Transcription initiation factor TFIID subunit 6

Overview
NameTranscription initiation factor TFIID subunit 6
Smed IDSMED30003583
Length (bp)1641
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription initiation factor TFIID subunit 6 (SMED30003583) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 6 (SMED30003583) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription initiation factor TFIID subunit 6 (SMED30003583) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 6 (SMED30003583) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003583

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003583h1SMcG0007526 SmedASXL_014117SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003583h1SMcG0007526 SmedASXL_014117SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30003583h1SMcG0007525 Contig52098uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003583h1SMcG0007525 Contig52098newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003583h1SMcG0007526 Contig52098uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003583h1SMcG0007526 Contig52098newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Human
Match: TAF6 (TATA-box binding protein associated factor 6 [Source:HGNC Symbol;Acc:HGNC:11540])

HSP 1 Score: 187.193 bits (474), Expect = 5.323e-51
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Human
Match: TAF6 (TATA-box binding protein associated factor 6 [Source:HGNC Symbol;Acc:HGNC:11540])

HSP 1 Score: 187.193 bits (474), Expect = 5.323e-51
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Human
Match: TAF6 (TATA-box binding protein associated factor 6 [Source:HGNC Symbol;Acc:HGNC:11540])

HSP 1 Score: 187.193 bits (474), Expect = 5.323e-51
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Human
Match: TAF6 (TATA-box binding protein associated factor 6 [Source:HGNC Symbol;Acc:HGNC:11540])

HSP 1 Score: 187.193 bits (474), Expect = 8.004e-51
Identity = 118/440 (26.82%), Postives = 215/440 (48.86%), Query Frame = 1
Query:   31 EVKQEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            E K++  ++     +    V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:   31 EEKRDSRMAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 433          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Human
Match: TAF6 (TATA-box binding protein associated factor 6 [Source:HGNC Symbol;Acc:HGNC:11540])

HSP 1 Score: 186.808 bits (473), Expect = 1.491e-50
Identity = 118/440 (26.82%), Postives = 215/440 (48.86%), Query Frame = 1
Query:   31 EVKQEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            E K++  ++     +    V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:   51 EEKRDSRMAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 453          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Celegans
Match: taf-6.1 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:A0A0S4XR63])

HSP 1 Score: 104.375 bits (259), Expect = 8.082e-25
Identity = 50/126 (39.68%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  736 EHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQ 1113
            E Q++ K +   C+G D+  R+ AL T++ D  L   LPHL   I + I  NI  + L+++IY  R++RSL  N   ++   LH +LPALLS  +  N+CL P TDNH+ALR F+ K +  +   Q
Sbjct:   28 EQQIFMKDIITVCMGQDDKKRHEALYTLETDAGLQVFLPHLTERICKSISANISQRCLSLIIYAGRVLRSLSHNKACDMTVTLHHVLPALLSCCVGRNMCLRPETDNHWALRDFSAKTLVGLVRDQ 153          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Celegans
Match: taf-6.1 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:A0A0S4XR63])

HSP 1 Score: 104.375 bits (259), Expect = 8.082e-25
Identity = 50/126 (39.68%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  736 EHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQ 1113
            E Q++ K +   C+G D+  R+ AL T++ D  L   LPHL   I + I  NI  + L+++IY  R++RSL  N   ++   LH +LPALLS  +  N+CL P TDNH+ALR F+ K +  +   Q
Sbjct:   28 EQQIFMKDIITVCMGQDDKKRHEALYTLETDAGLQVFLPHLTERICKSISANISQRCLSLIIYAGRVLRSLSHNKACDMTVTLHHVLPALLSCCVGRNMCLRPETDNHWALRDFSAKTLVGLVRDQ 153          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Celegans
Match: taf-6.1 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:A0A0S4XR63])

HSP 1 Score: 103.99 bits (258), Expect = 7.036e-24
Identity = 50/126 (39.68%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  736 EHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQ 1113
            E Q++ K +   C+G D+  R+ AL T++ D  L   LPHL   I + I  NI  + L+++IY  R++RSL  N   ++   LH +LPALLS  +  N+CL P TDNH+ALR F+ K +  +   Q
Sbjct:  155 EQQIFMKDIITVCMGQDDKKRHEALYTLETDAGLQVFLPHLTERICKSISANISQRCLSLIIYAGRVLRSLSHNKACDMTVTLHHVLPALLSCCVGRNMCLRPETDNHWALRDFSAKTLVGLVRDQ 280          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Celegans
Match: taf-6.1 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:A0A0S4XR63])

HSP 1 Score: 105.145 bits (261), Expect = 7.555e-24
Identity = 50/126 (39.68%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  736 EHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQ 1113
            E Q++ K +   C+G D+  R+ AL T++ D  L   LPHL   I + I  NI  + L+++IY  R++RSL  N   ++   LH +LPALLS  +  N+CL P TDNH+ALR F+ K +  +   Q
Sbjct:  229 EQQIFMKDIITVCMGQDDKKRHEALYTLETDAGLQVFLPHLTERICKSISANISQRCLSLIIYAGRVLRSLSHNKACDMTVTLHHVLPALLSCCVGRNMCLRPETDNHWALRDFSAKTLVGLVRDQ 354          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Celegans
Match: taf-6.2 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:Q965Y0])

HSP 1 Score: 70.4774 bits (171), Expect = 1.803e-12
Identity = 51/201 (25.37%), Postives = 88/201 (43.78%), Query Frame = 1
Query:  451 LTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITD 1053
            + +HWL +  +QP  PEN   S +   K+  +++ +   +    HG G                          G   + MP   +         EHQV +  +T+         R   L TI+ D  +  L    +  I+EG RL+I  +N+  L  L+++  SL+ NP++ L+ YL+ ++P+L+S V+  N+   PI D
Sbjct:  209 IKDHWLVVDGIQPCLPENVIPSEV---KRRFQEQQHETQRA---HGFG------------------------VPGIKREPMPEKRMST--QTFSMEHQVLYSEITKILTSGSSLQRQKVLETIETDTGIQFLAGRFVILIAEGTRLHIGTRNIRGLANLLKLTWSLMKNPNIRLEKYLYVLVPSLISCVVSKNMV--PILD 375          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Fly
Match: Taf6 (gene:FBgn0010417 transcript:FBtr0333272)

HSP 1 Score: 197.593 bits (501), Expect = 1.520e-55
Identity = 127/420 (30.24%), Postives = 216/420 (51.43%), Query Frame = 1
Query:   82 GNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQ 1341
            G+ ISA + ++I + I + +L+ +  K   + ++   KR+V +        KR      D + +LK R +   +  +    +P +F    S     L + ED E+DL E+ +    KI  + +L  HW  +  VQP  PENP      +Q   L D +     + M+ G  KD   +    T K + +K N+  I            V  +  H +  E Q+Y+K +TEACVG+DE  R  AL ++ +D  L  +LP +  FI+EG+++N++  NLA+LIYL+R+VR+L+DNP + L+ YLH ++P++++ ++   +C+ P  DNH+ALR FA +++  IC+  +T  N L  R+  I    ++     N +T+L S              L G++  LSEL  E I+  ++P++  I +
Sbjct:   18 GSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRDIDMSLKVRNVEPQYGFVAKDFIPFRFA---SGGGRELHFTEDKEIDLGEITSTNSVKIPLDLTLRSHWFVVEGVQPTVPENPPPLSKDSQ---LLDSV--NPVIKMDQGLNKDAAGKPT--TGKIHKLK-NVETIH-----------VKQLATHELSVEQQLYYKEITEACVGSDEPRRGEALQSLGSDPGLHEMLPRMCTFIAEGVKVNVVQNNLALLIYLMRMVRALLDNPSLFLEKYLHELIPSVMTCIVSKQLCMRPELDNHWALRDFASRLMAQICKNFNTLTNNLQTRVTRIFSKALQ-----NDKTHLSS--------------LYGSIAGLSELGGEVIKVFIIPRLKFISE 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Fly
Match: Taf6 (gene:FBgn0010417 transcript:FBtr0074941)

HSP 1 Score: 197.593 bits (501), Expect = 1.530e-55
Identity = 127/420 (30.24%), Postives = 216/420 (51.43%), Query Frame = 1
Query:   82 GNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQ 1341
            G+ ISA + ++I + I + +L+ +  K   + ++   KR+V +        KR      D + +LK R +   +  +    +P +F    S     L + ED E+DL E+ +    KI  + +L  HW  +  VQP  PENP      +Q   L D +     + M+ G  KD   +    T K + +K N+  I            V  +  H +  E Q+Y+K +TEACVG+DE  R  AL ++ +D  L  +LP +  FI+EG+++N++  NLA+LIYL+R+VR+L+DNP + L+ YLH ++P++++ ++   +C+ P  DNH+ALR FA +++  IC+  +T  N L  R+  I    ++     N +T+L S              L G++  LSEL  E I+  ++P++  I +
Sbjct:   18 GSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRDIDMSLKVRNVEPQYGFVAKDFIPFRFA---SGGGRELHFTEDKEIDLGEITSTNSVKIPLDLTLRSHWFVVEGVQPTVPENPPPLSKDSQ---LLDSV--NPVIKMDQGLNKDAAGKPT--TGKIHKLK-NVETIH-----------VKQLATHELSVEQQLYYKEITEACVGSDEPRRGEALQSLGSDPGLHEMLPRMCTFIAEGVKVNVVQNNLALLIYLMRMVRALLDNPSLFLEKYLHELIPSVMTCIVSKQLCMRPELDNHWALRDFASRLMAQICKNFNTLTNNLQTRVTRIFSKALQ-----NDKTHLSS--------------LYGSIAGLSELGGEVIKVFIIPRLKFISE 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Fly
Match: mia (gene:FBgn0014342 transcript:FBtr0346136)

HSP 1 Score: 113.62 bits (283), Expect = 2.378e-26
Identity = 68/207 (32.85%), Postives = 119/207 (57.49%), Query Frame = 1
Query:  727 VGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFL 1347
            +  E Q +F+ +TEACVG+ E+ R  AL  I  D +L+ LLP L  FI++ + +N+  QNL +L+YL+R+VR+L+ N   +L  YLH +LPA+LS +L   +C +P +++H+ALR+++G ++  I  +   A N ++ R+  +                     NK A     L T+ GAV+ L ++   A+R C++P++  + + +
Sbjct:  182 LSMEQQNFFELVTEACVGDLESRRVLALKAISTDPSLEELLPRLTKFIADAVAINVAQQNLPLLLYLMRMVRALLGNQRFSLLQYLHLLLPAVLSCLLAKQVCASPNSEDHWALREYSGNIMAHIVRQFDAADNGILPRVIGVY--------------------NK-ALLKKPLTTVFGAVIGLGKMGNHAVRACILPQLKYLSEHI 367          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Fly
Match: mia (gene:FBgn0014342 transcript:FBtr0089313)

HSP 1 Score: 113.62 bits (283), Expect = 2.378e-26
Identity = 68/207 (32.85%), Postives = 119/207 (57.49%), Query Frame = 1
Query:  727 VGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFL 1347
            +  E Q +F+ +TEACVG+ E+ R  AL  I  D +L+ LLP L  FI++ + +N+  QNL +L+YL+R+VR+L+ N   +L  YLH +LPA+LS +L   +C +P +++H+ALR+++G ++  I  +   A N ++ R+  +                     NK A     L T+ GAV+ L ++   A+R C++P++  + + +
Sbjct:  182 LSMEQQNFFELVTEACVGDLESRRVLALKAISTDPSLEELLPRLTKFIADAVAINVAQQNLPLLLYLMRMVRALLGNQRFSLLQYLHLLLPAVLSCLLAKQVCASPNSEDHWALREYSGNIMAHIVRQFDAADNGILPRVIGVY--------------------NK-ALLKKPLTTVFGAVIGLGKMGNHAVRACILPQLKYLSEHI 367          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Fly
Match: mia (gene:FBgn0014342 transcript:FBtr0300009)

HSP 1 Score: 113.62 bits (283), Expect = 2.378e-26
Identity = 68/207 (32.85%), Postives = 119/207 (57.49%), Query Frame = 1
Query:  727 VGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFL 1347
            +  E Q +F+ +TEACVG+ E+ R  AL  I  D +L+ LLP L  FI++ + +N+  QNL +L+YL+R+VR+L+ N   +L  YLH +LPA+LS +L   +C +P +++H+ALR+++G ++  I  +   A N ++ R+  +                     NK A     L T+ GAV+ L ++   A+R C++P++  + + +
Sbjct:  182 LSMEQQNFFELVTEACVGDLESRRVLALKAISTDPSLEELLPRLTKFIADAVAINVAQQNLPLLLYLMRMVRALLGNQRFSLLQYLHLLLPAVLSCLLAKQVCASPNSEDHWALREYSGNIMAHIVRQFDAADNGILPRVIGVY--------------------NK-ALLKKPLTTVFGAVIGLGKMGNHAVRACILPQLKYLSEHI 367          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Zebrafish
Match: taf6 (TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-040912-23])

HSP 1 Score: 183.726 bits (465), Expect = 3.925e-50
Identity = 115/407 (28.26%), Postives = 204/407 (50.12%), Query Frame = 1
Query:  115 IGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP---HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            + + + I +L  +      + ++   K +  + +     GKRC     D + ALK + +   +     + +P +F    S     L + E+ E+DL ++I     ++  + SL  HWLSI  VQPA PENP S+    QK    + + +     +  G   +G +Q   ++     +KG           ++M      ++P   H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ YLH ++PA+++ ++   +CL P  DNH+ALR FA +++   C+   T  N + +R+               ++T   +  ++   +T R   + G    L+EL  + I+  ++P++
Sbjct:   22 MAESVGIGSLQEDSCLTLSEEVSYRIKEIAQDALKFMHHGKRCKLTTGDIDHALKLKNVEPLYGFQSEEFIPFRFA---SGGGRELHFYEEKEVDLSDIINTPLPRVPLDVSLKAHWLSIDGVQPAIPENPPSASKEQQKAESTEPLKA-----VKPGQEDEGFIQAKGQSAVSAEVKGK----------EKM-----RMKPRSTHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYLHELIPAVVTCIVSKQLCLRPDVDNHWALRDFAARLMAQSCKTFSTTTNNIQSRI---------------TKTFTKALLDEKTQWTTRYGCIAG----LAELGHDVIKTLIIPRL 386          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Zebrafish
Match: taf6 (TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-040912-23])

HSP 1 Score: 182.185 bits (461), Expect = 5.293e-50
Identity = 112/368 (30.43%), Postives = 190/368 (51.63%), Query Frame = 1
Query:  232 GKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP---HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            GKRC     D + ALK + +   +     + +P +F    S     L + E+ E+DL ++I     ++  + SL  HWLSI  VQPA PENP S+    QK    + + +     +  G   +G +Q   ++     +KG           ++M      ++P   H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ YLH ++PA+++ ++   +CL P  DNH+ALR FA +++   C+   T  N + +R+               ++T   +  ++   +T R   + G    L+EL  + I+  ++P++
Sbjct:    9 GKRCKLTTGDIDHALKLKNVEPLYGFQSEEFIPFRFA---SGGGRELHFYEEKEVDLSDIINTPLPRVPLDVSLKAHWLSIDGVQPAIPENPPSASKEQQKAESTEPLKA-----VKPGQEDEGFIQAKGQSAVSAEVKGK----------EKM-----RMKPRSTHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYLHELIPAVVTCIVSKQLCLRPDVDNHWALRDFAARLMAQSCKTFSTTTNNIQSRI---------------TKTFTKALLDEKTQWTTRYGCIAG----LAELGHDVIKTLIIPRL 334          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Zebrafish
Match: taf6 (TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-040912-23])

HSP 1 Score: 143.665 bits (361), Expect = 3.496e-36
Identity = 99/368 (26.90%), Postives = 175/368 (47.55%), Query Frame = 1
Query:  232 GKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP---HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            GKRC     D + ALK + +   +     + +P +F    S     L + E+ E+DL ++I     ++  + SL            A+ E   +      K +               G   +G +Q   ++     +KG           ++M      ++P   H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ YLH ++PA+++ ++   +CL P  DNH+ALR FA +++   C+   T  N + +R+               ++T   +  ++   +T R   + G    L+EL  + I+  ++P++
Sbjct:   61 GKRCKLTTGDIDHALKLKNVEPLYGFQSEEFIPFRFA---SGGGRELHFYEEKEVDLSDIINTPLPRVPLDVSLK-----------ASKEQQKAESTEPLKAV-------------KPGQEDEGFIQAKGQSAVSAEVKGK----------EKM-----RMKPRSTHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYLHELIPAVVTCIVSKQLCLRPDVDNHWALRDFAARLMAQSCKTFSTTTNNIQSRI---------------TKTFTKALLDEKTQWTTRYGCIAG----LAELGHDVIKTLIIPRL 367          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Zebrafish
Match: taf6l (TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-6789])

HSP 1 Score: 56.225 bits (134), Expect = 7.159e-8
Identity = 45/194 (23.20%), Postives = 99/194 (51.03%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G D +    AL+ ++++  +  LLP+ ++ IS G++   +  +L  L  L+ +V+SLV NP++ L  Y+  ++ +++  +L      +NP+ D H+ LR +A  +++ I         +L++ L   ++ ++++ ++               D    L +  GAV+ L  L  +A+ + L P +
Sbjct:  160 YYQQITRAILGEDPHLMKVALLDLQSNSKIAALLPYFVYVIS-GVK--SVSHDLDQLNRLLHMVKSLVQNPYLYLGSYVRSLVSSVMYCILEPLAASINPLND-HWTLRDYAALLLSHI----FWTHGDLVSGLYHQILLSLQKVLS---------------DPVRPLCSHYGAVVGLHALGWKAVERVLYPHL 330          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Zebrafish
Match: taf6l (TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-6789])

HSP 1 Score: 56.225 bits (134), Expect = 7.159e-8
Identity = 45/194 (23.20%), Postives = 99/194 (51.03%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G D +    AL+ ++++  +  LLP+ ++ IS G++   +  +L  L  L+ +V+SLV NP++ L  Y+  ++ +++  +L      +NP+ D H+ LR +A  +++ I         +L++ L   ++ ++++ ++               D    L +  GAV+ L  L  +A+ + L P +
Sbjct:  160 YYQQITRAILGEDPHLMKVALLDLQSNSKIAALLPYFVYVIS-GVK--SVSHDLDQLNRLLHMVKSLVQNPYLYLGSYVRSLVSSVMYCILEPLAASINPLND-HWTLRDYAALLLSHI----FWTHGDLVSGLYHQILLSLQKVLS---------------DPVRPLCSHYGAVVGLHALGWKAVERVLYPHL 330          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Xenopus
Match: TAF6 (TATA-box binding protein associated factor 6 [Source:NCBI gene;Acc:100493467])

HSP 1 Score: 146.747 bits (369), Expect = 2.322e-38
Identity = 72/214 (33.64%), Postives = 127/214 (59.35%), Query Frame = 1
Query:  721 HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIK 1362
            H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ YLH ++PA+++ ++   +CL P  DNH+ALR FA +++  IC+   T  N + +R+               ++T   +  +    +T R  ++ G    L+EL  + ++  +VP++ +  + L ++++
Sbjct:  152 HELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYLHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLIAQICKNFITTTNNIQSRI---------------TKTFTKTWVDDRTPWTTRYGSIAG----LAELGPDVVKTLIVPRLAVEGERLRSVME 346          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Xenopus
Match: TAF6 (TATA-box binding protein associated factor 6 [Source:NCBI gene;Acc:100493467])

HSP 1 Score: 73.559 bits (179), Expect = 8.501e-14
Identity = 57/251 (22.71%), Postives = 102/251 (40.64%), Query Frame = 1
Query:   85 NVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFN-----GDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENAR 798
             ++ + + ++I + + +S ++    +     ++   K +  + +     GKR    P D + ALK + +   +     + +P ++    S     L + E+ E+DL ++I+    ++  + S+  HWLSI  VQPA PENP       QK                            L+  KP   +G L G   G       G      +++  P        H +  E Q+Y+K +TEACVG+ E  R
Sbjct:   10 TLLPSESMKVIAESVGVSQMSEETCQMLAQEVSFRIKEVTQDALKFMHVGKRQKLTPNDIDAALKLKNVEPIYGFHAKEFLPFRYA---SGGGRELHFYEEKEVDLSDIISTPLPRVPLDVSIKAHWLSIEGVQPAIPENPPPVTKEQQK----------------------SEATEPLKAVKPGQEEGGLKGKGQGAGAAEGKGKEKKTPILEGAPLKLKPRSIHELSVEQQLYYKEITEACVGSCEAKR 235          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Mouse
Match: Taf6 (TATA-box binding protein associated factor 6 [Source:MGI Symbol;Acc:MGI:109129])

HSP 1 Score: 189.119 bits (479), Expect = 4.334e-52
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGAAAADGKGKEKKAPPLLEGAPFRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Mouse
Match: Taf6 (TATA-box binding protein associated factor 6 [Source:MGI Symbol;Acc:MGI:109129])

HSP 1 Score: 188.348 bits (477), Expect = 1.573e-51
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGAAAADGKGKEKKAPPLLEGAPFRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Mouse
Match: Taf6 (TATA-box binding protein associated factor 6 [Source:MGI Symbol;Acc:MGI:109129])

HSP 1 Score: 188.348 bits (477), Expect = 1.573e-51
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGAAAADGKGKEKKAPPLLEGAPFRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Mouse
Match: Taf6l (TATA-box binding protein associated factor 6 like [Source:MGI Symbol;Acc:MGI:2444957])

HSP 1 Score: 59.6918 bits (143), Expect = 7.405e-9
Identity = 47/194 (24.23%), Postives = 96/194 (49.48%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G+D      AL  ++ +  +  LLP+ ++ +S G++   +  +L  L  L+++ RSL+ NPH+ L PY+  ++ ++L  VL      +NP+ D H+ LR  A  +++ I         +L++ L   ++ ++++ +                D    L +  GAV+ L  L  +A+ + L P +
Sbjct:  167 YYQQVTRAVLGDDPQLMKVALQDLQTNSKIAALLPYFVYVVS-GVK--SVSHDLEQLHRLLQVARSLIRNPHLCLGPYVRSLVGSVLYCVLEPLAASINPLND-HWTLRDGAALLLSHI----FWTHGDLVSGLYQQILLSLQKVLT---------------DPVRPLCSHYGAVVGLHALGWKAVERVLYPHL 337          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Mouse
Match: Taf6l (TATA-box binding protein associated factor 6 like [Source:MGI Symbol;Acc:MGI:2444957])

HSP 1 Score: 59.6918 bits (143), Expect = 7.405e-9
Identity = 47/194 (24.23%), Postives = 96/194 (49.48%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G+D      AL  ++ +  +  LLP+ ++ +S G++   +  +L  L  L+++ RSL+ NPH+ L PY+  ++ ++L  VL      +NP+ D H+ LR  A  +++ I         +L++ L   ++ ++++ +                D    L +  GAV+ L  L  +A+ + L P +
Sbjct:  167 YYQQVTRAVLGDDPQLMKVALQDLQTNSKIAALLPYFVYVVS-GVK--SVSHDLEQLHRLLQVARSLIRNPHLCLGPYVRSLVGSVLYCVLEPLAASINPLND-HWTLRDGAALLLSHI----FWTHGDLVSGLYQQILLSLQKVLT---------------DPVRPLCSHYGAVVGLHALGWKAVERVLYPHL 337          
BLAST of Transcription initiation factor TFIID subunit 6 vs. UniProt/SwissProt
Match: sp|P49847|TAF6_DROME (Transcription initiation factor TFIID subunit 6 OS=Drosophila melanogaster OX=7227 GN=Taf6 PE=1 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 1.534e-54
Identity = 127/420 (30.24%), Postives = 216/420 (51.43%), Query Frame = 1
Query:   82 GNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQ 1341
            G+ ISA + ++I + I + +L+ +  K   + ++   KR+V +        KR      D + +LK R +   +  +    +P +F    S     L + ED E+DL E+ +    KI  + +L  HW  +  VQP  PENP      +Q   L D +     + M+ G  KD   +    T K + +K N+  I            V  +  H +  E Q+Y+K +TEACVG+DE  R  AL ++ +D  L  +LP +  FI+EG+++N++  NLA+LIYL+R+VR+L+DNP + L+ YLH ++P++++ ++   +C+ P  DNH+ALR FA +++  IC+  +T  N L  R+  I    ++     N +T+L S              L G++  LSEL  E I+  ++P++  I +
Sbjct:   18 GSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRDIDMSLKVRNVEPQYGFVAKDFIPFRFA---SGGGRELHFTEDKEIDLGEITSTNSVKIPLDLTLRSHWFVVEGVQPTVPENPPPLSKDSQ---LLDSV--NPVIKMDQGLNKDAAGKPT--TGKIHKLK-NVETIH-----------VKQLATHELSVEQQLYYKEITEACVGSDEPRRGEALQSLGSDPGLHEMLPRMCTFIAEGVKVNVVQNNLALLIYLMRMVRALLDNPSLFLEKYLHELIPSVMTCIVSKQLCMRPELDNHWALRDFASRLMAQICKNFNTLTNNLQTRVTRIFSKALQ-----NDKTHLSS--------------LYGSIAGLSELGGEVIKVFIIPRLKFISE 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. UniProt/SwissProt
Match: sp|Q91857|TAF6_XENLA (Transcription initiation factor TFIID subunit 6 OS=Xenopus laevis OX=8355 GN=taf6 PE=2 SV=3)

HSP 1 Score: 188.734 bits (478), Expect = 3.415e-51
Identity = 117/434 (26.96%), Postives = 216/434 (49.77%), Query Frame = 1
Query:   82 GN-VISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATV----IDVRP---HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNII 1359
            GN ++ + + ++I + + IS ++    +     ++   K +  + +     GKR    P D + ALK + +   +   P + +P ++    S     L + E+ E DL ++I+    ++  + SL  HWLSI  VQPA PENP       QK    + +                   ++ +  +   + G   G   G   ++  A +    + ++P   H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ YLH ++PA+++ ++   +CL P  DNH+ALR FA +++  IC+   T  N + +R+               ++T   +  +    +T R  ++ G    L+EL  + ++  +VP++ +  + L +++
Sbjct:    8 GNTLLPSESMKVISESVGISQMSEETCQLLAQEVSFRIKEVTQDALKFMHVGKRQKLTPSDIDAALKLKNVEPIYGFHPKEFLPFRYA---SGGGRELHFYEEKETDLSDIISTPLPRVPLDVSLKAHWLSIEGVQPAIPENPPPVPKEQQKTEATEPL-------------------KVAKPGQEEGLPGKGQGSGEGKGKEKKTAILEGAPLKLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYLHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLIAQICKNFSTTTNNIQSRI---------------TKTFTKTWVDDRTPWTTRYGSIAG----LAELGPDVVKTLIVPRLTVEGERLRSVL 400          
BLAST of Transcription initiation factor TFIID subunit 6 vs. UniProt/SwissProt
Match: sp|Q62311|TAF6_MOUSE (Transcription initiation factor TFIID subunit 6 OS=Mus musculus OX=10090 GN=Taf6 PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.100e-50
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGAAAADGKGKEKKAPPLLEGAPFRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. UniProt/SwissProt
Match: sp|Q63801|TAF6_RAT (Transcription initiation factor TFIID subunit 6 OS=Rattus norvegicus OX=10116 GN=Taf6 PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.240e-50
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGAAAADGKGKEKKAPPLLEGAPFRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. UniProt/SwissProt
Match: sp|P49848|TAF6_HUMAN (Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 2.556e-50
Identity = 119/437 (27.23%), Postives = 216/437 (49.43%), Query Frame = 1
Query:   40 QEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP--------HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            +E+ + ++NT      V+ + + +++ + + I+ +     +   D ++   K +  + +     GKR      D + ALK + +   +     + +P +F    S     L++ E+ E+DL ++I     ++  +  L  HWLSI   QPA PENP  +    QK    + + S        G  +DG ++           KG     A G   ++    +++  P        H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ Y+H ++PA+++ ++   +CL P  DNH+ALR FA ++V  IC+   T  N + +R+               ++T   S  ++   +T R  ++ G    L+EL  + I+  ++P++
Sbjct:    3 EEKKLKLSNT------VLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFA---SGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKS-----AKPGQEEDGPLKG----------KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRI---------------TKTFTKSWVDEKTPWTTRYGSIAG----LAELGHDVIKTLILPRL 396          
BLAST of Transcription initiation factor TFIID subunit 6 vs. TrEMBL
Match: G4LY68 (Transcription initiation factor tfiid, putative OS=Schistosoma mansoni OX=6183 GN=Smp_061300 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 5.990e-64
Identity = 141/446 (31.61%), Postives = 235/446 (52.69%), Query Frame = 1
Query:   85 NVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTD-------IPFKVVPLKFNKQNSNSETS--------LFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYS---KSQLIMNHGSGKD--GTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIK 1362
            NV  A  C  +  + N+S   AN+L+     +N +A+ L+ E +    + +R +P   D + A     +  SF +        PF      F    +   T+         F   D E+D+K L+ +EP+ + Y+ SL  HWLS+   QP +P+NP   ++ A+  +L +   S   +++  ++H    D   +V++  +    N  +  L+ ++ G +  ++ A  ++ RPH +  E  +YF+ LTEACVG +E  R+ AL     D  L P+LPHLM FI+EG+R+N+   NLA+LIYL+R+V++L+DNPH++L+PYLH ++P +++ VL   +C  PITDNH+ALR FA K + ++C R +T+ NEL  R+                   L      SA  +M  NTL G ++ L+E   + +R  + P +  +C  LT + +
Sbjct:   55 NVDVATLCAEMCGVSNLSQSAANLLQ---KHLNQIARLLIHEVLRVMEQSRRGVPQASDIDLASVLIGLEASFYNNYFIMKFSPFGTTTANFLPIRTGGRTASSGPGGKVFFIRPDKEIDVKALLLREPAGVIYDVSLVAHWLSVNGKQPTSPQNPPPDFL-AKMALLNNSFGSNNKQNKRPISHQKNDDINSSVEKHSKIGIHNSNRDKLDLLS-GSHPRKVLAVSVERRPHEISQEVMIYFRELTEACVGANETRRHEALDNATLDPGLQPILPHLMTFITEGVRINVTNHNLAILIYLMRLVKALIDNPHISLEPYLHLLVPTVITCVLNRQLCAKPITDNHWALRDFAAKQLVTLCNRHNTSSNELYGRVT----------------RELSRALCSSAIHSM--NTLYGIIVALAEFGAQCLRMTVFPLLSSLCHRLTKLTE 477          
BLAST of Transcription initiation factor TFIID subunit 6 vs. TrEMBL
Match: G7YTP4 (Transcription initiation factor TFIID subunit 6 OS=Clonorchis sinensis OX=79923 GN=CLF_110588 PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 6.557e-64
Identity = 155/545 (28.44%), Postives = 267/545 (48.99%), Query Frame = 1
Query:   55 SINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETS---LFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRD--KMYSKSQLIMNHGSGKDGTVQRILETNKP---NVIKGNLNG-IALGFNGDRMPATV-IDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADF------TMR--------------------------LNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIKLKG-----------------STLPGAEDKAISSLKDILLGGRVAMTLFDYRLANNMDMGLETCIAEF 1512
            + +++ E   + IS    +L  +M  ISNL+          +N +A+ LV   +    + +R +P   D + A     +   F   P   +P++   + + S       F   D E+D+K L+ +EP+ + Y+ S+  HWL++   QP +P+NP   ++   ++      K  S   +  N  + +D T  +    N P   + ++   +G +  G    R  +++ ++ RPH V  E  +YF+ LTEACVG  E  R+ AL     D  L P+LP+L+ FI+EG+R+N+   NLA+LIYL+R+V++LVDN H++L+PYLH ++P +++ VL   +C  PITDNH+ALR FA K + ++C R +T+ NEL NR+   L +++   I+  S  +   +  K AD       T R                          +NTL G ++ L+E   +++R  + P +  +C  LT +++                    S L  A+ ++   LK ++L  R+A  L D+R   N+   L+   A +
Sbjct:   69 ATSSSDEAKQSGISVDVAKLCAEMCGISNLSTPAAMLLQKHLNQIARLLVHNILRVMEQSRRGVPQASDVDLASVLIGLEAPFGSTPANFLPIRTGGRTATSGPGGKVFFIRPDKEIDVKALLLREPAGVLYDVSVVAHWLAVNGKQPVSPQNPPPDFLARMRQFSGSIGKRESGQSVDRNDAASEDSTHGK--RPNPPLSASKVRTTADGDVVSGVPHPRTISSISVERRPHEVSQEVMIYFRELTEACVGACEKRRHEALDNATLDPGLQPILPYLVTFITEGVRVNVTNHNLAILIYLMRLVKALVDNSHISLEPYLHLLVPTVITCVLNRQLCAKPITDNHWALRDFAAKQLVTLCNRHNTSTNELYNRVTRELSSSLHSWIDGASAVSGTDSGAKLADAVDSKLSTNRTDPARPDKVSSTLDKRSTSLGTAVNSMNTLYGILVALAEFGAQSLRILVFPLLPSLCHRLTMMVEPPSTPTTEPVDSLSTFQPSTSRLSPADQRSFDFLK-VMLTNRIAPLLADWRTRQNLGTTLDDYRAAY 610          
BLAST of Transcription initiation factor TFIID subunit 6 vs. TrEMBL
Match: A0A074ZJB6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_05533 PE=4 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.012e-63
Identity = 158/539 (29.31%), Postives = 261/539 (48.42%), Query Frame = 1
Query:   91 ISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETS---LFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGK-----DGTVQRILETNKPN--VIKGNLNGIALG--FNGDRMPATV----IDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNS--------------------------------ETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIK---------------LKGST--LPGAEDKAISSLKDILLGGRVAMTLFDYRLANNMDMGLETCIAEF 1512
            IS    +L  +M  ISNL+          +N +A+ LV   +    + +R +P   D + A     +   F   P   +P++   + + S       F   D E+D+K L+ +EP+ + Y+ S+  HWL++   QP +P+NP   ++       R + +S S  I    SG+     D T +      +PN  +    +  IA G   +G   P T+    ++ RPH V  E  +YF+ LTEACVG  E  R+ AL     D  L P+LP+L+ FI+EG+R+N+   NLA+LIYL+R+V++LVDN H++L+PYLH ++P +++ VL   +C  PITDNH+ALR FA K + ++C R +T+ NEL NR+   L +++   I+  S                                 + LD  +         +NTL G ++ L+E   +++R  + P +  +C  LT +++                + ST  L  A+ ++   LK ++L  R+A  L D+R   N+   L+   A +
Sbjct:  137 ISVDVAKLCAEMCGISNLSTPAAMLLQKHLNQIARLLVHNILRVMEQSRRGVPQASDVDLASVLIGLEAPFGSTPANFLPIRTGGRTATSGPGGKVFFIRPDKEIDVKALLLREPAGVLYDVSVVAHWLAVNGKQPVSPQNPPPDFL------ARMRQFSGS--IGKRESGQSVDRNDATSEDPTHGKRPNPPLSASKVRSIADGDVVSGVPHPRTISSISVERRPHEVSQEVMIYFRELTEACVGACEKRRHEALDNATLDPGLQPILPYLVTFITEGVRVNVTNHNLAILIYLMRLVKALVDNSHISLEPYLHLLVPTVITCVLNRQLCAKPITDNHWALRDFAAKQLVTLCNRHNTSTNELYNRVTRELSSSLHSWIDGASAVSGTDSGAKLSDVVDSKLSTNRTDPARSDKVSSTLDKRSTSLGTAVNSMNTLYGILVALAEFGAQSLRILVFPLLPSLCHRLTLMVEPPSTPTTESVDSLSPFQPSTNRLSPADQRSFDFLK-VMLTNRIAPLLADWRTRQNLGTTLDDYRAAY 666          
BLAST of Transcription initiation factor TFIID subunit 6 vs. TrEMBL
Match: A0A4E0R1I2 (Transcription initiation factor TFIID subunit 6 OS=Fasciola hepatica OX=6192 GN=D915_009408 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.184e-62
Identity = 158/555 (28.47%), Postives = 268/555 (48.29%), Query Frame = 1
Query:  109 QLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETS---LFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILR---DKMYSKSQLIMNHGSGKDG-----------------TVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINR--------LCAIL----VTNIKQTINPNSETNLDSTN-----NKSADFT----------------------------MRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIK----LKGS--------TLP------GAEDKAISSLKDILLGGRVAMTLFDYRLANNMDMGLETCIAEFG 1515
             L  +M  IS +  +        +  + + +V   +    + +R +P   D + A     +  +F       +P++   + ++S       F   D E+DLK L+ +EP+ + Y+ SLT HWL++   QP +P+NP   ++ A+  +L     K  S S+ +   G    G                  ++R L+T+ P+++  +   ++         A  +  RPH V  E  +YF+ LTEACVG +EN R+ AL     D  L P+LPHL+ FI+EG+R+N+   NLA+LIYL+R+V++LVDNPH++L+PYLH ++P +++ VL   +C  PITDNH+ALR FA K + ++C R +T+ NEL NR        LC  +    V+    T  P S    DS++       SA+ +                              +NTL G ++ L+E   + +R  + P +  +CQ LT +++    + GS        +LP       A++++   LK I++  R++  L D+R   N+ + L+     +G
Sbjct:   64 HLCAEMCGISGMQHSAAGFLRKHLMQICRLMVHSIIRVMEQSRRGVPQASDIDLASILIGLEPAFGTATSSFLPIRTGGRTASSGPGGKVFFIRPDKEIDLKALLLREPAGVVYDVSLTAHWLAVNGRQPISPQNPPPDFV-ARMSLLNGTAQKNESNSKSVHGEGPETSGGPTSSESAQETRQSSPLAMKRKLDTSNPDLVTSHPRSVS---------ALSVARRPHEVSQEVMIYFRELTEACVGANENRRHEALDNATLDPGLQPILPHLVTFITEGVRVNVTNHNLAILIYLMRLVKALVDNPHMSLEPYLHLLVPTVITCVLNRQLCAKPITDNHWALRDFAAKQLVTLCNRHNTSTNELYNRVTRELSRALCNWIEGSHVSGSSLTNLPGSRLGSDSSSATDSGKSSAESSEPKDLKKGDSPTTTGTTTTRGPSLGTAIHSMNTLYGILVALAEFGAQCLRILVFPLLPALCQRLTELVEPPAPVVGSDSGDVSVHSLPVTGRLAPADERSFEFLK-IMMTNRISSLLADWRTRQNLGVSLDDYRKAYG 607          
BLAST of Transcription initiation factor TFIID subunit 6 vs. TrEMBL
Match: A0A183MSK0 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS19025 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.438e-62
Identity = 144/446 (32.29%), Postives = 229/446 (51.35%), Query Frame = 1
Query:   85 NVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTD-------IPFKVVPLKFNKQNSNSETS--------LFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYS---KSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDV----RPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNI 1356
            NV  A  C  +  + N+S   AN+L+     +N +A+ L+ E +    + +R +P   D + A     +  SF +        PF      F    +   T+         F   D E+D+K L+ +EP+ + Y+ SL  HWLS+   QP +P+NP   ++ A+  +L +   S   +++  ++H   KD  +   +E + P +   N N   L       P  V+ V    R H +  E  +YF+ LTEACVG +E  R+ AL     D  L P+LPHLM FI+EG+R+N+   NLA+LIYL+R+V++L+DNPH++L+PYLH ++P +++ VL   +C  PITDNH+ALR FA K + ++C R +T+ NEL  R+                   L      SA  +M  NTL G ++ L+E   + +R  + P +  +C  LT +
Sbjct:   55 NVDVATLCAEMCGVSNLSQSAANLLQ---KHLNQIARLLIHEVLRVMEQSRRGVPQASDIDLASVLIGLEASFHNNYFIIKFSPFGTTTANFLPIRTGGRTASSGPGGKVFFIRPDKEIDVKALLLREPAGVVYDVSLVAHWLSVNGKQPTSPQNPPPDFL-ARMALLNNSFGSHNKQNKRSISHK--KDDDINSSVEKH-PKIGIHNSNRDKLDLLSASHPRKVLAVSVERRSHEISQEVMIYFRELTEACVGANETRRHEALDNATLDPGLQPILPHLMTFITEGVRINVTNHNLAILIYLMRLVKALIDNPHISLEPYLHLLVPTVITCVLNRQLCAKPITDNHWALRDFAAKQLVTLCNRHNTSSNELYGRVT----------------RELSRALCSSAIHSM--NTLYGIIVALAEFGAQCLRMMVFPLLSSLCHRLTKL 475          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Cavefish
Match: taf6 (TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-040912-23])

HSP 1 Score: 180.259 bits (456), Expect = 2.890e-49
Identity = 111/409 (27.14%), Postives = 200/409 (48.90%), Query Frame = 1
Query:   88 VISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP---HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIR 1305
            V+ + + + + + + +  L  +      + ++   K +  + +     GKR      D + ALK + +   +       +P +F    S     L + E+ E+DL ++I+    ++  + SL  HWLSI  VQP+ PENP  +    QK    + + +     +  G  +DG++Q   ++     +KG                  + ++P   H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R++++L+DNP + L+ YLH +LPA+++ ++   +CL P  DNH+ALR FA +++   C+   T  N + +R+               ++T   S  +    +T R   +    L +  L++E +R
Sbjct:   13 VLPSESMKAMAESMGVGQLQEDSCVALSEEVSYRIKEIAQDALKFMHHGKRRKLTTSDIDYALKLKNVEPLYGFQSQDFIPFRFA---SGGGRELHFYEEKEVDLSDIISTPLPRVPLDVSLKAHWLSIDGVQPSIPENPPPATKEQQKAESTEPLKA-----VKPGQEEDGSIQGKGQSGTSAEVKGKEK---------------LRMKPRSTHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMMKALMDNPTLYLEKYLHELLPAVVTCIVSKQLCLRPDVDNHWALRDFAARLMAQSCKTFSTTTNNIQSRI---------------TKTFTKSWLDDKTQWTTRYGCIVIKTLIIPRLTVEGVR 383          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Cavefish
Match: taf6 (TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-040912-23])

HSP 1 Score: 177.563 bits (449), Expect = 1.121e-47
Identity = 111/409 (27.14%), Postives = 200/409 (48.90%), Query Frame = 1
Query:   88 VISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP---HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIR 1305
            V+ + + + + + + +  L  +      + ++   K +  + +     GKR      D + ALK + +   +       +P +F    S     L + E+ E+DL ++I+    ++  + SL  HWLSI  VQP+ PENP  +    QK    + + +     +  G  +DG++Q   ++     +KG                  + ++P   H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R++++L+DNP + L+ YLH +LPA+++ ++   +CL P  DNH+ALR FA +++   C+   T  N + +R+               ++T   S  +    +T R   +    L +  L++E +R
Sbjct:   37 VLPSESMKAMAESMGVGQLQEDSCVALSEEVSYRIKEIAQDALKFMHHGKRRKLTTSDIDYALKLKNVEPLYGFQSQDFIPFRFA---SGGGRELHFYEEKEVDLSDIISTPLPRVPLDVSLKAHWLSIDGVQPSIPENPPPATKEQQKAESTEPLKA-----VKPGQEEDGSIQGKGQSGTSAEVKGKEK---------------LRMKPRSTHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMMKALMDNPTLYLEKYLHELLPAVVTCIVSKQLCLRPDVDNHWALRDFAARLMAQSCKTFSTTTNNIQSRI---------------TKTFTKSWLDDKTQWTTRYGCIVIKTLIIPRLTVEGVR 407          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Cavefish
Match: taf6l (TATA-box binding protein associated factor 6 like [Source:NCBI gene;Acc:103030381])

HSP 1 Score: 56.225 bits (134), Expect = 6.124e-8
Identity = 45/194 (23.20%), Postives = 99/194 (51.03%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G D +    AL+ ++++  +  LLP+ ++ IS G++   +  +L  L  L+ +V+SLV NP++ L  Y+  ++ +++  +L      +NP+ D H+ LR +A  +++ I         +L++ L   ++ ++++ ++               D    L +  GAV+ L  L  +A+ + L P +
Sbjct:  161 YYQQITRAILGEDPHLMKVALLDLQSNSKIAALLPYFVYVIS-GVK--SVSHDLDQLNRLLHMVKSLVQNPYLYLGSYVRSLVSSVMYCILEPLAASINPLND-HWTLRDYAALLLSHI----FWTHGDLVSGLYHQILLSLQKVLS---------------DPVRPLCSHYGAVVGLHALGWKAVERVLYPHL 331          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Cavefish
Match: taf6l (TATA-box binding protein associated factor 6 like [Source:NCBI gene;Acc:103030381])

HSP 1 Score: 56.225 bits (134), Expect = 6.124e-8
Identity = 45/194 (23.20%), Postives = 99/194 (51.03%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G D +    AL+ ++++  +  LLP+ ++ IS G++   +  +L  L  L+ +V+SLV NP++ L  Y+  ++ +++  +L      +NP+ D H+ LR +A  +++ I         +L++ L   ++ ++++ ++               D    L +  GAV+ L  L  +A+ + L P +
Sbjct:  161 YYQQITRAILGEDPHLMKVALLDLQSNSKIAALLPYFVYVIS-GVK--SVSHDLDQLNRLLHMVKSLVQNPYLYLGSYVRSLVSSVMYCILEPLAASINPLND-HWTLRDYAALLLSHI----FWTHGDLVSGLYHQILLSLQKVLS---------------DPVRPLCSHYGAVVGLHALGWKAVERVLYPHL 331          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Cavefish
Match: taf6l (TATA-box binding protein associated factor 6 like [Source:NCBI gene;Acc:103030381])

HSP 1 Score: 56.225 bits (134), Expect = 6.369e-8
Identity = 45/194 (23.20%), Postives = 99/194 (51.03%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G D +    AL+ ++++  +  LLP+ ++ IS G++   +  +L  L  L+ +V+SLV NP++ L  Y+  ++ +++  +L      +NP+ D H+ LR +A  +++ I         +L++ L   ++ ++++ ++               D    L +  GAV+ L  L  +A+ + L P +
Sbjct:  106 YYQQITRAILGEDPHLMKVALLDLQSNSKIAALLPYFVYVIS-GVK--SVSHDLDQLNRLLHMVKSLVQNPYLYLGSYVRSLVSSVMYCILEPLAASINPLND-HWTLRDYAALLLSHI----FWTHGDLVSGLYHQILLSLQKVLS---------------DPVRPLCSHYGAVVGLHALGWKAVERVLYPHL 276          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Sea Lamprey
Match: taf6 (TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-040912-23])

HSP 1 Score: 174.096 bits (440), Expect = 5.402e-48
Identity = 100/286 (34.97%), Postives = 159/286 (55.59%), Query Frame = 1
Query:  319 KVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVR-----PHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILV 1161
            + +P ++    S     LF+ E+ E++L ++I     ++  + SL  HWLSI  VQP+ PENP  +    QKK   + M      IM  G   DG +       KP   K + +G + G +  ++PA    VR      H +  E Q+Y+K +TEACVG+ E+ R  AL +I +D  L  +LP    FISEG+R+N+   NLA+LIYL+R+ ++L+DN  + L+ YLH ++PA+++ ++   +CL P  DNH+ALR FA +++  IC+   +  N + +R     V
Sbjct:   11 EFIPFRYA---SGGGRELFFYEEQEVNLSDMINTPLPRVPLDISLKAHWLSIEGVQPSIPENPPPTPKEQQKKEATEPMR-----IMKPGQS-DGNL-------KPG-HKASTSGPSDGKDKRKVPAEGAAVRVKARATHELSVEQQLYYKEITEACVGSCESKRAEALQSIASDPGLYQMLPRFSTFISEGVRVNVAQNNLALLIYLMRMTKALLDNQTLYLEKYLHELIPAVVTCIVSRQLCLRPDVDNHWALRDFAARLMAQICKNFSSTTNNIQSRSTKTFV 279          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Yeast
Match: TAF6 (Subunit (60 kDa) of TFIID and SAGA complexes; involved in transcription initiation of RNA polymerase II and in chromatin modification, similar to histone H4; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003080])

HSP 1 Score: 100.908 bits (250), Expect = 4.091e-23
Identity = 85/373 (22.79%), Postives = 174/373 (46.65%), Query Frame = 1
Query:  103 TCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVV--PLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIH-AQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNV-IKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYF----KTLTEACVGND--ENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITD-----NHF-----ALRKFAGKVVNSICERQHTARNELINRLCAILV 1161
            T + + + + + N+N ++LK     +      ++ + V   R  KR +    D + AL+   +   +       V   + F+K N++   S++Y ++ E+D   LI +   ++    + T HWL++  VQPA  +NP  + I  +Q   +R  + +     +N  S +          +  +     +L+ +  G N +  P     +  H +  E Q+YF     TLT     ++  ++ +  AL +++ D  L  L+P+ + FI+E I  N+   +L +L  ++ ++ SL+ N  + LDPY+H ++P++L+++L   +  +P  D     + F     ALR FA  +++ + ++   A   L  R+   L+
Sbjct:   16 TVKDVAESLGLENINDDVLKALAMDVEYRILEIIEQAVKFKRHSKRDVLTTDDVSKALRVLNVEPLYGYYDGSEVNKAVSFSKVNTSGGQSVYYLDEEEVDFDRLINEPLPQVPRLPTFTTHWLAVEGVQPAIIQNPNLNDIRVSQPPFIRGAIVTA----LNDNSLQTPVTSTTASASVTDTGASQHLSNVKPGQNTEVKP-----LVKHVLSKELQIYFNKVISTLTAKSQADEAAQHMKQAALTSLRTDSGLHQLVPYFIQFIAEQITQNL--SDLQLLTTILEMIYSLLSNTSIFLDPYIHSLMPSILTLLLAKKLGGSPKDDSPQEIHEFLERTNALRDFAASLLDYVLKKFPQAYKSLKPRVTRTLL 377          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Nematostella
Match: EDO45275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTJ4])

HSP 1 Score: 188.348 bits (477), Expect = 3.329e-52
Identity = 129/468 (27.56%), Postives = 228/468 (48.72%), Query Frame = 1
Query:   31 EVKQEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRI--LETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIKLKGSTLPGAEDKAISSLKDILL 1428
            E  ++E+ S+      D  +I A + ++I + I + NLN   +   ++      K+L  E+    ++ KR   +  D + AL+ + +   +  +    +P +F    S     +F+ +D E+DL ++I  +  +I  + SL  HWLSI  +QPA PENP  +     K+  +  +++          G+      +      KP + K  ++ I      D+    V     H +  E Q+Y+K +TEACVG+ E+ R  AL ++  D  L  +LP    FISEG+R+N+   NL +LIYL+R+V++L+DN  + L+ YLH ++PA+++ V+   +C  P  DNH+ALR F  ++V  IC   ++  N +  R+       + Q   P                   L T  GA+  L+EL  E I+  ++P++ I    ++    L+G+ +   E  A  +L+++LL
Sbjct:    3 EASEDEVESV------DSQLI-AESIKVIAESIGVRNLNHEAIGTLMEEGTYRLKQLTQESSKFMQKSKRKKLMTKDIDNALRLQNVEPLYGFVAQDFIPFRFA---SGGGREVFFYDDPEIDLNDVINTQLPRIPVDVSLKAHWLSIEGLQPAIPENPPPALADQLKREEQKPVFTTKAAPDKTKPGQKRPKAEVDSKSNKKPAITKHTISSIP-SNKADKTKGLVT----HELSVEQQLYYKEITEACVGSCESRRTEALQSLATDPGLYQMLPRFCTFISEGVRVNVAQNNLVLLIYLMRMVKALLDNSTLFLEKYLHEMIPAVVTCVVSKQLCPKPEVDNHWALRDFGARLVAQICRSFNSTTNSVQTRVTKTYCKALHQEKAP-------------------LATHYGAITGLAELGQEVIKVLVLPRLKIESALISR--ALQGTDV--VEKNAAENLQNLLL 432          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Nematostella
Match: EDO48592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIY9])

HSP 1 Score: 60.4622 bits (145), Expect = 6.271e-10
Identity = 50/212 (23.58%), Postives = 102/212 (48.11%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVL-CGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNI-KQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIKLKGST 1377
            Y++ +T+A +G  +  R  A   ++++  +  + P+ + FI+ G++      +L  L  L+ +V +L DN  + LDPY+ +++ A++  +L    + LNP+ D H+ LR+ A  ++              ++R C+  V  + +Q +    E   D +    + F        GAV+ L EL  EA+ + L+P +      L  +++   S+
Sbjct:  162 YYEQITKAVLGESDVCRRMAFSDLQSNPKISCIFPYFVSFIASGVK--SCSHDLKQLSRLLGMVSALTDNSSLFLDPYVIQLVTAVMYCLLETLTVSLNPVND-HWRLRRDAACIL------------AFLSRKCSNPVNYLHQQLLMTLREVLTDESRPYCSHF--------GAVVGLMELGSEALEQFLLPHLSTYWHQLQQVLEDDSSS 350          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Medaka
Match: taf6 (TATA-box binding protein associated factor 6 [Source:NCBI gene;Acc:101174043])

HSP 1 Score: 182.57 bits (462), Expect = 8.842e-50
Identity = 112/370 (30.27%), Postives = 188/370 (50.81%), Query Frame = 1
Query:  232 GKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRP---HFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGI 1332
            GKR      D + ALK + +   +     + +P +F    S     L + E+ E+DL ++I     ++  + SL  HWLSI  VQP+ PENP  +    QK    + +      ++  G  ++G +Q            G   G A   +G       I ++P   H +  E Q+Y+K +TEACVG+ E  R  AL +I  D  L  +LP    FISEG+R+N++  NLA+LIYL+R+V++L+DNP + L+ YLH ++PA+++ ++   +CL P  DNH+ALR FA +++   C+   T  N + +R+   L           +++ LD     +A +        G +  L+EL  + I+  ++P++ +
Sbjct:   61 GKRRKLTTSDIDNALKLKNVEPLYGFQSQEFIPFRFA---SGGGRELHFYEEKEVDLSDIINTPLPRVPLDVSLKAHWLSIEGVQPSIPENPPPATKEQQKTESTEPLK-----VVKPGQEEEGAIQ------------GKGQG-ATAPDGKGKEKGSIRLKPRSTHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYLHELIPAVVTCIVSKQLCLRPDVDNHWALRDFAARLMAQCCKTFSTTTNNIQSRITKTL-----------TKSWLDEKTQWTARY--------GCIAGLAELGPDVIKTLILPRLTV 390          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Medaka
Match: taf6l (TATA-box binding protein associated factor 6 like [Source:NCBI gene;Acc:101170624])

HSP 1 Score: 59.6918 bits (143), Expect = 5.507e-9
Identity = 47/194 (24.23%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  748 YFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCG-NICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKI 1326
            Y++ +T A +G+D +    AL+ ++++  +  LLP+ ++ IS G++   +  +L  L  L+ +VRSLV NP++ L  Y+  ++ +++  +L      +NP+ D H+ LR +A  ++++I         +L++ L   ++ ++++ ++               D    L +  GAV+ L  L  +A+ K L P +
Sbjct:  160 YYQQITRAILGDDPHLMKVALLDLQSNSKIAALLPYFVYVIS-GVK--SVSHDLEQLNRLLHMVRSLVQNPYLYLGSYVRSLVSSVMYCILEPLAASINPLND-HWTLRDYAALLLSNI----FWTHGDLVSGLYHQILLSLQKVLS---------------DPVRPLCSHYGAVVGLHALGWKAVEKVLFPHL 330          
BLAST of Transcription initiation factor TFIID subunit 6 vs. Planmine SMEST
Match: SMESG000004538.1 (SMESG000004538.1)

HSP 1 Score: 1105.89 bits (2859), Expect = 0.000e+0
Identity = 537/537 (100.00%), Postives = 537/537 (100.00%), Query Frame = 1
Query:   19 MENPEVKQEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIKLKGSTLPGAEDKAISSLKDILLGGRVAMTLFDYRLANNMDMGLETCIAEFGNGMGMKYHDIFSKTSTSRHGIVQQQQNAINNEGNVPHV 1629
            MENPEVKQEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIKLKGSTLPGAEDKAISSLKDILLGGRVAMTLFDYRLANNMDMGLETCIAEFGNGMGMKYHDIFSKTSTSRHGIVQQQQNAINNEGNVPHV
Sbjct:    1 MENPEVKQEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPCIDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPFKVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWLSIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRILETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTEACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVLIYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFALRKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTNNKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIKLKGSTLPGAEDKAISSLKDILLGGRVAMTLFDYRLANNMDMGLETCIAEFGNGMGMKYHDIFSKTSTSRHGIVQQQQNAINNEGNVPHV 537          
The following BLAST results are available for this feature:
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAF65.323e-5127.23TATA-box binding protein associated factor 6 [Sour... [more]
TAF65.323e-5127.23TATA-box binding protein associated factor 6 [Sour... [more]
TAF65.323e-5127.23TATA-box binding protein associated factor 6 [Sour... [more]
TAF68.004e-5126.82TATA-box binding protein associated factor 6 [Sour... [more]
TAF61.491e-5026.82TATA-box binding protein associated factor 6 [Sour... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf-6.18.082e-2539.68TAF (TBP-associated transcription factor) family ... [more]
taf-6.18.082e-2539.68TAF (TBP-associated transcription factor) family ... [more]
taf-6.17.036e-2439.68TAF (TBP-associated transcription factor) family ... [more]
taf-6.17.555e-2439.68TAF (TBP-associated transcription factor) family ... [more]
taf-6.21.803e-1225.37TAF (TBP-associated transcription factor) family ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taf61.520e-5530.24gene:FBgn0010417 transcript:FBtr0333272[more]
Taf61.530e-5530.24gene:FBgn0010417 transcript:FBtr0074941[more]
mia2.378e-2632.85gene:FBgn0014342 transcript:FBtr0346136[more]
mia2.378e-2632.85gene:FBgn0014342 transcript:FBtr0089313[more]
mia2.378e-2632.85gene:FBgn0014342 transcript:FBtr0300009[more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf63.925e-5028.26TAF6 RNA polymerase II, TATA box binding protein (... [more]
taf65.293e-5030.43TAF6 RNA polymerase II, TATA box binding protein (... [more]
taf63.496e-3626.90TAF6 RNA polymerase II, TATA box binding protein (... [more]
taf6l7.159e-823.20TAF6-like RNA polymerase II, p300/CBP-associated f... [more]
taf6l7.159e-823.20TAF6-like RNA polymerase II, p300/CBP-associated f... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TAF62.322e-3833.64TATA-box binding protein associated factor 6 [Sour... [more]
TAF68.501e-1422.71TATA-box binding protein associated factor 6 [Sour... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taf64.334e-5227.23TATA-box binding protein associated factor 6 [Sour... [more]
Taf61.573e-5127.23TATA-box binding protein associated factor 6 [Sour... [more]
Taf61.573e-5127.23TATA-box binding protein associated factor 6 [Sour... [more]
Taf6l7.405e-924.23TATA-box binding protein associated factor 6 like ... [more]
Taf6l7.405e-924.23TATA-box binding protein associated factor 6 like ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49847|TAF6_DROME1.534e-5430.24Transcription initiation factor TFIID subunit 6 OS... [more]
sp|Q91857|TAF6_XENLA3.415e-5126.96Transcription initiation factor TFIID subunit 6 OS... [more]
sp|Q62311|TAF6_MOUSE1.100e-5027.23Transcription initiation factor TFIID subunit 6 OS... [more]
sp|Q63801|TAF6_RAT1.240e-5027.23Transcription initiation factor TFIID subunit 6 OS... [more]
sp|P49848|TAF6_HUMAN2.556e-5027.23Transcription initiation factor TFIID subunit 6 OS... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4LY685.990e-6431.61Transcription initiation factor tfiid, putative OS... [more]
G7YTP46.557e-6428.44Transcription initiation factor TFIID subunit 6 OS... [more]
A0A074ZJB61.012e-6329.31Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4E0R1I21.184e-6228.47Transcription initiation factor TFIID subunit 6 OS... [more]
A0A183MSK01.438e-6232.29Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf62.890e-4927.14TAF6 RNA polymerase II, TATA box binding protein (... [more]
taf61.121e-4727.14TAF6 RNA polymerase II, TATA box binding protein (... [more]
taf6l6.124e-823.20TATA-box binding protein associated factor 6 like ... [more]
taf6l6.124e-823.20TATA-box binding protein associated factor 6 like ... [more]
taf6l6.369e-823.20TATA-box binding protein associated factor 6 like ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf65.402e-4834.97TAF6 RNA polymerase II, TATA box binding protein (... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAF64.091e-2322.79Subunit (60 kDa) of TFIID and SAGA complexes; invo... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO452753.329e-5227.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485926.271e-1023.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf68.842e-5030.27TATA-box binding protein associated factor 6 [Sour... [more]
taf6l5.507e-924.23TATA-box binding protein associated factor 6 like ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000004538.10.000e+0100.00SMESG000004538.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003583 ID=SMED30003583|Name=Transcription initiation factor TFIID subunit 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1641bp
ATATAAATCTTATATGTAATGGAAAATCCTGAAGTTAAACAAGAAGAAAT
AATTTCAATAAATAATACTACTGAATTTGATGGAAATGTTATTAGCGCTG
CTACATGTCAGCTTATTGGTCAAATGATAAATATTTCCAATTTAAATGCA
AATATTCTTAAGCCATGCATTGATTCCATAAATAACTTAGCGAAAAGATT
AGTAGGCGAAACGGTATTTGCTGCACGTCGTGGTAAACGATGTATTCCTA
TACCCTTTGATGCTAACACTGCACTTAAATATCGAAAAATAGCAACGTCA
TTTACAGATATTCCTTTTAAAGTTGTCCCGTTGAAATTTAATAAACAAAA
TTCAAACAGCGAAACTTCTTTGTTTTATCCAGAAGATACCGAACTCGATT
TAAAAGAATTAATAACAAAAGAACCAAGCAAGATATCTTATGAGTCATCA
TTAACTGAACATTGGTTGAGTATTTACTCAGTTCAACCGGCCACACCGGA
AAATCCAACATCTTCATATATTCACGCTCAGAAAAAAATTCTCCGCGATA
AAATGTATTCAAAATCTCAATTAATTATGAATCATGGCAGTGGAAAAGAT
GGAACAGTTCAAAGAATTCTTGAAACAAACAAACCAAATGTCATCAAAGG
AAATCTCAATGGTATTGCTCTTGGATTTAATGGCGATCGAATGCCAGCCA
CTGTAATTGACGTGAGACCGCATTTCGTCGGAACGGAACATCAGGTGTAT
TTTAAAACCCTCACTGAAGCATGTGTTGGAAATGACGAGAACGCTAGAAA
CAATGCGTTAGTTACTATTAAAAACGACAAAGCTCTAGATCCATTATTAC
CTCATTTAATGCATTTCATTTCCGAAGGCATTCGATTGAATATTATGTAT
CAAAATCTCGCTGTTCTAATTTATTTGGTGAGAATCGTTCGATCTTTAGT
CGATAATCCCCACGTCAATTTGGATCCGTATTTGCATCGGATTCTACCGG
CGCTATTATCAGTCGTTCTCTGTGGAAATATTTGTCTCAATCCTATAACA
GATAACCATTTTGCACTGAGGAAGTTTGCTGGAAAAGTTGTCAACAGTAT
CTGCGAACGACAGCACACTGCACGCAATGAGCTCATTAACCGACTATGTG
CAATTCTCGTTACAAATATCAAACAAACTATTAATCCAAATTCGGAAACC
AATTTAGATAGCACAAACAATAAATCTGCTGATTTCACAATGAGACTCAA
CACGTTATGCGGTGCCGTGCTCTGCTTATCGGAATTGAGCATTGAAGCCA
TTCGAAAATGCCTCGTTCCAAAAATTGGGATAATTTGTCAGTTCCTTACA
AACATTATCAAACTGAAGGGCTCTACATTGCCCGGGGCTGAGGATAAAGC
TATCAGTTCTTTAAAAGACATTTTATTGGGTGGGAGAGTTGCAATGACTC
TATTCGATTACAGGCTAGCAAACAATATGGATATGGGTTTGGAGACCTGC
ATTGCGGAATTCGGTAACGGGATGGGGATGAAGTATCATGATATATTTAG
CAAGACGTCCACATCTCGGCATGGCATTGTTCAGCAACAACAAAATGCTA
TTAATAATGAAGGCAATGTTCCACATGTATAAATTTGTGTA
back to top

protein sequence of SMED30003583-orf-1

>SMED30003583-orf-1 ID=SMED30003583-orf-1|Name=SMED30003583-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=538bp
MENPEVKQEEIISINNTTEFDGNVISAATCQLIGQMINISNLNANILKPC
IDSINNLAKRLVGETVFAARRGKRCIPIPFDANTALKYRKIATSFTDIPF
KVVPLKFNKQNSNSETSLFYPEDTELDLKELITKEPSKISYESSLTEHWL
SIYSVQPATPENPTSSYIHAQKKILRDKMYSKSQLIMNHGSGKDGTVQRI
LETNKPNVIKGNLNGIALGFNGDRMPATVIDVRPHFVGTEHQVYFKTLTE
ACVGNDENARNNALVTIKNDKALDPLLPHLMHFISEGIRLNIMYQNLAVL
IYLVRIVRSLVDNPHVNLDPYLHRILPALLSVVLCGNICLNPITDNHFAL
RKFAGKVVNSICERQHTARNELINRLCAILVTNIKQTINPNSETNLDSTN
NKSADFTMRLNTLCGAVLCLSELSIEAIRKCLVPKIGIICQFLTNIIKLK
GSTLPGAEDKAISSLKDILLGGRVAMTLFDYRLANNMDMGLETCIAEFGN
GMGMKYHDIFSKTSTSRHGIVQQQQNAINNEGNVPHV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000124SAGA complex
GO:0005669transcription factor TFIID complex
GO:0046695SLIK (SAGA-like) complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006367transcription initiation from RNA polymerase II promoter
GO:0051090regulation of sequence-specific DNA binding transcription factor activity
GO:0006352DNA-templated transcription, initiation
GO:0006413translational initiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037796TAF6
IPR011989ARM-like
IPR011442TAF6_C
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003743translation initiation factor activity
GO:0046982protein heterodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011442TAF6, C-terminal HEAT repeat domainPFAMPF07571TAF6_Ccoord: 331..437
e-value: 1.8E-14
score: 53.8
NoneNo IPR availableGENE3DG3DSA:1.25.40.770coord: 235..451
e-value: 2.6E-37
score: 130.1
NoneNo IPR availablePANTHERPTHR10221:SF12TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 6coord: 24..471
IPR037796Transcription initiation factor TFIID subunit 6PANTHERPTHR10221TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 6coord: 24..471
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 247..448