Amyloid beta (A4) precursor protein b

Overview
NameAmyloid beta (A4) precursor protein b
Smed IDSMED30003584
Length (bp)1718
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Amyloid beta (A4) precursor protein b (SMED30003584) t-SNE clustered cells

Violin plots show distribution of expression levels for Amyloid beta (A4) precursor protein b (SMED30003584) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Amyloid beta (A4) precursor protein b (SMED30003584) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Amyloid beta (A4) precursor protein b (SMED30003584) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003584

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30003584h1SMcG0017534 dd_Smed_v4_5336_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30003584h1SMcG0017534 dd_Smed_v4_5336_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 72.0182 bits (175), Expect = 1.662e-12
Identity = 43/123 (34.96%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  203 ILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +   + V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   34 ILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 153          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 72.0182 bits (175), Expect = 1.724e-12
Identity = 43/123 (34.96%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  203 ILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +   + V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   69 ILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 72.0182 bits (175), Expect = 1.876e-12
Identity = 44/129 (34.11%), Postives = 61/129 (47.29%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +   + V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 71.633 bits (174), Expect = 1.883e-12
Identity = 44/129 (34.11%), Postives = 61/129 (47.29%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +   + V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   58 IDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 183          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 71.633 bits (174), Expect = 2.147e-12
Identity = 44/129 (34.11%), Postives = 61/129 (47.29%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +   + V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Celegans
Match: apl-1 (Amyloid-beta-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q10651])

HSP 1 Score: 79.337 bits (194), Expect = 2.560e-15
Identity = 51/173 (29.48%), Postives = 87/173 (50.29%), Query Frame = 2
Query:   92 HLQFIPSISYHAGSSIMYKTDKG-WILNEN---ITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWC-HGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQT-LENRPECLSFDTWKNISVTLCSESYSYV-VDMIQYS-----PCTDKVMIFSKVDIICCPADK 574
            H +FIP +++  G    Y T++G W  ++           DILK C+  YP+ NITN+++     +I++WC   G  C    ++ V P+ C++     E  +VP +CQ + + +R +C  +  WK+ +   C    S    DMI  S     PC   + +F+ V+ +CCP D+
Sbjct:   31 HEKFIPMVAFSCGYRNQYMTEEGSWKTDDERYATCFSGKLDILKYCRKAYPSMNITNIVEYSHEVSISDWCREEGSPC--KWTHSVRPYHCIDGEFHSEALQVPHDCQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCA--LDMFTGVEFVCCPNDQ 199          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Celegans
Match: apl-1 (Amyloid-beta-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q10651])

HSP 1 Score: 79.337 bits (194), Expect = 2.704e-15
Identity = 51/173 (29.48%), Postives = 87/173 (50.29%), Query Frame = 2
Query:   92 HLQFIPSISYHAGSSIMYKTDKG-WILNEN---ITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWC-HGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQT-LENRPECLSFDTWKNISVTLCSESYSYV-VDMIQYS-----PCTDKVMIFSKVDIICCPADK 574
            H +FIP +++  G    Y T++G W  ++           DILK C+  YP+ NITN+++     +I++WC   G  C    ++ V P+ C++     E  +VP +CQ + + +R +C  +  WK+ +   C    S    DMI  S     PC   + +F+ V+ +CCP D+
Sbjct:   31 HEKFIPMVAFSCGYRNQYMTEEGSWKTDDERYATCFSGKLDILKYCRKAYPSMNITNIVEYSHEVSISDWCREEGSPC--KWTHSVRPYHCIDGEFHSEALQVPHDCQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCA--LDMFTGVEFVCCPNDQ 199          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307293)

HSP 1 Score: 71.2478 bits (173), Expect = 1.497e-12
Identity = 36/132 (27.27%), Postives = 56/132 (42.42%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGG----RNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            ++   D+L  C+  YPN +ITN+++    + I  WC  G      C  +  + + PFRCL    + +   VP  C    + N   C  F  W       C E    +       PC   + +FS V+ +CCP
Sbjct:   71 LRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRW-IKPFRCLEGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQMRSFAMLLPCG--ISVFSGVEFVCCP 199          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307295)

HSP 1 Score: 71.2478 bits (173), Expect = 1.632e-12
Identity = 36/132 (27.27%), Postives = 56/132 (42.42%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGG----RNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            ++   D+L  C+  YPN +ITN+++    + I  WC  G      C  +  + + PFRCL    + +   VP  C    + N   C  F  W       C E    +       PC   + +FS V+ +CCP
Sbjct:   71 LRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRW-IKPFRCLEGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQMRSFAMLLPCG--ISVFSGVEFVCCP 199          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0070109)

HSP 1 Score: 66.6254 bits (161), Expect = 4.087e-11
Identity = 36/132 (27.27%), Postives = 56/132 (42.42%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGG----RNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            ++   D+L  C+  YPN +ITN+++    + I  WC  G      C  +  + + PFRCL    + +   VP  C    + N   C  F  W       C E    +       PC   + +FS V+ +CCP
Sbjct:   71 LRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRW-IKPFRCLG-PFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQMRSFAMLLPCG--ISVFSGVEFVCCP 198          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307294)

HSP 1 Score: 66.6254 bits (161), Expect = 4.115e-11
Identity = 36/132 (27.27%), Postives = 56/132 (42.42%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGG----RNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            ++   D+L  C+  YPN +ITN+++    + I  WC  G      C  +  + + PFRCL    + +   VP  C    + N   C  F  W       C E    +       PC   + +FS V+ +CCP
Sbjct:   71 LRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRW-IKPFRCLG-PFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQMRSFAMLLPCG--ISVFSGVEFVCCP 198          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307291)

HSP 1 Score: 66.6254 bits (161), Expect = 4.273e-11
Identity = 36/132 (27.27%), Postives = 56/132 (42.42%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGG----RNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            ++   D+L  C+  YPN +ITN+++    + I  WC  G      C  +  + + PFRCL    + +   VP  C    + N   C  F  W       C E    +       PC   + +FS V+ +CCP
Sbjct:   71 LRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRW-IKPFRCLG-PFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQMRSFAMLLPCG--ISVFSGVEFVCCP 198          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 70.4774 bits (171), Expect = 2.772e-12
Identity = 41/132 (31.06%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+ ++ V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   65 ISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLHDYGMLLPCG--IDRFRGVEFVCCPMEEQ 194          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 70.4774 bits (171), Expect = 3.374e-12
Identity = 41/132 (31.06%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+ ++ V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   54 ISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLHDYGMLLPCG--IDRFRGVEFVCCPMEEQ 183          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 70.4774 bits (171), Expect = 3.379e-12
Identity = 41/132 (31.06%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+ ++ V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   54 ISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLHDYGMLLPCG--IDRFRGVEFVCCPMEEQ 183          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 70.4774 bits (171), Expect = 3.430e-12
Identity = 41/132 (31.06%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+ ++ V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   53 ISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLHDYGMLLPCG--IDRFRGVEFVCCPMEEQ 182          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 70.4774 bits (171), Expect = 3.432e-12
Identity = 41/132 (31.06%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+ ++ V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   65 ISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLHDYGMLLPCG--IDRFRGVEFVCCPMEEQ 194          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 70.4774 bits (171), Expect = 4.163e-12
Identity = 43/129 (33.33%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   ++ ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE    + +     PC  DK   F  V+ +CCP
Sbjct:   62 IGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEKSMSLHEYGMLLPCGIDK---FRGVEFVCCP 187          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 70.4774 bits (171), Expect = 4.560e-12
Identity = 43/129 (33.33%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   ++ ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE    + +     PC  DK   F  V+ +CCP
Sbjct:   52 IGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEKSMSLHEYGMLLPCGIDK---FRGVEFVCCP 177          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 70.4774 bits (171), Expect = 4.799e-12
Identity = 43/129 (33.33%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   ++ ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE    + +     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEKSMSLHEYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 70.4774 bits (171), Expect = 4.925e-12
Identity = 43/129 (33.33%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   ++ ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE    + +     PC  DK   F  V+ +CCP
Sbjct:   28 IGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEKSMSLHEYGMLLPCGIDK---FRGVEFVCCP 153          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 70.0922 bits (170), Expect = 5.406e-12
Identity = 43/129 (33.33%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   ++ ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE    + +     PC  DK   F  V+ +CCP
Sbjct:   28 IGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEKSMSLHEYGMLLPCGIDK---FRGVEFVCCP 153          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 72.7886 bits (177), Expect = 6.499e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +  ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 72.7886 bits (177), Expect = 6.558e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +  ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 72.7886 bits (177), Expect = 7.266e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +  ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 72.4034 bits (176), Expect = 7.516e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +  ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 72.4034 bits (176), Expect = 8.319e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +  ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. UniProt/SwissProt
Match: sp|Q06BR2|A4_DORPE (Amyloid-beta precursor-like protein OS=Doryteuthis pealeii OX=1051067 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.257e-14
Identity = 47/163 (28.83%), Postives = 80/163 (49.08%), Query Frame = 2
Query:   98 QFIPSISYHAGSSIMYKTDKGWILNENIT---IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRN---CTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            +F P +++      M++   GW+ +++     +K   +IL+ C+ +YP+++ITNV++     TI NWC  G N   C ++ ++ V PFRCL    + E   VP +C     + P  C  FD     +++ CS             PC +    FS V+ +CCP
Sbjct:   29 KFEPMVAFICNKPAMHRVPSGWVPDDDPAKSCVKQPEEILEYCKKLYPDHDITNVLQASYKVTIPNWC--GFNVTHCHKHGNHTVRPFRCLVGPFQSEALLVPEHCIFDHYHDPRVCNEFDQCNETAMSKCSARGMTTQSFAMLWPCQEPGH-FSGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. UniProt/SwissProt
Match: sp|Q10651|A4_CAEEL (Amyloid-beta-like protein OS=Caenorhabditis elegans OX=6239 GN=apl-1 PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 3.439e-14
Identity = 51/173 (29.48%), Postives = 87/173 (50.29%), Query Frame = 2
Query:   92 HLQFIPSISYHAGSSIMYKTDKG-WILNEN---ITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWC-HGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQT-LENRPECLSFDTWKNISVTLCSESYSYV-VDMIQYS-----PCTDKVMIFSKVDIICCPADK 574
            H +FIP +++  G    Y T++G W  ++           DILK C+  YP+ NITN+++     +I++WC   G  C    ++ V P+ C++     E  +VP +CQ + + +R +C  +  WK+ +   C    S    DMI  S     PC   + +F+ V+ +CCP D+
Sbjct:   31 HEKFIPMVAFSCGYRNQYMTEEGSWKTDDERYATCFSGKLDILKYCRKAYPSMNITNIVEYSHEVSISDWCREEGSPC--KWTHSVRPYHCIDGEFHSEALQVPHDCQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCA--LDMFTGVEFVCCPNDQ 199          
BLAST of Amyloid beta (A4) precursor protein b vs. UniProt/SwissProt
Match: sp|P08592|A4_RAT (Amyloid-beta A4 protein OS=Rattus norvegicus OX=10116 GN=App PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 5.477e-12
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +  ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. UniProt/SwissProt
Match: sp|P12023|A4_MOUSE (Amyloid-beta A4 protein OS=Mus musculus OX=10090 GN=App PE=1 SV=3)

HSP 1 Score: 72.4034 bits (176), Expect = 5.819e-12
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +  ++ V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. UniProt/SwissProt
Match: sp|Q5IS80|A4_PANTR (Amyloid-beta A4 protein OS=Pan troglodytes OX=9598 GN=APP PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 9.873e-12
Identity = 44/129 (34.11%), Postives = 61/129 (47.29%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCT-DKVMIFSKVDIICCP 565
            I     IL+ CQ VYP   ITNV++  Q  TI NWC  GR   +   + V P+RCL      +   VP  C+   + R + C +   W  ++   CSE  + + D     PC  DK   F  V+ +CCP
Sbjct:   63 IDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDK---FRGVEFVCCP 188          
BLAST of Amyloid beta (A4) precursor protein b vs. TrEMBL
Match: A0A1S3JZF2 (amyloid-beta-like protein OS=Lingula unguis OX=7574 GN=LOC106177438 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.821e-16
Identity = 49/160 (30.63%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  107 PSISYHAGSSIMYKTDKGWILNENIT-IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGG-RNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            P +++    + MYKT KGW+ + +   +K    I++ C+ VYP  +ITNV++     TI  WC  G + C  + S+ V PF+CL      +   VP +C  Q +  + +CL+F+ W   + + C E            PC   + +F+ V+ +CCP D K
Sbjct:   42 PMVAFLCNKAAMYKTKKGWVADRDTDCLKDGSQIVEFCKKVYPKLDITNVVEASDEVTIDGWCKKGHKTCKHHSSHKVRPFKCLVGKFVSDALLVPEHCVFQHIRVKEKCLTFNDWTYEANSWCEEKGMQRQSSAMLLPCG--IDVFTGVEFVCCPKDNK 199          
BLAST of Amyloid beta (A4) precursor protein b vs. TrEMBL
Match: A0A067QLF7 (Beta-amyloid-like protein (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_00553 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.119e-13
Identity = 48/167 (28.74%), Postives = 81/167 (48.50%), Query Frame = 2
Query:  101 FIPSISYHAGSS------IMYKTDKG-WIL---NENITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCH-GGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            F P ++ + GS         Y T+ G W+    N+ + +K   +IL+ C+ VYP  +ITN+++    + ++NWC  G + C  + S  V P+RCL    + +   VP NC    + N+ +C  FD W   +   C +    +       PC   + +FS V+ +CCP
Sbjct:    8 FEPQVAMYCGSDKQQAYHSQYMTESGHWVTDLNNKALCLKEKVEILEYCKKVYPKRDITNIVEASHYQKVSNWCKVGHKKCKGSHSEWVKPYRCLEGPFQSDALLVPENCLFDHIHNQTKCWQFDRWNVTAAQACLDRDLSLRSFAMLLPCG--ISLFSGVEFVCCP 172          
BLAST of Amyloid beta (A4) precursor protein b vs. TrEMBL
Match: A0A2A6B2I0 (Apl-1 OS=Pristionchus pacificus OX=54126 GN=PRIPAC_49357 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.999e-13
Identity = 51/172 (29.65%), Postives = 87/172 (50.58%), Query Frame = 2
Query:   92 HLQFIPSISYHAGSSIMYKTDKG-WILNEN---ITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWC-HGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLEN-RPECLSFDTWKNISVTLCSESYS------YVVDMIQYSPCTDKVMIFSKVDIICCPAD 571
            H +F+P I++  G    Y  + G W+ ++N     ++ + D LK C+ VYPN N+TN+++     T+ +WC   G +CT   +  V P+RC+      E  +VP +C+   EN + +C  + +WKN +  LC+           V       PC   + +F+ V+ +CCP D
Sbjct:  296 HERFVPLIAFKCGFRNRYMAENGSWVSDDNKYATCLEGNLDKLKYCKKVYPNLNVTNIVEYSHEVTLADWCREEGDHCTSTKT--VRPYRCIVGEFHSEALQVPHDCRFNHENSQQKCNDYTSWKNEATRLCNSRKDEGGRAMIVRSFAMLEPCG--LDLFTGVEYVCCPTD 463          
BLAST of Amyloid beta (A4) precursor protein b vs. TrEMBL
Match: H3FMK4 (Apl-1 OS=Pristionchus pacificus OX=54126 GN=WBGene00113065 PE=4 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 2.999e-13
Identity = 51/172 (29.65%), Postives = 87/172 (50.58%), Query Frame = 2
Query:   92 HLQFIPSISYHAGSSIMYKTDKG-WILNEN---ITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWC-HGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLEN-RPECLSFDTWKNISVTLCSESYS------YVVDMIQYSPCTDKVMIFSKVDIICCPAD 571
            H +F+P I++  G    Y  + G W+ ++N     ++ + D LK C+ VYPN N+TN+++     T+ +WC   G +CT   +  V P+RC+      E  +VP +C+   EN + +C  + +WKN +  LC+           V       PC   + +F+ V+ +CCP D
Sbjct:  296 HERFVPLIAFKCGFRNRYMAENGSWVSDDNKYATCLEGNLDKLKYCKKVYPNLNVTNIVEYSHEVTLADWCREEGDHCTSTKT--VRPYRCIVGEFHSEALQVPHDCRFNHENSQQKCNDYTSWKNEATRLCNSRKDEGGRAMIVRSFAMLEPCG--LDLFTGVEYVCCPTD 463          
BLAST of Amyloid beta (A4) precursor protein b vs. TrEMBL
Match: A0A0K2UWH1 (Betaamyloidlike proteinlike [Bombus terrestris] OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.177e-13
Identity = 40/123 (32.52%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  200 DILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCP 565
            +IL+ C+ VYP+ +I N+++ +    I NWC  GR   +  +  V P+RCL    + +   VP +C    + N+  CL+FDTW   + + CS+    V       PC   + +FS V+ +CCP
Sbjct:   57 EILEYCKKVYPDMDINNIVESFHWVKINNWCKLGRKKCKGPARWVKPYRCLAGPFQSDALLVPEHCLFDHIHNQTRCLAFDTWNVTAASACSDRGMKVKSFAMLLPCG--IDVFSGVEFVCCP 177          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Cavefish
Match: ENSAMXT00000015571.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:31369849:31402293:1 gene:ENSAMXG00000015133.2 transcript:ENSAMXT00000015571.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 6.971e-13
Identity = 45/141 (31.91%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  161 WILNENIT---IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPAD 571
            W L+ + T   I     IL+ CQ VYP   ITNV++  Q  +I NWC  GR   R+  + V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCPA+
Sbjct:   46 WELDPSGTKGCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQNWCKKGRKQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICESHLHWHTVAKESCGDHTMNLHDYGMLLPCG--IDRFRGVEFVCCPAE 184          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 71.633 bits (174), Expect = 9.946e-13
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+  + V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   63 IGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDQTMNLHDFGMLLPCG--IDRFRGVEFVCCPVEEQ 192          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 70.8626 bits (172), Expect = 2.242e-12
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+  + V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   64 IGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDQTMNLHDFGMLLPCG--IDRFRGVEFVCCPVEEQ 193          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 70.4774 bits (171), Expect = 2.337e-12
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+  + V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   64 IGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDQTMNLHDFGMLLPCG--IDRFRGVEFVCCPVEEQ 193          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 70.4774 bits (171), Expect = 2.523e-12
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPE-CLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     IL+ CQ VYP+  ITNV++  Q  +I NWC  GR   R+  + V P+RCL      +   VP  C+   + R + C S   W  ++   C +    + D     PC   +  F  V+ +CCP +++
Sbjct:   64 IGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDQTMNLHDFGMLLPCG--IDRFRGVEFVCCPVEEQ 193          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Nematostella
Match: EDO45291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTM2])

HSP 1 Score: 69.707 bits (169), Expect = 1.287e-12
Identity = 45/142 (31.69%), Postives = 66/142 (46.48%), Query Frame = 2
Query:  161 WILNEN---ITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQ-QTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADK 574
            W  +EN   +    +  +LK CQ VYP  N++NV++     TI  WC   +N   N +  V P+RCL    E +   VP  C+ Q L    EC S D WK  +   C +  + +       PC     +F+ V+ +CCP  K
Sbjct:   52 WATDENGHSMCSTSTKQVLKYCQHVYPKLNVSNVVEANMNVTIKTWC-DPKNVNCNATKTVLPYRCLVGKFEADALLVPPGCRFQHLHPGSECKSHDFWKIKAEEKCKDQDANLRYYGVLLPCN--TGLFTGVEFVCCPVKK 190          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Medaka
Match: appb (amyloid-beta A4 protein [Source:NCBI gene;Acc:101172288])

HSP 1 Score: 72.4034 bits (176), Expect = 6.903e-13
Identity = 42/132 (31.82%), Postives = 62/132 (46.97%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENR-PECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     +L+ CQ VYP   ITNV++  Q  +ITNWC  GR   R+  + V P+RCL      +   VP  C+   + R  +C S   W  ++   C +    + D     PC   V  F  V+ +CCP + +
Sbjct:   64 IDTKEGLLRYCQEVYPELQITNVVEANQPVSITNWCKKGRKQCRSHPHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDRSMNLHDYGMLLPCN--VDRFRGVEFVCCPVEGE 193          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Medaka
Match: appb (amyloid-beta A4 protein [Source:NCBI gene;Acc:101172288])

HSP 1 Score: 72.0182 bits (175), Expect = 8.213e-13
Identity = 42/132 (31.82%), Postives = 62/132 (46.97%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENR-PECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKK 577
            I     +L+ CQ VYP   ITNV++  Q  +ITNWC  GR   R+  + V P+RCL      +   VP  C+   + R  +C S   W  ++   C +    + D     PC   V  F  V+ +CCP + +
Sbjct:   64 IDTKEGLLRYCQEVYPELQITNVVEANQPVSITNWCKKGRKQCRSHPHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDRSMNLHDYGMLLPCN--VDRFRGVEFVCCPVEGE 193          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 68.9366 bits (167), Expect = 8.098e-12
Identity = 40/130 (30.77%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENR-PECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPAD 571
            I     IL+ CQ VYP   ITNV++  Q  +I +WC  GR   R   + V P+RCL      +   VP  C+   + R  +C S   W  ++   C +    + D     PC   +  F  V+ +CCP +
Sbjct:   38 IGTKEGILQYCQEVYPELQITNVVEANQPVSIQSWCKKGRKQCRGHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDRTMTLHDYGMLLPCG--IDRFKGVEFVCCPTE 165          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 68.1662 bits (165), Expect = 1.526e-11
Identity = 40/130 (30.77%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENR-PECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPAD 571
            I     IL+ CQ VYP   ITNV++  Q  +I +WC  GR   R   + V P+RCL      +   VP  C+   + R  +C S   W  ++   C +    + D     PC   +  F  V+ +CCP +
Sbjct:   64 IGTKEGILQYCQEVYPELQITNVVEANQPVSIQSWCKKGRKQCRGHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDRTMTLHDYGMLLPCG--IDRFKGVEFVCCPTE 191          
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 68.1662 bits (165), Expect = 1.570e-11
Identity = 40/130 (30.77%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  185 IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENR-PECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPAD 571
            I     IL+ CQ VYP   ITNV++  Q  +I +WC  GR   R   + V P+RCL      +   VP  C+   + R  +C S   W  ++   C +    + D     PC   +  F  V+ +CCP +
Sbjct:   64 IGTKEGILQYCQEVYPELQITNVVEANQPVSIQSWCKKGRKQCRGHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDRTMTLHDYGMLLPCG--IDRFKGVEFVCCPTE 191          
BLAST of Amyloid beta (A4) precursor protein b vs. Planmine SMEST
Match: SMESG000057580.1 (SMESG000057580.1)

HSP 1 Score: 859.751 bits (2220), Expect = 0.000e+0
Identity = 457/463 (98.70%), Postives = 461/463 (99.57%), Query Frame = 2
Query:  140 MYKTDKGWILNENITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHERETFKVPINCQQTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTDKVMIFSKVDIICCPADKKYYNSLLNTYLKGSHNERWIFSQXXXXXXXXXXXXXXXXGRDICAKQNLISMRHDKSSLKEDLENLKLEFQSNFSKNKKWFFEENLKIERTHIQRIFKKVNMSCKPPMTQHQLSICVKQINSTLVQLQNHYKRTSNIHFQDFKQYLIREFEILFQNYTNIFKTANLMTKLQSVRDYLTSAPVNLSYEDSSSKEYKRHILKCNSPISFDHPTSNSHATPIMSXXXXXXXXXXXXXXXXXXXXXXKFCGQPFHRSTPNYVMSVVFDANQTQGPMPQSDQNLSENSNKQNVKLTLYENPIFNAKSATKPIEKQSLIENMES 1528
            MYKTDKGWILNENITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHE+ETFKVPINCQQTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCT+KVM+FSKVDIICCPADKKYYNSLLNTYLKGSHNERWIFSQLRHALLLLYRVKLRNLGRDICAKQNLISMRHDKS LKEDLENLKLEFQSNFSKNKKWFFEENLKIERTHIQRIFKKVNMSCKPPMTQHQLSICVKQINSTLVQLQNHYKRTSNIHFQDFKQYLIREFEILFQNYTNIFKTANLMTKLQSVRDYLTSAPVNLSYEDSSSKEYKR ILKCNSPISFDHPTSNSHATPIMSIVVTTVILLILIILTFIGTIVIKFCGQPFHRSTPNYVMSVVFDANQTQGPMPQSDQNLSENSNKQNVKLTLYENPIF+AKSATKPIEKQSLIENMES
Sbjct:    1 MYKTDKGWILNENITIKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDVHPFRCLNSTHEKETFKVPINCQQTLENRPECLSFDTWKNISVTLCSESYSYVVDMIQYSPCTEKVMMFSKVDIICCPADKKYYNSLLNTYLKGSHNERWIFSQLRHALLLLYRVKLRNLGRDICAKQNLISMRHDKSYLKEDLENLKLEFQSNFSKNKKWFFEENLKIERTHIQRIFKKVNMSCKPPMTQHQLSICVKQINSTLVQLQNHYKRTSNIHFQDFKQYLIREFEILFQNYTNIFKTANLMTKLQSVRDYLTSAPVNLSYEDSSSKEYKRQILKCNSPISFDHPTSNSHATPIMSIVVTTVILLILIILTFIGTIVIKFCGQPFHRSTPNYVMSVVFDANQTQGPMPQSDQNLSENSNKQNVKLTLYENPIFHAKSATKPIEKQSLIENMES 463          
The following BLAST results are available for this feature:
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APP1.662e-1234.96amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP1.724e-1234.96amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP1.876e-1234.11amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP1.883e-1234.11amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP2.147e-1234.11amyloid beta precursor protein [Source:HGNC Symbol... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
apl-12.560e-1529.48Amyloid-beta-like protein [Source:UniProtKB/Swiss... [more]
apl-12.704e-1529.48Amyloid-beta-like protein [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Appl1.497e-1227.27gene:FBgn0000108 transcript:FBtr0307293[more]
Appl1.632e-1227.27gene:FBgn0000108 transcript:FBtr0307295[more]
Appl4.087e-1127.27gene:FBgn0000108 transcript:FBtr0070109[more]
Appl4.115e-1127.27gene:FBgn0000108 transcript:FBtr0307294[more]
Appl4.273e-1127.27gene:FBgn0000108 transcript:FBtr0307291[more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
appb2.772e-1231.06amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb3.374e-1231.06amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb3.379e-1231.06amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb3.430e-1231.06amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb3.432e-1231.06amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf2e24.163e-1233.33general transcription factor IIE subunit 2 [Source... [more]
gtf2e24.560e-1233.33general transcription factor IIE subunit 2 [Source... [more]
gtf2e24.799e-1233.33general transcription factor IIE subunit 2 [Source... [more]
gtf2e24.925e-1233.33general transcription factor IIE subunit 2 [Source... [more]
gtf2e25.406e-1233.33general transcription factor IIE subunit 2 [Source... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
App6.499e-1334.11amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App6.558e-1334.11amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App7.266e-1334.11amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App7.516e-1334.11amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App8.319e-1334.11amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06BR2|A4_DORPE1.257e-1428.83Amyloid-beta precursor-like protein OS=Doryteuthis... [more]
sp|Q10651|A4_CAEEL3.439e-1429.48Amyloid-beta-like protein OS=Caenorhabditis elegan... [more]
sp|P08592|A4_RAT5.477e-1234.11Amyloid-beta A4 protein OS=Rattus norvegicus OX=10... [more]
sp|P12023|A4_MOUSE5.819e-1234.11Amyloid-beta A4 protein OS=Mus musculus OX=10090 G... [more]
sp|Q5IS80|A4_PANTR9.873e-1234.11Amyloid-beta A4 protein OS=Pan troglodytes OX=9598... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JZF24.821e-1630.63amyloid-beta-like protein OS=Lingula unguis OX=757... [more]
A0A067QLF72.119e-1328.74Beta-amyloid-like protein (Fragment) OS=Zootermops... [more]
A0A2A6B2I02.999e-1329.65Apl-1 OS=Pristionchus pacificus OX=54126 GN=PRIPAC... [more]
H3FMK42.999e-1329.65Apl-1 OS=Pristionchus pacificus OX=54126 GN=WBGene... [more]
A0A0K2UWH13.177e-1332.52Betaamyloidlike proteinlike [Bombus terrestris] OS... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000015571.26.971e-1331.91pep primary_assembly:Astyanax_mexicanus-2.0:12:313... [more]
appb9.946e-1331.06amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb2.242e-1231.06amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb2.337e-1231.06amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb2.523e-1231.06amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO452911.287e-1231.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
appb6.903e-1331.82amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
appb8.213e-1331.82amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
APP8.098e-1230.77amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
APP1.526e-1130.77amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
APP1.570e-1130.77amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Amyloid beta (A4) precursor protein b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000057580.10.000e+098.70SMESG000057580.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003584 ID=SMED30003584|Name=Amyloid beta (A4) precursor protein b|organism=Schmidtea mediterranea sexual|type=transcript|length=1718bp
ATTTTTTAGCATTTAATTTTAAATTAAATTTTAAATGAATAGTAAATCAA
TTATAATTTTATTAATTTCATTATTCTCTCCGAATTTCGTCCATCTTCAA
TTCATACCATCAATTTCATATCACGCAGGTTCTAGTATTATGTACAAAAC
CGACAAAGGTTGGATACTGAATGAAAATATTACCATTAAACATTCACATG
ATATTCTAAAAGTCTGCCAAACGGTCTATCCAAATTATAACATAACTAAT
GTCATGAAGATATATCAAATAGAAACTATTACCAATTGGTGTCACGGAGG
TCGTAATTGTACAAGAAATATGTCTTATGATGTTCATCCATTCCGATGTT
TAAATTCCACACATGAAAGAGAAACATTTAAAGTTCCCATAAATTGTCAG
CAGACATTGGAAAATCGTCCTGAATGTTTGTCATTTGATACTTGGAAAAA
CATTTCCGTAACACTTTGTTCTGAATCTTATTCTTATGTAGTGGATATGA
TACAATATTCGCCTTGCACTGACAAAGTCATGATATTTTCTAAAGTAGAT
ATCATTTGTTGCCCTGCAGACAAGAAATATTACAACAGCCTGCTGAATAC
ATATCTGAAAGGTAGTCATAATGAACGGTGGATATTCTCCCAGTTGAGAC
ATGCCCTATTGTTATTGTATAGAGTCAAATTACGAAACCTAGGACGAGAT
ATTTGCGCCAAACAAAATCTCATTTCTATGAGACATGATAAATCATCGCT
CAAAGAAGATTTGGAAAATCTAAAATTGGAATTCCAAAGCAACTTTTCTA
AAAACAAGAAATGGTTTTTTGAGGAAAATTTAAAAATCGAAAGAACTCAT
ATTCAACGAATCTTCAAAAAAGTAAATATGAGCTGTAAACCTCCAATGAC
TCAACATCAACTATCCATCTGTGTGAAACAAATCAATTCTACACTCGTCC
AACTGCAGAATCATTACAAGCGCACCTCAAATATTCATTTCCAAGACTTT
AAACAATACTTAATCCGGGAGTTTGAAATTTTATTTCAGAATTATACAAA
TATTTTCAAAACGGCAAATTTAATGACAAAGTTACAAAGTGTAAGAGATT
ATCTAACTTCAGCGCCTGTAAACCTTTCGTACGAAGATTCCTCAAGCAAA
GAATATAAGCGGCACATATTGAAATGCAATAGTCCTATTTCATTTGATCA
TCCTACGTCTAATTCACATGCTACTCCAATTATGTCAATTGTCGTGACAA
CCGTGATCCTGCTGATCCTTATAATATTGACTTTTATTGGAACTATCGTG
ATCAAATTTTGCGGTCAACCATTTCATCGTTCGACTCCGAATTACGTTAT
GTCGGTTGTGTTCGATGCCAATCAAACCCAGGGACCAATGCCACAATCGG
ACCAGAATCTTTCGGAAAATTCCAACAAACAGAACGTAAAACTTACTCTC
TACGAAAATCCTATTTTCAACGCAAAATCTGCAACCAAACCTATCGAAAA
ACAATCTCTCATAGAAAATATGGAAAGTTAATATCAAGAATTTTAGTTTA
TTTGTTTTAAAACATTTACCCATGTTCGCGTTGCAGATATTATCAGCTTG
GGTTTTATATTTAAGTCCTGTGCAATTCATTGGACTGGACTAATGGCATT
GTACATTTACATCTGTCGTGAACTTATTATCCTCTGGACCTTTTATTTTG
ATATTGCTTTTCTACTTG
back to top

protein sequence of SMED30003584-orf-1

>SMED30003584-orf-1 ID=SMED30003584-orf-1|Name=SMED30003584-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MNSKSIIILLISLFSPNFVHLQFIPSISYHAGSSIMYKTDKGWILNENIT
IKHSHDILKVCQTVYPNYNITNVMKIYQIETITNWCHGGRNCTRNMSYDV
HPFRCLNSTHERETFKVPINCQQTLENRPECLSFDTWKNISVTLCSESYS
YVVDMIQYSPCTDKVMIFSKVDIICCPADKKYYNSLLNTYLKGSHNERWI
FSQLRHALLLLYRVKLRNLGRDICAKQNLISMRHDKSSLKEDLENLKLEF
QSNFSKNKKWFFEENLKIERTHIQRIFKKVNMSCKPPMTQHQLSICVKQI
NSTLVQLQNHYKRTSNIHFQDFKQYLIREFEILFQNYTNIFKTANLMTKL
QSVRDYLTSAPVNLSYEDSSSKEYKRHILKCNSPISFDHPTSNSHATPIM
SIVVTTVILLILIILTFIGTIVIKFCGQPFHRSTPNYVMSVVFDANQTQG
PMPQSDQNLSENSNKQNVKLTLYENPIFNAKSATKPIEKQSLIENMES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007399nervous system development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR008154Amyloid_glyco_extra
IPR015849Amyloid_glyco_heparin-bd
Vocabulary: molecular function
TermDefinition
GO:0008201heparin binding
GO:0046914transition metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane