+  RD WIK++MKSL   +  KE+  ++L    ++DIK + +   +L+    ++E  R  +E  ++E  +L+R++DE+   R+ ++RQE+ ++Q +N  R+EL+++E  L+    K I NG+++V+++++   EK       +QG YG LIE   C + F+T+VEVTAG RLF+ +V+ ++    IL  +N+   PGE+ F P+N++  + + +P+++D +PM+S+L FD   +  M   FGKTL+CR +++AT  +K+ N DC+TLDGDQVSRRG LTGG+YD R SRL+LQ+       ++++ E   Q   T  E +D  I  ++ KLQ+ ET + +   T++K K D+    + +    +A   KE KL++L  DL  M+ + +S+  ELGT+LL+QL++ +Q EVD++N  I  L  + + + T                     R+ + LE    E+S  D  ++L+    +L+A+   ++  ++++   E +++ V ++K + +T+LE  +  E+   ++IQ+D ++LEK+ +K+S L+KKK+E ++KIRE+GSLP+DA +KF    +K L+K L   N E+K+YSHVNKKALDQF++++E+KEKL+KRK+ELDKG+           QAI+DLM  L+ +K+EAI+ TFKQVS YF ++F+KLV +G+  L+++        ++ ++DP            S+P V+ FTGV I+VSFTG  A+ ++M
Sbjct:    1 VIIQGFRSYRDQTIIEPFSSKHNVIVGRNGSGKSNFFFAIQFVLSADEFSNLRQEERQALLHEGTGPRVVSAFVELIFDNSDNRLPIEKDEVSLRRVIGAKKDQYFLDKKNVTKSDVMNLLESAGFSRSNPYYIVKQGRINQLAVAKDNERLKLLREVAGTRVYDERKEESKQILKDSENKKEKIEELLKYIEDRLQTLEEEKEELKAYQKWDRERRCLEYTIHDKELRDTREKLEEVSD----FHTMCLEYTIHDKELRDTREKLEEKYSQSIRDLGEKENVLTSEKKQLEEECQENIKQRTKLELDIKDLETSASDDATTKESYREELERLQGTISQQQQELDNLLPSYNEYRAEEEQCTLRLSACEQRRTELYAKQGRKNQFSSKEARDNWIKKEMKSLTSTVAKKESQFQRL----ETDIKVLHNRPFKLTD---DLEQRRSSIEQNNKEYSELKRKRDELTNTRKELWRQEAAMEQTINTAREELSKSERGLKGTVNKGISNGIETVKKIMQ---EKN------LQGVYGPLIENFTCNEKFFTAVEVTAGNRLFHIIVDTDKTASLILSTMNRQKMPGEVTFMPLNKVKIKPTNFPKSDDVMPMISKLNFDDTLRPAMELAFGKTLICRDLDVATQYSKSENLDCITLDGDQVSRRGALTGGHYDTRKSRLDLQRTIWSSGKKVEDEEVQLQTIKTSLEEIDGQITTVLGKLQKAETRQVQLRETYEKQKLDVRAMTQSKERTEQALKAKESKLSTLETDLGAMRSSLKSWNDELGTELLSQLTSQDQEEVDRINRDINDLQERLRTSVT---------------------RRTEALE----EISIEDQQQQLETRRADLKAVVHVVKKARERLKELESEVSHVAKKKTKAQTKLEEWKVIERSRLEAIQEDARSLEKIANKRSLLVKKKDECMKKIRELGSLPSDAFDKFQKTALKTLWKKLHHCNEELKKYSHVNKKALDQFINFSEQKEKLMKRKDELDKGYEASHHFFIVLCQAIVDLMDVLEMRKHEAILFTFKQVSKYFSDVFEKLVHNGKGTLVMKTDP-----IEHQDDPDSQSSSQASSQGSVPLVDTFTGVAIKVSFTGKAAETREM 1073          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO34135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ79])

HSP 1 Score: 178.718 bits (452), Expect = 1.860e-52
Identity = 84/106 (79.25%), Postives = 96/106 (90.57%), Query Frame = 1
Query: 3400 MNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MNQLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALDPQ+RKAVA+MI+ L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E+A DF+EDD  HG
Sbjct:    1 MNQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDPQFRKAVAEMIRNLAVKAQFITTTFRPELLESADKFYGVKFRNKVSHIDAITLEQAKDFIEDDD-HG 105          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO40646 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7S6N1])

HSP 1 Score: 101.293 bits (251), Expect = 1.538e-21
Identity = 168/791 (21.24%), Postives = 344/791 (43.49%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTG-PRVVSAYVEIIFD------NSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLA-------TAPDNQRLKLLREVAGTRVYDERKEE-SKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTT---KRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQ-------ELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHAR---ESVYPETNDAIPMMSRLTF--DAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGG-----------YYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHA 2340
            + I K++ + F+SY      G F    + IVG NGSGKSN   A+ FV       +  ++   L+H  +  P V S  V + F       N +  +  D   V  R    +    Y ++ + +   +V  LL   G    +  +++ QG++ Q++       T  ++  L+ L ++ G+  Y E  EE +K++   +EA+ +++N  + +++     LE    E  EY   +        T+F R + +  +  ++ + +R++      ++ K    C+D  +   ++Y+        M  E ++++ +  E  +     +   +D K     K G  N + + QK L++   K+  ++   E+ + Q E    K  ++ +     E +  E+ A  G  ++ +      E  ++Q+   NK + + ++ +     E++    + ++   +L  A AN+E V Q       E++++ +EL  L+    + +AD +   + E+K  Q+L ++R ++     +L++   +S  N L++      + ++K       + G YG L +L    D +  ++    G  L + V +  E     +Q + K+N  G   F  ++++       S   +T   +P +  L    DAK           TLV   +E AT +A   N  +  VTL G  + + GT++GG            +    S  +L+  +QK+E E + TE     Y  +K+ L+  ++E     Q+K+    +H++  +++  ++    E+Q A
Sbjct:   14 LMITKIVNENFKSYAGVQELGPFHKSFSSIVGPNGSGKSNVIDAMLFVFGYRSKMIRTKKVSQLIHNSSAHPNVASCTVSVHFQRIIDLVNDEFEVVPDSNFVVSRTARKDNSSDYHVNGRKMPFKEVAKLLRDVGIDLDHNRFLILQGEVEQISMMKPKALTEHEDGMLEYLEDIIGSSRYKEPIEELAKEVEVLNEARGEKLNR-VKAVEKEKDELEGSKDEAVEYINMENGITRKRNTLFQRYIYECSQNEEKAQSKRDEVKTGFDELHKQLADCSDRKKTKGKEYKG-------MTKECDKLRKVAEETKENFAAYER--DDLKLREDFKHGKVNGK-KLQKSLEKEKEKLASLKDAPEKNQKQVEELEKKIQQLESQKIKEEDKLAEVMA--GLKSETEGLQNEKEEKEKQLMEKNKDVNETKSKMDVAKSELEIYNSQHKNAQTQLREAHANLESVIQKQTQRKSEIKSIEKELPDLKNNLKKAEADLEKAVQGEAKSSQELRSIRSKVEEARSSLQA--SRSRGNVLEA------LMKQKAAGK---IPGLYGRLGDLGAIDDKYDIAISTACGA-LDHIVCDTMETAQTCVQYLKKNNI-GAATFIGLDKVEVWRKDASSKIQTPSNVPRLYDLVRVKDAKVSTAFYFALRNTLVADELEQATRIAFQGNKRWRVVTLQGSLIDQSGTMSGGGTRVAKGRMCSSFVSDVSPQQLKSMEQKLEQEEKATE----EYREQKKQLEEAVDE-----QKKKVSNLEHQLEKNRM--EVQALSEQQQA 767          

HSP 2 Score: 85.5001 bits (210), Expect = 1.085e-16
Identity = 53/160 (33.12%), Postives = 80/160 (50.00%), Query Frame = 1
Query: 3154 ALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            AL  ++ +  +  F  ++   +E+++ +   G AEL           L D  DP S           GI  S        K+++ LSGG+K+L +L L+FA+    P P Y+ DEIDAALD +    VA+ IK  +K+AQFI  + R  M E A+R  G+
Sbjct: 1061 ALRKKRLDEFMAGFSIITTKLKEMYQMITLGGDAEL----------ELVDSLDPFSE----------GIVFSVRPPKKSWKNISNLSGGEKTLSSLALVFALHHFKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIIISLRNNMFELADRLIGI 1200          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO49596 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7RFF3])

HSP 1 Score: 73.1738 bits (178), Expect = 6.092e-13
Identity = 47/157 (29.94%), Postives = 77/157 (49.04%), Query Frame = 1
Query: 3166 QKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDA-QFITTTFRPEMLEAAERFYGV 3633
            ++Y+  +  F+ VS    +I+K+L  +  A+  +          +D E+P         + G GI  +      + + M+ LSGG+K++ AL L+F+I    PAPF++ DEIDAALD      VA  I   +K+  Q I  + + E    AE   G+
Sbjct: 1055 ERYDRFMSAFEHVSTKIDDIYKELANNPSAQAFLGP--------EDAEEP---------YLG-GINYNCVAPGKRFRPMDNLSGGEKTVAALALLFSIHSYQPAPFFVLDEIDAALDNTNINKVARHIINQTKEYFQCIVISLKEEFYTRAEALIGI 1193          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc3 (structural maintenance of chromosomes 3 [Source:NCBI gene;Acc:100049276])

HSP 1 Score: 1145.18 bits (2961), Expect = 0.000e+0
Identity = 621/1221 (50.86%), Postives = 871/1221 (71.33%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS---------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MYIK+VIIQGFRSYRDQT    F P HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE     +  +R A +   D +E+ ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L+E +P++ + + KE+   + L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++    C   FYT VEVTAGTRLFYH+VE +E+  KIL E NK N PGE+ F P+++L  R++ YPETNDAIPM+S+L +   F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N     E +++ I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +QR VD LN+ I+ L    ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL  I++R++    +    +  + + + E +     +E  ++ EK+  D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   T+KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR++ELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DEE  +         SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+DMI  L+  AQFITTTFRPE+LE+A++FYGVKFRNKVSHID ++ E+A DFVEDD THG
Sbjct:    1 MYIKQVIIQGFRSYRDQTVVDPFSPKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEDEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKSKISAMKEEREQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNMVKEKEERGISRLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKTRVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFECEPAFYTCVEVTAGTRLFYHIVETDEVSTKILMEFNKMNLPGEVTFLPLSKLDVRDTAYPETNDAIPMISKLRYSPNFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDMRKAEEELTELEAKLNENLRRNI----ERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQRRVDDLNDEIRQLQQDNRQLLNERIKLEGIMTRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELDGINKRVKETLSRSEDLDSLIDKTEGEIKDHIKSMERWKNIEKEQNDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLTLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQDELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDAEGSQSQDEEGGADSERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIVELAGHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEQAKDFVEDDTTHG 1216          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc3 (structural maintenance of chromosomes 3 [Source:NCBI gene;Acc:100049276])

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 554/1162 (47.68%), Postives = 789/1162 (67.90%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQK-----RKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPS---------SSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVA 3540
            MYIK+VIIQGFRSYRDQT    F P HN+IVGRNGSGKSNFF AIQFVLSDE+SHL P++R+ LLHEGTGPRV+SA+VEIIFDNSDNR+P DK EVSLRR+IG KKDQYFLDKKMVTK DVMNLLESAGFSRSNPYYIVKQGKI Q+ATAPD+QRLKLLREVAGTRVYDERKEES  + KE+E K ++INELL  I++RL TLE E +EL +YQK D+ RR+LE+TI+++EL + + KLDE+  +RE     +  +R A +   D +E+ ER  R+L+ K   M +E EQ+ +   E++++R +L+L   D +    G +  R R  K+ Q+++ KI++ QK L+E +P++ + + KE+   + L+ A   R +L+AKQGR +QF S+ +RD+WIK+++KSL++AI DK+  I  +  +++      E  + + +  + ++  V+  +E + ++  +++ +KDE+Q++R  ++R+E+  QQ L   R++L + +  LR+ TGK+ILNG+DS+ +V+E FR K G + HV+ GY+G ++    C   FYT VEVTAGT     V+E+ +L                                    DAIPM+S+L +   F     H FGKTL+CRS+E++T LA+    DC+TL+GDQVS RG LTGGYYD R SRLELQK      ++  E+E +  EN+++N    + +L   I+++++++Q+ ET + K + + D +  ++ + KE++    +    K+  L SL   L  M+ TRES + ELGTDLL+QLS  +QR VD LN+ I+ L    ++   ER+ LE   T  ET L+ NL ++ DQ+E E+ E+ ET+    L     EL  I++R++    +    +  + + + E +     +E  ++ EK+  D+I  D + LEKM ++Q  LLKKKEE ++KIRE+GSLP +A EK+   T+KQL++ L++ N E+K+YSHVNKKALDQFV+++E+KEKL+KR++ELD+G+++I++LM  L+ +KYEAI LTFKQVS  F E+F+KLVP G+A L+++KG  + +   DEE  +         SS+P V++FTGVGI VSFTG   +M++M QLSGGQKSLVAL LIFAIQKCDPAPFYLFDEID ALD Q+RKAV+
Sbjct:    1 MYIKQVIIQGFRSYRDQTVVDPFSPKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEDEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKSKISAMKEEREQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNMVKEKEERGISRLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKTRVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRK-GINQHVINGYHGIVMNNFECEPAFYTCVEVTAGT----SVLEDHKL------------------------------------DAIPMISKLRYSPNFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDMRKAEEELTELEAKLNENLRRNI---EHILYERIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQRRVDDLNDEIRQLQQDNRQLLNERIKLEGIMTRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELDGINKRVKETLSRSEDLDSLIDKTEGEIKDHIKSMERWKNIEKEQNDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLTLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQDELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDAEGSQSQDEEGGADSERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVS 1118          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc2 (structural maintenance of chromosomes 2 [Source:NCBI gene;Acc:101160532])

HSP 1 Score: 127.102 bits (318), Expect = 4.638e-29
Identity = 76/231 (32.90%), Postives = 129/231 (55.84%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS-DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSD-NRIPF-----DKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELL-SSIDDRLRTLESETKELKEYQKCDRDRRSL 765
            MYIK +II+GF+SY  +T    FDP  N I G NGSGKSN   +I F+L     SH+      +L+++     +  A V I FDNS+ ++ P      D+  V+ + +IG + ++Y ++      T V +L  S G + +NP++++ QG+IT++      + L ++ E AGTR+Y+ +K  +++  ++ EAK+ +I  +L   I   ++ L+ E     EYQK  R+ + L
Sbjct:    1 MYIKSIIIEGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSHVRASNLQDLVYKNGQGGITKATVSITFDNSNKSQSPLGFETHDEITVTRQVVIGGR-NKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKISAQRTIEKKEAKLREIQTILDEEITPTMQKLQEERSSYLEYQKLMREIQHL 230          

HSP 2 Score: 97.8265 bits (242), Expect = 4.704e-20
Identity = 54/181 (29.83%), Postives = 93/181 (51.38%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGV--GIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVS 3672
            I+  ++ LD +K EA+ L +++V+  F  IF  L+P   A+L  ++G                        GV  G+E     GD   +++ +LSGGQ+SLVAL+LI A+    PAP Y+ DE+DAALD  + + +  M++   + +QF+  + +  M   A   +  KF + +S + + +
Sbjct: 1015 ILQTIEELDQKKNEALNLAWQKVNKDFGSIFSTLLPGATAKLAPQQG-----------------------CGVLDGLEFKVALGDTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRRSQFVVVSLKDGMFTNANVLFKTKFVDGMSTVTRTA 1172          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc2 (structural maintenance of chromosomes 2 [Source:NCBI gene;Acc:101160532])

HSP 1 Score: 125.176 bits (313), Expect = 1.791e-28
Identity = 181/747 (24.23%), Postives = 319/747 (42.70%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS-DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSD-NRIPF-----DKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLAT----------------------------APDNQRL-----------KLLREVAG-TRVY--------DERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKEL--KEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKA-----AKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAI------PMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRL 2127
            MYIK +II+GF+SY  +T    FDP  N I G NGSGKSN   +I F+L     SH+      +L+++     +  A V I FDNS+ ++ P      D+  V+ + +IG  +++Y ++      T V +L  S G + +NP++++ QG+IT++                               P  Q+L           KL+RE+   +R+Y        +E K +S +  K  +  + ++   +S  + +++ L ++ +EL  K  Q+ + + ++LE +     L  ++R     +D + QSS   LD++K       KK  + ++ +E D + L +KE ++    EQ+Q++  E  +   +L+     +K    G         +D +   L  Q +  + E  K   E   AK+ +M       +H + EL  KQ  + +  S  ++D+              D    ++   +++++++ ++    N   G E          E++ E+ R+L R   EV   ++T  R  S+      +LR E    E        K +L  L SV  V                  Y T +E             V AG RL+  VV+ E    K+L+   K          P+N++ A+       ND +        +S + +++  +  M + FG TLVC +++ A  +A  K +    VTL GD    +GTL+GG   Q  S L
Sbjct:    1 MYIKSIIIEGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSHVRASNLQDLVYKNGQGGITKATVSITFDNSNKSQSPLGFETHDEITVTRQVVIGG-RNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEVCTLFDEKKSIIETLLLILDEEITPTMQKLQEERSSYLEYQKLMREIQHLSRLYVAWLFVCAEETKVKSAENLKVMQGNIVKMQAKVSENESKIQELSAQIQELQKKNDQEVNGELKTLEMS-----LASVQR-----EDAKAQSS---LDLKKQNLKDETKKRKELVKSMEEDKKVLVVKEKEVSKLSEQLQALQVEGQKNTAELEAAEQHFKAVSAG-----LSTNEDGEEATLAGQMMACKNEMSKADTE---AKQAQM-----TLKHAQAELKTKQAEMKKMDSGYKKDQ--------------DTFKAVKSSREKLEAELAKL----NYEDGKE----------ESLMEKRRQLSR---EVAQLKETFDRLMSR----FPSLRFEYKDPERGWDRSKVKGLLANLISVSDV-----------------SYATALE-------------VVAGGRLYNIVVDTEVTGKKLLE---KGELQRRYTIIPLNKISAK-----TLNDKVGEDNVHTALSLVGYESDLRKAMEYVFGSTLVCDTLDNAKKVAFDKQVMTKTVTLGGDIFDPQGTLSGGARSQSASIL 647          

HSP 2 Score: 97.8265 bits (242), Expect = 5.185e-20
Identity = 54/181 (29.83%), Postives = 93/181 (51.38%), Query Frame = 1
Query: 3136 IIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGV--GIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVS 3672
            I+  ++ LD +K EA+ L +++V+  F  IF  L+P   A+L  ++G                        GV  G+E     GD   +++ +LSGGQ+SLVAL+LI A+    PAP Y+ DE+DAALD  + + +  M++   + +QF+  + +  M   A   +  KF + +S + + +
Sbjct:  987 ILQTIEELDQKKNEALNLAWQKVNKDFGSIFSTLLPGATAKLAPQQG-----------------------CGVLDGLEFKVALGDTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRRSQFVVVSLKDGMFTNANVLFKTKFVDGMSTVTRTA 1144          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:101157474])

HSP 1 Score: 78.1814 bits (191), Expect = 4.810e-14
Identity = 51/147 (34.69%), Postives = 69/147 (46.94%), Query Frame = 1
Query: 3193 FKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            F  +++  +E ++ L   G AEL           L D  DP S           GI  S        K +  LSGG+K+L +L L+FA+    P P Y  DEIDAALD +    VA  I   +K+AQFI  + R  M E A+R  G+
Sbjct: 1065 FNMITNKLKENYQMLTLGGDAEL----------ELVDSLDPFSE----------GIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKNAQFIIISLRNNMFEIADRLIGI 1191          

HSP 2 Score: 60.4622 bits (145), Expect = 1.193e-8
Identity = 144/716 (20.11%), Postives = 303/716 (42.32%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPR-VVSAYVEIIFDNSDNR-------IPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLA-------TAPDNQRLKLLREVAGT-RVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLK---------IQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNEL-------SGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSI-----TGKSILNGLDSVRRVIEIFRE--KFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGT--RLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVY-----PETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLA--KNLNFDCVTLDGDQVSRRGTLTGG 2100
            + I  ++ + F+SY  +   G F    + I+G NGSGKSN   ++ FV       +  ++   L+H     + V S  VE+ F    ++       IP  K  VS R    +    Y ++ K  T  +V  LL S G    +  +++ QG++ Q+A       T  D   L+ L ++ G+ R+    +  +++I   +E + +++N  +  ++     LE E  +  E+ K + D    +  ++   + D+++++ + +  +++    T ++ +   K + ++EK+  + +++  K+ ++   +E                              A      Q DLQ V ++          + +QK+LE+ + + E  ++       ++S+A  R+++L  ++ +V +     +  E +KE+   L +  + KE  + +LS  ++    R++   +EL         A A +   +Q L+  S+ L++ R    +++       ++  K Q++L  L    N T   ++ +       K+ L+   S  +V++   +  K G     + G YG L +L    + +  ++    G    +    ++  +  +  L+E N     G   F  ++++   E        PE +  +  M R+  D+  +         TLV + +E AT +A  K   +  VTL G  +   GT+TGG
Sbjct:   65 LMITHLVNRNFKSYAGEQILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSKKLSVLIHSSDKHKDVQSCTVEVHFQKIIDKEGDDYEVIPNSKFYVS-RTANKDGSSAYHINGKKATFKEVGALLRSHGIDLDHNRFLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGSCRLKKPIQVLARRIELLNEQRGEKLNR-VKLVEKEKNALEGEKNKAVEFLKLENDIFKHKSQLYQYYVHDLQQRVVDKEQEKQKILEETKELTEKNAKISQEMEKMNEELKNVEKKQNKINKYIE------------------------------AQKEQFTQLDLQDVEVREKIKHSKNKKKTLQKQLEKEQKKLEEVQSIPSSSEKAISEATARKEDL--EKQKVKEEDKLKEVMESLKEETSGLQQDKEKKEKELMELSKAVNETRSRMDLAQSELDIYLSRHKTALAQLNTAKQTLQTTSDTLKERRAAIKDLEVQIPEKVQELKKDQEELEKLTKMDNETREVVKELREKVDEAKTSLSSNRSRGKVLDALMQLKKTGR----IPGIYGRLGDLGAIDEKYDVAISSCCGALDNIVVDTIDTAQKCVTFLKEQN----IGVATFIGLDKMKTWEKNMAPIRTPEDSPRLFDMVRVNDDS-VRPAFYFALRDTLVAQDMEQATRMAFQKEKRWRVVTLKGQIIEMAGTMTGG 737          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017173.1 (SMESG000017173.1)

HSP 1 Score: 1768.44 bits (4579), Expect = 0.000e+0
Identity = 924/924 (100.00%), Postives = 924/924 (100.00%), Query Frame = 1
Query:  946 MIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            MIDEVEQIQSMLSEKLQRREQLQLLVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNLEKMQSKQSQLLKKKEETLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNEEKEKLLKRKEELDKGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG
Sbjct:    1 MIDEVEQIQSMLSEKLQRREQLQLLVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNLEKMQSKQSQLLKKKEETLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNEEKEKLLKRKEELDKGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 924          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017173.1 (SMESG000017173.1)

HSP 1 Score: 1753.8 bits (4541), Expect = 0.000e+0
Identity = 899/899 (100.00%), Postives = 899/899 (100.00%), Query Frame = 1
Query: 1021 VNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNXXXXXXXXXXXXXXXXXTLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNXXXXXXXXXXXXXXXGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 3717
            VNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNLEKMQSKQSQLLKKKEETLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNEEKEKLLKRKEELDKGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG
Sbjct:   16 VNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFDCVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNYITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKTEAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKLNETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEVSETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQLENLRSQEKDYADSIQDDQQNLEKMQSKQSQLLKKKEETLRKIREIGSLPADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNEEKEKLLKRKEELDKGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFVEDDQTHG 914          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017172.1 (SMESG000017172.1)

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 268/268 (100.00%), Postives = 268/268 (100.00%), Query Frame = 1
Query:   97 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIE 900
            MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIE
Sbjct:    1 MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRLRTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIE 268          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000036986.1 (SMESG000036986.1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.345e-17
Identity = 53/164 (32.32%), Postives = 82/164 (50.00%), Query Frame = 1
Query: 3142 DLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGV 3633
            D ++ +  Q+++     F  ++   +E+++ +   G AEL           L D  DP S           GI  S        K+++ LSGG+K+L +L L+FA+    P PFY+ DEIDAALD +    VA+ IK  +K+AQFI  + R  M E A+   G+
Sbjct: 1112 DQLEKMKRQRHQEFTAGFNLITTKLKEMYQMITMGGDAEL----------ELVDSLDPFSE----------GILFSVRPPKKSWKNISNLSGGEKTLSSLALVFALHHFKPTPFYVMDEIDAALDFKNVSIVANYIKDRTKNAQFIIISLRNNMYELADCLIGI 1255          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000022017.1 (SMESG000022017.1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.427e-13
Identity = 43/156 (27.56%), Postives = 72/156 (46.15%), Query Frame = 1
Query: 3169 KYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKD-AQFITTTFRPEMLEAAERFYGV 3633
            +Y+  +  F  V  +   I+K L  +  A+  +    H++  LD+                  I+        + + M+ LSGG+K++ AL L+FA    +P+PF++ DEIDAALD      VA  I+  + D AQ I  + + E    A+   G+
Sbjct: 1078 RYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDE------------------IQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1215          

HSP 2 Score: 70.0922 bits (170), Expect = 1.024e-11
Identity = 159/730 (21.78%), Postives = 290/730 (39.73%), Query Frame = 1
Query:  103 IKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLSDEYSHLSPQERINLLHEGT--GPRVVSAYVEIIFDNSDNRIPFDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGT----RVYDERKEESKQIFKESEAKMDQINELLS-------SIDD-----RLRTL----------------ESETKEL-KEYQKCDRDRRSLEF--TIFDRELKDIKRKLDEIKDRREQSSVNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMXXXXXXXXXXXXXXVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQYELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMKSLNKAI----------KDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEAVSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSITGKSILNGLDSVR-----RVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFY-TSVEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESVYPETNDAIPMMSRLTFD------AKFQNVMLHNFGKTLVCRSIEIATTLAKNLN--FDCVTLDGDQVSRRGTLTGGYYD 2109
            +K + I  F+SY+ +   G F      I+G NGSGKSN   AI FVL +   +L  +   +L+H      P   +A V  I++   N+      +    RII N   +Y ++ K V   +    LE          ++V QG +  +A     +R ++  E++ +      Y+  KEE +++ +E+   +++   +++        ID+     +L+T                 E ET E+ KE+ K   +  S E      D ++K  ++K+   K  REQS +      +  KKC  DI K   ++  +  K   ++D+                         K +K+   +AR +   + Q  + ++Q    R+E++K +YEL +++       +S  + R  EL       NQ Q   +  + + E+   L+  +          KD  + + +  +EI S  KR E  +NE           R+ L+ + E +    R  +E +   +T+  +     +++  +  EL     NL    G++ +   +S R      +IE  +  F        G +G L+E+       Y  ++    G  +   V + ++     +Q +       E  F P++ L  R       +   P    L  D      A  +  +    G  LVC ++E A T+A N       V+L+G    R G ++GG  D
Sbjct:   10 LKVIEIDNFKSYKGKQTIGPF-SQFTAIIGPNGSGKSNLMDAISFVLGESTKNLRVKRLNDLIHGANFGQPVAKTASVTAIYEIDQNQ------QSRFSRIIHNNTSEYKINDKSVKIDEYAYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQMFEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKV--TKFNREQSGI-----EQEIKKCEQDISKKRPEHIKVHQKLKHLMDK------------------------QKESKKAYESARQQHLAN-QEELAQLQSQMDRIEQLKSEYELKQSQ-------ISVEKGRNLEL-----ETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNE----------SRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVSNL----GEARVEKHESSRAAKKQELIENLKRLFP-------GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPE-TFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSLEGTLFQRSGVISGGASD 666          
The following BLAST results are available for this feature:
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMC30.000e+050.65structural maintenance of chromosomes 3 [Source:HG... [more]
SMC27.567e-1930.29structural maintenance of chromosomes 2 [Source:HG... [more]
SMC27.567e-1930.29structural maintenance of chromosomes 2 [Source:HG... [more]
SMC27.567e-1930.29structural maintenance of chromosomes 2 [Source:HG... [more]
SMC41.055e-1525.43structural maintenance of chromosomes 4 [Source:HG... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc-30.000e+040.44Structural maintenance of chromosomes protein 3 [... [more]
smc-33.415e-8948.37Structural maintenance of chromosomes protein 3 [... [more]
smc-31.194e-7855.06Structural maintenance of chromosomes protein 3 [... [more]
mix-14.384e-2330.40Mitotic chromosome and X-chromosome-associated pro... [more]
smc-41.950e-1339.78Structural maintenance of chromosomes protein 4 [... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SMC30.000e+046.49gene:FBgn0015615 transcript:FBtr0074290[more]
SMC12.177e-2222.99gene:FBgn0040283 transcript:FBtr0084541[more]
SMC21.354e-1632.92gene:FBgn0027783 transcript:FBtr0087461[more]
glu2.624e-1331.41gene:FBgn0015391 transcript:FBtr0080935[more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc30.000e+050.61structural maintenance of chromosomes 3 [Source:ZF... [more]
smc30.000e+049.00structural maintenance of chromosomes 3 [Source:ZF... [more]
smc26.999e-1928.57structural maintenance of chromosomes 2 [Source:ZF... [more]
smc26.999e-1928.57structural maintenance of chromosomes 2 [Source:ZF... [more]
smc47.903e-1433.33structural maintenance of chromosomes 4 [Source:ZF... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cryba40.000e+049.39crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998... [more]
cryba40.000e+049.43crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998... [more]
cryba40.000e+048.16crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998... [more]
cryba40.000e+049.05crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998... [more]
cryba40.000e+048.50crystallin beta A4 [Source:Xenbase;Acc:XB-GENE-998... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smc30.000e+050.74structural maintenance of chromosomes 3 [Source:MG... [more]
Smc25.766e-3125.11structural maintenance of chromosomes 2 [Source:MG... [more]
Smc25.766e-3125.11structural maintenance of chromosomes 2 [Source:MG... [more]
Smc21.276e-2832.16structural maintenance of chromosomes 2 [Source:MG... [more]
Smc41.584e-1333.33structural maintenance of chromosomes 4 [Source:MG... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93309|SMC3_XENLA0.000e+051.74Structural maintenance of chromosomes protein 3 OS... [more]
sp|Q9CW03|SMC3_MOUSE0.000e+050.74Structural maintenance of chromosomes protein 3 OS... [more]
sp|Q5R4K5|SMC3_PONAB0.000e+050.65Structural maintenance of chromosomes protein 3 OS... [more]
sp|Q9UQE7|SMC3_HUMAN0.000e+050.65Structural maintenance of chromosomes protein 3 OS... [more]
sp|O97594|SMC3_BOVIN0.000e+050.45Structural maintenance of chromosomes protein 3 OS... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F4P20.000e+074.55Putative rootletin (Ciliary rootlet coiled-coil pr... [more]
A0A4Z2DHG40.000e+074.24Structural maintenance of chromosomes protein OS=S... [more]
A0A095C3F20.000e+073.63Structural maintenance of chromosomes protein OS=S... [more]
A0A0X3PK780.000e+073.09SMC hinge domain-containing protein (Fragment) OS=... [more]
A0A4Z2DHJ90.000e+074.12Structural maintenance of chromosomes protein OS=S... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc30.000e+050.74structural maintenance of chromosomes 3 [Source:NC... [more]
smc21.195e-1930.51structural maintenance of chromosomes 2 [Source:ZF... [more]
smc1a2.228e-1429.83structural maintenance of chromosomes 1A [Source:N... [more]
smc43.018e-1433.33structural maintenance of chromosomes 4 [Source:NC... [more]
smc1al4.897e-1429.83structural maintenance of chromosomes 1A, like [So... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc26.427e-2932.17structural maintenance of chromosomes 2 [Source:ZF... [more]
ENSPMAT00000008608.13.582e-1420.53pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 ... [more]
ENSPMAT00000000346.12.493e-1229.53pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 ... [more]
ENSPMAT00000002584.12.818e-1228.92pep scaffold:Pmarinus_7.0:GL477247:652:6382:-1 gen... [more]
SMC1A1.906e-1029.17structural maintenance of chromosomes 1A [Source:H... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
SMC30.000e+032.88Subunit of the multiprotein cohesin complex; requi... [more]
SMC42.217e-2221.04Subunit of the condensin complex; condensin reorga... [more]
SMC23.651e-2031.55Subunit of the condensin complex; condensin reorga... [more]
SMC17.030e-1733.11Subunit of the multiprotein cohesin complex; essen... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO341360.000e+044.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341351.860e-5279.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406461.538e-2121.24Structural maintenance of chromosomes protein [So... [more]
EDO495966.092e-1329.94Structural maintenance of chromosomes protein [So... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc30.000e+050.86structural maintenance of chromosomes 3 [Source:NC... [more]
smc30.000e+047.68structural maintenance of chromosomes 3 [Source:NC... [more]
smc24.638e-2932.90structural maintenance of chromosomes 2 [Source:NC... [more]
smc21.791e-2824.23structural maintenance of chromosomes 2 [Source:NC... [more]
smc44.810e-1434.69structural maintenance of chromosomes 4 [Source:NC... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017173.10.000e+0100.00SMESG000017173.1[more]
SMESG000017173.10.000e+0100.00SMESG000017173.1[more]
SMESG000017172.10.000e+0100.00SMESG000017172.1[more]
SMESG000036986.14.345e-1732.32SMESG000036986.1[more]
SMESG000022017.16.427e-1327.56SMESG000022017.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003593 ID=SMED30003593|Name=Structural maintenance of chromosomes protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3778bp
ATTCTAATTTGAAAAAAAATTTTTTGCTTTAATTTAATTTTATAATATTG
AAATATTTACGAAAGTTTAACAGGTTTCAAAAGGTGTTCCTGTACTATGT
ACATTAAAAAAGTAATTATTCAAGGATTTCGAAGTTATCGTGATCAAACT
TGCCCTGGAGAGTTTGATCCACACCATAACATTATTGTTGGTCGAAATGG
TTCAGGAAAATCCAACTTTTTTCAAGCTATTCAATTTGTATTATCCGATG
AATATAGTCATTTAAGTCCACAAGAACGAATTAATTTGCTTCACGAAGGA
ACCGGCCCAAGAGTAGTATCGGCGTATGTGGAAATAATATTTGATAATAG
TGACAATCGTATTCCATTTGATAAAACCGAAGTTTCACTGCGTCGAATTA
TCGGAAATAAAAAGGATCAATATTTTCTAGACAAGAAAATGGTTACAAAA
ACCGATGTGATGAATCTATTGGAAAGCGCCGGTTTCAGTCGAAGCAATCC
GTATTATATTGTCAAGCAAGGCAAAATCACTCAATTAGCCACCGCGCCAG
ACAATCAAAGATTGAAATTGTTGCGAGAAGTTGCCGGAACGAGAGTCTAT
GATGAGAGAAAGGAAGAAAGTAAACAAATATTCAAGGAAAGTGAAGCGAA
AATGGACCAAATCAATGAGTTATTGTCGAGTATCGATGACAGGTTGAGGA
CGCTGGAATCGGAAACGAAGGAATTGAAGGAGTATCAGAAATGCGATCGA
GATCGGCGGAGTTTGGAATTTACGATTTTCGATCGGGAACTGAAGGACAT
CAAGCGGAAATTGGATGAGATAAAGGACAGGCGGGAGCAGAGCTCGGTCA
ATACGCTCGACATGAGGAAGGCTGCCAAGAAATGCGCCGATGACATCGAG
AAACTTGAGCGTGATTATCGAGATCTACGTTTGAAAGAAGGTCAAATGAT
TGACGAAGTTGAACAAATACAATCGATGTTGAGTGAAAAGTTACAGCGAC
GAGAACAGTTGCAACTGTTGGTTAACGATTATAAAACCACCAAACGCGGT
GGAGCTAATGCTAGAGCTAGAGCGCAAAAAGACCTCCAAAGAGTTATGCT
AAAGATCCAGCAAGTGCAAAAGAGATTGGAAGAGATAAAACCACAATACG
AACTCGCTAGGGCAAAGGAAGATGAAATGGGAAACAGTCTCAGTGATGCT
GAGCATCGCAGGAAGGAATTGTTTGCTAAGCAAGGCCGAGTAAATCAGTT
CCAGAGTCGCACTCAGCGAGACGAATGGATTAAAGAACAAATGAAGAGTT
TAAACAAAGCTATAAAAGACAAAGAAAATACGATTAGGAAATTGTCAGAC
GAAATCGATAGCGACATAAAGCGGATTGAAGATTTAGTGAATGAACTCTC
TGGAGCTGAGGCAAACATGGAAGGCGTCAGGCAGGAATTAGAGGCCGTTT
CAGAGGAATTGCGGAAATTACGACGACAGAAAGACGAAGTCCAAGCAGAT
AGACAAACGGTTTATCGACAGGAAAGTAAAGTCCAACAGCAATTGAATAA
TCTACGAGATGAACTGAACCGAACGGAACATAATTTACGATCAATAACGG
GGAAAAGTATTTTAAATGGACTGGATTCAGTGCGACGAGTGATTGAGATA
TTCCGTGAGAAATTCGGTTCCGATTGCCATGTAGTGCAGGGGTATTATGG
GACATTGATTGAGTTGATAAATTGTCCCGATACGTTCTACACGAGTGTCG
AGGTGACAGCTGGAACCCGACTGTTCTATCATGTCGTTGAGAATGAGGAA
CTCGTCATCAAGATTCTGCAAGAAGTCAACAAGCACAATTTCCCAGGAGA
AATCAATTTCTTTCCCATCAATCGATTGCACGCGAGGGAATCGGTTTATC
CGGAAACAAATGATGCGATACCCATGATGTCGCGGTTGACGTTTGATGCT
AAGTTCCAAAATGTTATGTTGCACAATTTCGGTAAAACTCTCGTTTGTCG
TAGCATTGAAATCGCTACAACTCTCGCCAAAAATCTCAACTTTGATTGCG
TAACACTCGACGGAGACCAAGTCTCACGAAGAGGAACGCTTACCGGTGGG
TATTATGATCAACGGTTTTCGAGGTTAGAATTACAGAAACGTAAACAAAA
AATGGAAATGGAAATCCAAGAAACCGAAAACGTGCAACAGAATTACATTA
CGAGAAAAGAAGTGTTGGATTCTGGAATAAACGAGATAATCGATAAACTA
CAACGAAAAGAAACAGTTAGAGCAAAGCATGAGATGACATTTGATAAATT
GAAGAAAGACATATATCTATGGAAAGAGGAACAACATGCAAAAACGGAAG
CGAAACCACAAAAGGAATGGAAATTGACATCTTTGAGACATGATTTGGAA
CAGATGAAATACACTAGGGAATCTTATCAAGTGGAATTAGGAACGGACTT
ATTGACACAGTTATCTACCAGTGAACAGCGGGAGGTGGACAAACTGAACG
AAACCATCCAAGGGCTCACCATCAAAGCTAAAGAAGCTTACACAGAACGG
ATGTGTTTAGAAGCGGAAAAGACGGAAAACGAAACTCTATTAGATCATAA
CTTGATGCGTAAAAAGGACCAATTGGAAGCGGAGATGACAGAAGTGTCGG
AAACTGACATCACCGAGCGACTGCAAGAAGCGGAGGATGAATTACGCGCG
ATCGATGAAAGAATTGAAGCCGATCAGAAGCAGGTTAATAGTAGTGAGGA
AAAGCTGGCAGAAGTCCAGGAGGAAAAGCGACGATTGGAAACACAATTGG
AGAATTTGCGGTCCCAAGAAAAGGATTACGCTGACAGCATTCAAGATGAC
CAACAGAATCTGGAAAAGATGCAATCGAAACAAAGTCAGTTGTTGAAAAA
GAAAGAAGAAACGCTAAGAAAAATTCGAGAAATCGGTTCACTGCCAGCTG
ATGCTCTCGAGAAATTCAATGATAAAACGATGAAACAATTGTATAAACTG
TTGGATAAAGCAAACCGGGAAATCAAAAGATACAGTCATGTCAATAAAAA
GGCTCTTGATCAATTTGTCAGTTACAACGAAGAAAAAGAAAAGCTGTTGA
AACGAAAAGAGGAACTCGATAAAGGACATCAAGCAATTATCGACCTAATG
AAAGCACTTGATCACCAGAAATACGAAGCAATCGTGCTCACATTCAAACA
AGTGTCTCATTATTTTCAAGAAATTTTCAAGAAACTCGTGCCAGATGGAA
GAGCTGAACTGATTATTAGGAAAGGAAAACATGATGATACATTGCTCGAC
GATGAGGAGGATCCGTCGTCATCCATTCCCGAGGTGGAACGGTTTACTGG
TGTGGGAATTGAAGTGAGTTTCACTGGCGGTGACGCACAAATGAAGGACA
TGAATCAATTGAGTGGTGGACAGAAATCGTTAGTGGCACTCACTTTGATT
TTCGCGATCCAGAAATGTGATCCGGCTCCGTTCTATCTGTTTGATGAGAT
CGATGCAGCTCTTGATCCGCAGTATCGAAAGGCGGTTGCTGACATGATCA
AGGGACTCAGCAAGGATGCGCAATTCATAACGACCACTTTCCGACCGGAA
ATGCTGGAGGCAGCCGAGCGGTTTTATGGGGTCAAATTTCGGAATAAGGT
GAGCCATATCGATCAGGTCTCAAAGGAAGAGGCGCTGGACTTTGTGGAAG
ATGACCAGACGCACGGCTAGTCGATTTATCATTTATCTGTGTTCCTTGTG
CATTTATGGATGTTTTGTAAATGGCAAT
back to top

protein sequence of SMED30003593-orf-1

>SMED30003593-orf-1 ID=SMED30003593-orf-1|Name=SMED30003593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1208bp
MYIKKVIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS
DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIPFDKTEVSLRR
IIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATA
PDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQINELLSSIDDRL
RTLESETKELKEYQKCDRDRRSLEFTIFDRELKDIKRKLDEIKDRREQSS
VNTLDMRKAAKKCADDIEKLERDYRDLRLKEGQMIDEVEQIQSMLSEKLQ
RREQLQLLVNDYKTTKRGGANARARAQKDLQRVMLKIQQVQKRLEEIKPQ
YELARAKEDEMGNSLSDAEHRRKELFAKQGRVNQFQSRTQRDEWIKEQMK
SLNKAIKDKENTIRKLSDEIDSDIKRIEDLVNELSGAEANMEGVRQELEA
VSEELRKLRRQKDEVQADRQTVYRQESKVQQQLNNLRDELNRTEHNLRSI
TGKSILNGLDSVRRVIEIFREKFGSDCHVVQGYYGTLIELINCPDTFYTS
VEVTAGTRLFYHVVENEELVIKILQEVNKHNFPGEINFFPINRLHARESV
YPETNDAIPMMSRLTFDAKFQNVMLHNFGKTLVCRSIEIATTLAKNLNFD
CVTLDGDQVSRRGTLTGGYYDQRFSRLELQKRKQKMEMEIQETENVQQNY
ITRKEVLDSGINEIIDKLQRKETVRAKHEMTFDKLKKDIYLWKEEQHAKT
EAKPQKEWKLTSLRHDLEQMKYTRESYQVELGTDLLTQLSTSEQREVDKL
NETIQGLTIKAKEAYTERMCLEAEKTENETLLDHNLMRKKDQLEAEMTEV
SETDITERLQEAEDELRAIDERIEADQKQVNSSEEKLAEVQEEKRRLETQ
LENLRSQEKDYADSIQDDQQNLEKMQSKQSQLLKKKEETLRKIREIGSLP
ADALEKFNDKTMKQLYKLLDKANREIKRYSHVNKKALDQFVSYNEEKEKL
LKRKEELDKGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPD
GRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMK
DMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADM
IKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHIDQVSKEEALDFV
EDDQTHG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041741SMC3_ABC_euk
IPR036277SMC_hinge_sf
IPR010935SMC_hinge
IPR027417P-loop_NTPase
IPR024704SMC
IPR003395RecF/RecN/SMC_N
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0005515protein binding
GO:0003682chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005694chromosome
GO:0005634nucleus
GO:0008278cohesin complex
Vocabulary: biological process
TermDefinition
GO:0051276chromosome organization
GO:0006281DNA repair
GO:0007064mitotic sister chromatid cohesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 797..817
NoneNo IPR availableCOILSCoilCoilcoord: 399..503
NoneNo IPR availableCOILSCoilCoilcoord: 852..942
NoneNo IPR availableCOILSCoilCoilcoord: 323..343
NoneNo IPR availableCOILSCoilCoilcoord: 674..703
NoneNo IPR availableCOILSCoilCoilcoord: 962..1003
NoneNo IPR availableCOILSCoilCoilcoord: 232..252
NoneNo IPR availableCOILSCoilCoilcoord: 172..206
NoneNo IPR availableCOILSCoilCoilcoord: 260..287
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1021..1207
e-value: 1.8E-54
score: 185.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..240
e-value: 8.7E-44
score: 152.4
NoneNo IPR availableGENE3DG3DSA:3.30.70.1620coord: 592..671
e-value: 3.7E-25
score: 90.2
NoneNo IPR availableGENE3DG3DSA:1.20.1060.20coord: 529..683
e-value: 3.7E-25
score: 90.2
NoneNo IPR availablePANTHERPTHR43977FAMILY NOT NAMEDcoord: 1..1202
NoneNo IPR availablePANTHERPTHR43977:SF1STRUCTURAL MAINTENANCE OF CHROMOSOMES PROTEIN 3coord: 1..1202
IPR010935SMCs flexible hingeSMARTSM00968SMC_hinge_2coord: 531..644
e-value: 1.1E-16
score: 71.5
IPR010935SMCs flexible hingePFAMPF06470SMC_hingecoord: 531..643
e-value: 6.4E-21
score: 74.8
IPR024704Structural maintenance of chromosomes proteinPIRSFPIRSF005719SMCcoord: 1..1198
e-value: 1.2E-147
score: 490.9
IPR003395RecF/RecN/SMC, N-terminalPFAMPF02463SMC_Ncoord: 2..1186
e-value: 4.4E-55
score: 189.4
IPR041741Structural maintenance of chromosomes 3, ABC domain, eukaryoticCDDcd03272ABC_SMC3_eukcoord: 3..158
e-value: 1.05116E-87
score: 281.841
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..1179
IPR036277SMCs flexible hinge superfamilySUPERFAMILYSSF75553Smc hinge domaincoord: 480..690