Leucine rich repeat containing 49

Overview
NameLeucine rich repeat containing 49
Smed IDSMED30003580
Length (bp)2902
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine rich repeat containing 49 (SMED30003580) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine rich repeat containing 49 (SMED30003580) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine rich repeat containing 49 (SMED30003580) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine rich repeat containing 49 (SMED30003580) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003580

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003580SMESG000011491.1 SmedASXL_016659SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003580SMESG000011491.1 dd_Smed_v4_15207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003580SMESG000011491.1 dd_Smed_v6_15207_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003580SMESG000011491.1 dd_Smed_v4_15207_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine rich repeat containing 49 vs. Ensembl Human
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 180.644 bits (457), Expect = 4.913e-47
Identity = 124/237 (52.32%), Postives = 168/237 (70.89%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR+SL+RQ LT CPI+  E++LRLLN+Q+N+I +IQ++  L+KLI LDLYDN+IE ISGL TL+ LRVL+LG+NRI KI  LE+L  LDVLDLH N I  IENINHL +LRVLNLA N ++ + NL GL SL+E+N+R N +  V D++  N P LQ +FLSFN++      SCL D  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   36 ILQRSSEEKILYSDRLSLERQKLTVCPIINGEDHLRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRMA 270          

HSP 2 Score: 89.3521 bits (220), Expect = 1.338e-17
Identity = 42/127 (33.07%), Postives = 77/127 (60.63%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNAN 2303
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  LI  + D RK++  +  E++   P  ++  N
Sbjct:  420 KFPNSLHLKFKETNLVMLQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRLISILGDARKKQFRYLLESKGKKPGIINEEN 546          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Human
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 180.644 bits (457), Expect = 7.697e-47
Identity = 124/237 (52.32%), Postives = 168/237 (70.89%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR+SL+RQ LT CPI+  E++LRLLN+Q+N+I +IQ++  L+KLI LDLYDN+IE ISGL TL+ LRVL+LG+NRI KI  LE+L  LDVLDLH N I  IENINHL +LRVLNLA N ++ + NL GL SL+E+N+R N +  V D++  N P LQ +FLSFN++      SCL D  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   70 ILQRSSEEKILYSDRLSLERQKLTVCPIINGEDHLRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRMA 304          

HSP 2 Score: 89.3521 bits (220), Expect = 1.604e-17
Identity = 42/127 (33.07%), Postives = 77/127 (60.63%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNAN 2303
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  LI  + D RK++  +  E++   P  ++  N
Sbjct:  454 KFPNSLHLKFKETNLVMLQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRLISILGDARKKQFRYLLESKGKKPGIINEEN 580          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Human
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 180.644 bits (457), Expect = 1.053e-46
Identity = 124/237 (52.32%), Postives = 168/237 (70.89%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR+SL+RQ LT CPI+  E++LRLLN+Q+N+I +IQ++  L+KLI LDLYDN+IE ISGL TL+ LRVL+LG+NRI KI  LE+L  LDVLDLH N I  IENINHL +LRVLNLA N ++ + NL GL SL+E+N+R N +  V D++  N P LQ +FLSFN++      SCL D  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   85 ILQRSSEEKILYSDRLSLERQKLTVCPIINGEDHLRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRMA 319          

HSP 2 Score: 89.3521 bits (220), Expect = 1.524e-17
Identity = 42/127 (33.07%), Postives = 77/127 (60.63%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNAN 2303
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  LI  + D RK++  +  E++   P  ++  N
Sbjct:  469 KFPNSLHLKFKETNLVMLQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRLISILGDARKKQFRYLLESKGKKPGIINEEN 595          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Human
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 180.259 bits (456), Expect = 1.152e-46
Identity = 124/237 (52.32%), Postives = 168/237 (70.89%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR+SL+RQ LT CPI+  E++LRLLN+Q+N+I +IQ++  L+KLI LDLYDN+IE ISGL TL+ LRVL+LG+NRI KI  LE+L  LDVLDLH N I  IENINHL +LRVLNLA N ++ + NL GL SL+E+N+R N +  V D++  N P LQ +FLSFN++      SCL D  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   80 ILQRSSEEKILYSDRLSLERQKLTVCPIINGEDHLRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRMA 314          

HSP 2 Score: 89.3521 bits (220), Expect = 1.460e-17
Identity = 42/127 (33.07%), Postives = 77/127 (60.63%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNAN 2303
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  LI  + D RK++  +  E++   P  ++  N
Sbjct:  464 KFPNSLHLKFKETNLVMLQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRLISILGDARKKQFRYLLESKGKKPGIINEEN 590          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Human
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 89.7373 bits (221), Expect = 2.405e-18
Identity = 42/127 (33.07%), Postives = 77/127 (60.63%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNAN 2303
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  LI  + D RK++  +  E++   P  ++  N
Sbjct:  152 KFPNSLHLKFKETNLVMLQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRLISILGDARKKQFRYLLESKGKKPGIINEEN 278          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 97.8265 bits (242), Expect = 1.266e-21
Identity = 69/191 (36.13%), Postives = 101/191 (52.88%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFN-----------HLGRISDFSC-------------LIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITE 1088
            N+I +I GL+TL  L  L LG NRI+KIE L++  +LD L L AN I++IEN++HL  L VL+L  N IT + N+ GL++L E+ + +N ++ V  I+     +L    L FN            L  ++DF               L++L  LN + +D NPI+S  + R  VI    Q+  LD  Q  E
Sbjct:  130 NKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDE----HLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKLDNWSIMDELVELPQLNSVYLDFNPIASVDTYRGKVIHLLQQITRLDGTQCRE 316          

HSP 2 Score: 53.1434 bits (126), Expect = 5.234e-7
Identity = 46/141 (32.62%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPIS 1010
            N I++I  L+ L +L  L    N+I+K+E L+SL  L+ LDL  N I  IEN+  L+ L+ L    N IT +  L  L  L  + +  N +  + +++  N   L R+FL  N +  I +      L  L  LS+  N I+
Sbjct:   64 NLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLD--NNLKLDRLFLGANQIRLIENVD---HLKKLTVLSLPANAIT 199          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 73.1738 bits (178), Expect = 1.915e-13
Identity = 55/163 (33.74%), Postives = 90/163 (55.21%), Query Frame = 3
Query:  585 DNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPI-SSNGSSRSAVIFNFPQLNLLD 1070
            DNRI+++  L  L +L  L LG N+I KIEGL+ + +L  L L  N++Q+IE ++ LS L+ ++LA N I  +  L GL +L  +++  N +E +   N      +  + +  N L    D   L  L +L  L+++ NP+ SS+ + R+ V    P + LLD
Sbjct:  146 DNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKL--ENVEQFKGISSLMIRKNKLNCWQDVRQLKKLENLTVLTMEMNPLYSSDYTYRNRVKEILPDVKLLD 306          

HSP 2 Score: 61.2326 bits (147), Expect = 1.160e-9
Identity = 45/131 (34.35%), Postives = 72/131 (54.96%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLN 980
            NRI +I GL  L +L  L L  N+I  IEGLE+   +  L+   N IQ +EN++HL +L  L L  N I  +  L G+  L E+++  N ++ +  +++     L+ I L+ N + +I   S L +L SL+
Sbjct:  103 NRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDT--LSGLKSISLAQNGIRKIDGLSGLTNLKSLD 231          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 64.6994 bits (156), Expect = 9.860e-11
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISS 1013
            NRI +I+GL+ L  L  L L  N+I KIE LE+L +L +L+L  N I+ IENI HL +L  L +  N I  L  +  L  LS +++  N +  + ++   N  NL+ ++LS   L  I     L +L  L+   + NN I +
Sbjct:  113 NRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLN--NLKELYLSDQGLQDIHGVEPLTNLLLLD---VANNEIKT 249          

HSP 2 Score: 60.077 bits (144), Expect = 2.798e-9
Identity = 37/93 (39.78%), Postives = 58/93 (62.37%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCV 860
            Y+N++  IS LE+L +L  L L  NRI +I GL+ L +L+ L L +N I+ IEN+  L+ L++L L  N I  + N+  L +L E+ I +N +
Sbjct:   89 YENQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKI 181          

HSP 3 Score: 58.5362 bits (140), Expect = 8.802e-9
Identity = 42/114 (36.84%), Postives = 63/114 (55.26%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINS-TNCPNLQRIFLSFN 926
            N+I ++ G+ETL+ L VL L  NRI KIE +E LN L  L L    +Q I  +  L++L +L++A N I   + +  L SL++     N VES  +I   +    LQ ++L  N
Sbjct:  179 NKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKTFSGVERLESLNDFWANDNKVESFSEIEQLSKLKGLQTVYLERN 292          

HSP 4 Score: 56.6102 bits (135), Expect = 3.331e-8
Identity = 44/165 (26.67%), Postives = 85/165 (51.52%), Query Frame = 3
Query:  585 DNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSS--RSAVIFNFPQLNLLDT 1073
            DNRI++I  +  L +L  L +G+N+I ++EG+E+L +L VL L  N I  IEN+  L++L+ L L+   +  +  +  L +L  +++  N +++   +      +L   + + N +   S+   L  L  L  + ++ NP   N ++  R  V+    Q+  +D 
Sbjct:  156 DNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKTFSGVE--RLESLNDFWANDNKVESFSEIEQLSKLKGLQTVYLERNPFYFNDTNQYRRKVMMTLTQVTQIDA 318          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 51.2174 bits (121), Expect = 1.381e-6
Identity = 36/156 (23.08%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  705 LDLHANSIQVIENINHLSD-LRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHI 1169
            ++L    I VIEN+    D   V++L  N I  L N      L+ + +  N +  +    +T  PNL+ + L+ N++  + D   L +   L  ++   NPI+   + R  +I+  P + ++D  ++   +R  AK++  + + G K+   + + +
Sbjct:   24 INLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAAKKMF-KGKSGKKARDAIQKSV 178          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 51.2174 bits (121), Expect = 1.381e-6
Identity = 36/156 (23.08%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  705 LDLHANSIQVIENINHLSD-LRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHI 1169
            ++L    I VIEN+    D   V++L  N I  L N      L+ + +  N +  +    +T  PNL+ + L+ N++  + D   L +   L  ++   NPI+   + R  +I+  P + ++D  ++   +R  AK++  + + G K+   + + +
Sbjct:   24 INLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAAKKMF-KGKSGKKARDAIQKSV 178          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Fly
Match: CG13708 (gene:FBgn0035577 transcript:FBtr0073358)

HSP 1 Score: 106.301 bits (264), Expect = 7.885e-23
Identity = 72/179 (40.22%), Postives = 103/179 (57.54%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESL-NRLDVLDLHANSIQVIEN-INHLSDLRVLNLAGNVITCL--TNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            YDN+IERI+ L+ L SL VL+LG+NRI+ I GL SL + L VLDLH N +  + + IN L  L+ LNLAGN I  +   +  GL  L E+N++RN +  +      +   L+R++L  N L R+ D + +     L E++I+NNP+S  G   S ++   P L  L    ITE  R  A
Sbjct:  478 YDNQIERIANLDGLPSLSVLLLGKNRITDIGGLSSLKDTLRVLDLHGNKLTSLGSRINCLQQLKSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKLRRINGFQ--HLVALERLWLCHNDLHRVDDMASIARATRLLEVTIENNPVSLAGDCVSFLVSYLPLLQTLSQMPITEQVRRAA 654          

HSP 2 Score: 66.2402 bits (160), Expect = 1.359e-10
Identity = 29/87 (33.33%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATM 2183
            RFP+ +   F+  +I C  Q+N LA L+ L  L+I+   N I+     R Y ++RL+H GL++ N +E+T+ E   A   ++ L+ +
Sbjct: 1071 RFPHAEHYVFRETNISCLGQLNGLAELQGLSSLMIDAEGNGITLKETWRAYAIYRLSHWGLKQLNGQEVTEAEVEAANAMYVGLSDL 1157          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Fly
Match: CG13708 (gene:FBgn0035577 transcript:FBtr0332744)

HSP 1 Score: 106.301 bits (264), Expect = 7.885e-23
Identity = 72/179 (40.22%), Postives = 103/179 (57.54%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESL-NRLDVLDLHANSIQVIEN-INHLSDLRVLNLAGNVITCL--TNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            YDN+IERI+ L+ L SL VL+LG+NRI+ I GL SL + L VLDLH N +  + + IN L  L+ LNLAGN I  +   +  GL  L E+N++RN +  +      +   L+R++L  N L R+ D + +     L E++I+NNP+S  G   S ++   P L  L    ITE  R  A
Sbjct:  478 YDNQIERIANLDGLPSLSVLLLGKNRITDIGGLSSLKDTLRVLDLHGNKLTSLGSRINCLQQLKSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKLRRINGFQ--HLVALERLWLCHNDLHRVDDMASIARATRLLEVTIENNPVSLAGDCVSFLVSYLPLLQTLSQMPITEQVRRAA 654          

HSP 2 Score: 66.2402 bits (160), Expect = 1.359e-10
Identity = 29/87 (33.33%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATM 2183
            RFP+ +   F+  +I C  Q+N LA L+ L  L+I+   N I+     R Y ++RL+H GL++ N +E+T+ E   A   ++ L+ +
Sbjct: 1071 RFPHAEHYVFRETNISCLGQLNGLAELQGLSSLMIDAEGNGITLKETWRAYAIYRLSHWGLKQLNGQEVTEAEVEAANAMYVGLSDL 1157          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Fly
Match: U2A (gene:FBgn0033210 transcript:FBtr0088941)

HSP 1 Score: 65.4698 bits (158), Expect = 3.603e-11
Identity = 46/155 (29.68%), Postives = 76/155 (49.03%), Query Frame = 3
Query:  657 RISKIEGL-ESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQII 1118
            +I +IE L  +L++ D +DL  N ++ ++N+ HL  L+ L L  N I              + I     E+V        PNL  I L+ N+L  +SD   L+    L  + +  NP+S+  + R  + + FPQL LLD ++I + DR  A++  
Sbjct:   30 KIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRI--------------LRISEGLEEAV--------PNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFF 162          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 66.2402 bits (160), Expect = 3.730e-11
Identity = 50/163 (30.67%), Postives = 91/163 (55.83%), Query Frame = 3
Query:  585 DNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDT 1073
            DN++++I  +E L +LR L LG+N+I+KIE L++L  L++L L AN I  IEN+  L++LR L ++ N +  + NL     L  +++ +N ++ +   N      L+ ++L+ N +    D   L    +L  + ++ NP++ +   RS +    PQL  +D 
Sbjct:  158 DNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGI--ANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDA 318          

HSP 2 Score: 60.4622 bits (145), Expect = 2.863e-9
Identity = 44/130 (33.85%), Postives = 74/130 (56.92%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSL 977
            N I++I  L +LK+L  L L  N+I+KIE L+ L  L+VLD+  N +  IEN++ L  L  +    N IT + NL  L +L+ + +  N ++ + +I      NL+++FL  N + +I +   L++L  L
Sbjct:   71 NLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEM--LVNLRQLFLGKNKIAKIENLDTLVNLEIL 198          

HSP 3 Score: 58.5362 bits (140), Expect = 1.021e-8
Identity = 42/144 (29.17%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISS 1013
            YDN+I +I  L+ L  L VL +  NR++KIE L+ L +L+ +   +N I  IEN++ L++L +L L  N +  + N+  L +L ++ + +N +  + ++++    NL+ + L  N + +I +      L +L EL +  N + +
Sbjct:   91 YDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDT--LVNLEILSLQANRIVKIENLE---KLANLRELYVSENGVET 229          

HSP 4 Score: 56.225 bits (134), Expect = 6.314e-8
Identity = 44/129 (34.11%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  591 RIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSL 977
            RIE++   E L  +  L L  N I KIE L SL  L  L+L+ N I  IEN++ L  L VL+++ N +T + NL  L  L +V    N +  + +++     NL  + L  N L +I +   L++L  L
Sbjct:   50 RIEKLENFEPLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDM--LTNLTMLELGDNKLKKIENIEMLVNLRQL 176          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Fly
Match: tilB (gene:FBgn0014395 transcript:FBtr0077345)

HSP 1 Score: 65.0846 bits (157), Expect = 1.329e-10
Identity = 47/141 (33.33%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  687 LNRLDVLDLHANSIQVIENI-NHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            ++ L+ + LH   I+VIE+I N   DL++L L  N+I  L NL  L  L  +N+  N +E V   N   C +L ++ L+ N +  ++    L    +L EL +  NP       R  V+   PQLN LD  +IT  +R +A
Sbjct:   20 ISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVE--NLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRA 158          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Zebrafish
Match: dnaaf1 (dynein, axonemal, assembly factor 1 [Source:NCBI gene;Acc:386722])

HSP 1 Score: 78.5666 bits (192), Expect = 1.830e-14
Identity = 61/174 (35.06%), Postives = 87/174 (50.00%), Query Frame = 3
Query:  603 ISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINS-TNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSI----DNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAK 1109
            I GLE    LR L L  N I KIE LE+   L  L LH N I  +EN+  LS L  LN++ N I  + N+  L  LS + I  N +E+V D+   ++CP++  + LS N   RISD + +  L  + +L +     N  I    + R  +I    QL  LD + +   DR  A+
Sbjct:   89 IEGLEEYTGLRCLWLECNGIRKIENLENQTELRCLFLHQNLIHTLENLEPLSKLCTLNVSNNYIKVIENISSLSDLSTLQISHNTLENVCDMEELSHCPSISVLDLSHN---RISDPALVNILEKMPDLRVLNLMGNEVIKKIPNYRKTLIVRLKQLTYLDDRPVFPKDRACAE 259          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Zebrafish
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 73.1738 bits (178), Expect = 1.021e-12
Identity = 58/173 (33.53%), Postives = 91/173 (52.60%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            N++  +  L    SL  L+L  N  S I GLE   RL  L L  N+I  I  ++HL  LR L LAGN+I  + NL+ L++L  +++  N ++S+  +   N   L  + L  N +  I + + L DL  L E+++  NP+  +   R AVIF    L LLD + +T +++  A
Sbjct:  104 NQMTAMKDLSAYSSLTKLILDHNSFSVIRGLEKCKRLSHLSLAHNNISRIRGLDHLP-LRELCLAGNMINKIENLQTLHNLQVLDLSCNRIQSLTGLQ--NLRFLGTVNLESNLITEIKEAAHLHDLILLREINLLKNPVQDHDDYRIAVIFLLQHLILLDKQTVTAEEKVAA 273          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 70.0922 bits (170), Expect = 5.452e-12
Identity = 50/140 (35.71%), Postives = 75/140 (53.57%), Query Frame = 3
Query:  696 LDVLDLHANSIQVIENINHLS-DLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQ 1112
            L+ L LH   IQ IE+I+    DL++L L  N+I  + N+  L  L  +N+  N +E VI+ N   C +LQ++ L+ N +GR+S    L     L EL +  NP +     R  V+   PQL  LD K+I+  +R +A Q
Sbjct:   23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIE-VIE-NLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVGNPCAEYHGYRQYVVATVPQLQSLDGKEISRAERIQALQ 160          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 70.0922 bits (170), Expect = 5.452e-12
Identity = 50/140 (35.71%), Postives = 75/140 (53.57%), Query Frame = 3
Query:  696 LDVLDLHANSIQVIENINHLS-DLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQ 1112
            L+ L LH   IQ IE+I+    DL++L L  N+I  + N+  L  L  +N+  N +E VI+ N   C +LQ++ L+ N +GR+S    L     L EL +  NP +     R  V+   PQL  LD K+I+  +R +A Q
Sbjct:   23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIE-VIE-NLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVGNPCAEYHGYRQYVVATVPQLQSLDGKEISRAERIQALQ 160          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 70.0922 bits (170), Expect = 5.452e-12
Identity = 50/140 (35.71%), Postives = 75/140 (53.57%), Query Frame = 3
Query:  696 LDVLDLHANSIQVIENINHLS-DLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQ 1112
            L+ L LH   IQ IE+I+    DL++L L  N+I  + N+  L  L  +N+  N +E VI+ N   C +LQ++ L+ N +GR+S    L     L EL +  NP +     R  V+   PQL  LD K+I+  +R +A Q
Sbjct:   23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIE-VIE-NLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVGNPCAEYHGYRQYVVATVPQLQSLDGKEISRAERIQALQ 160          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 187.193 bits (474), Expect = 1.211e-48
Identity = 124/237 (52.32%), Postives = 169/237 (71.31%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            V+RR  E+K  +PD++SL+RQNLT CPI+E EE LRLL   +N I +IQ+L  L+ LI LDLYDN IE ISGL +L+SLRVLMLG+NRI KI  LE+L  LDVLDLH N I  IEN++HL +LRVLNLA N I  + N+ GL SL E+N+R N +  + D+++   P+LQ ++LSFN++ RI+D  CL D  SL+++++D NPI+     R  ++ +  QL  LD K+ITE++R  A
Sbjct:  156 VIRRTAEEKAASPDKLSLERQNLTVCPIIEGEEQLRLLYLHHNSITRIQNLSSLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDT--LPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEERRTA 390          

HSP 2 Score: 80.1073 bits (196), Expect = 1.090e-14
Identity = 37/116 (31.90%), Postives = 70/116 (60.34%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENE 2270
            +FPNI  + F+  ++    Q + LA L+RL++L ++   NP+ +FTL +YYV+FRL    ++K ND E+T ++ + + + F  LA ++ +++ Q  L   + + RK++  H  E +
Sbjct:  541 KFPNISHLKFKETNLITLHQFDVLAQLRRLDQLTVDPQGNPVVNFTLWKYYVLFRLNSFNIQKINDSEVTQNDIVLSEKLFGILAYIASSELPQYRLHALLGEFRKKQFHHLLEGK 656          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 166.392 bits (420), Expect = 1.027e-42
Identity = 115/218 (52.75%), Postives = 154/218 (70.64%), Query Frame = 3
Query:  453 RQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            RQNLT CPI+E EE LRLL   +N I +IQ+L  L+ LI LDLYDN IE ISGL +L+SLRVLMLG+NRI KI  LE+L  LDVLDLH N I  IEN++HL +LRVLNLA N I  + N+ GL SL E+N+R N +  + D+++   P+LQ ++LSFN++ RI+D  CL D  SL+++++D NPI+     R  ++ +  QL  LD K+ITE++R  A
Sbjct:   88 RQNLTVCPIIEGEEQLRLLYLHHNSITRIQNLSSLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDT--LPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEERRTA 303          

HSP 2 Score: 74.3294 bits (181), Expect = 5.525e-13
Identity = 37/119 (31.09%), Postives = 71/119 (59.66%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVI 2279
            +FPNI  + F+  ++    Q + LA L+RL++L ++   NP+ +FTL +YYV+FRL    ++K ND E+T ++ + + + F  LA ++ +++ Q  L   + + R  ++L S  ++  I
Sbjct:  454 KFPNISHLKFKETNLITLHQFDVLAQLRRLDQLTVDPQGNPVVNFTLWKYYVLFRLNSFNIQKINDSEVTQNDIVLSEKLFGILAYIASSELPQYRLHALLGEFRFLKILTSIFDKSAI 572          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 166.777 bits (421), Expect = 1.375e-42
Identity = 115/218 (52.75%), Postives = 154/218 (70.64%), Query Frame = 3
Query:  453 RQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            RQNLT CPI+E EE LRLL   +N I +IQ+L  L+ LI LDLYDN IE ISGL +L+SLRVLMLG+NRI KI  LE+L  LDVLDLH N I  IEN++HL +LRVLNLA N I  + N+ GL SL E+N+R N +  + D+++   P+LQ ++LSFN++ RI+D  CL D  SL+++++D NPI+     R  ++ +  QL  LD K+ITE++R  A
Sbjct:   32 RQNLTVCPIIEGEEQLRLLYLHHNSITRIQNLSSLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDT--LPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEERRTA 247          

HSP 2 Score: 79.7221 bits (195), Expect = 1.082e-14
Identity = 37/116 (31.90%), Postives = 70/116 (60.34%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENE 2270
            +FPNI  + F+  ++    Q + LA L+RL++L ++   NP+ +FTL +YYV+FRL    ++K ND E+T ++ + + + F  LA ++ +++ Q  L   + + RK++  H  E +
Sbjct:  398 KFPNISHLKFKETNLITLHQFDVLAQLRRLDQLTVDPQGNPVVNFTLWKYYVLFRLNSFNIQKINDSEVTQNDIVLSEKLFGILAYIASSELPQYRLHALLGEFRKKQFHHLLEGK 513          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 166.777 bits (421), Expect = 3.042e-42
Identity = 115/218 (52.75%), Postives = 154/218 (70.64%), Query Frame = 3
Query:  453 RQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            RQNLT CPI+E EE LRLL   +N I +IQ+L  L+ LI LDLYDN IE ISGL +L+SLRVLMLG+NRI KI  LE+L  LDVLDLH N I  IEN++HL +LRVLNLA N I  + N+ GL SL E+N+R N +  + D+++   P+LQ ++LSFN++ RI+D  CL D  SL+++++D NPI+     R  ++ +  QL  LD K+ITE++R  A
Sbjct:   99 RQNLTVCPIIEGEEQLRLLYLHHNSITRIQNLSSLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDT--LPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEERRTA 314          

HSP 2 Score: 79.337 bits (194), Expect = 1.757e-14
Identity = 37/116 (31.90%), Postives = 70/116 (60.34%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENE 2270
            +FPNI  + F+  ++    Q + LA L+RL++L ++   NP+ +FTL +YYV+FRL    ++K ND E+T ++ + + + F  LA ++ +++ Q  L   + + RK++  H  E +
Sbjct:  465 KFPNISHLKFKETNLITLHQFDVLAQLRRLDQLTVDPQGNPVVNFTLWKYYVLFRLNSFNIQKINDSEVTQNDIVLSEKLFGILAYIASSELPQYRLHALLGEFRKKQFHHLLEGK 580          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 78.9518 bits (193), Expect = 1.865e-14
Identity = 37/116 (31.90%), Postives = 70/116 (60.34%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENE 2270
            +FPNI  + F+  ++    Q + LA L+RL++L ++   NP+ +FTL +YYV+FRL    ++K ND E+T ++ + + + F  LA ++ +++ Q  L   + + RK++  H  E +
Sbjct:  356 KFPNISHLKFKETNLITLHQFDVLAQLRRLDQLTVDPQGNPVVNFTLWKYYVLFRLNSFNIQKINDSEVTQNDIVLSEKLFGILAYIASSELPQYRLHALLGEFRKKQFHHLLEGK 471          

HSP 2 Score: 72.7886 bits (177), Expect = 1.842e-12
Identity = 65/110 (59.09%), Postives = 78/110 (70.91%), Query Frame = 3
Query:  453 RQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENI-NHLSDLRVLNL 779
            RQNLT CPI+E EE LRLL   +N I +IQ+L  L+ LI LDLYDN IE ISGL +L+SLRVLMLG+NRI KI  LE+L  LDVLDLH N     + I  H+  LR L++
Sbjct:   85 RQNLTVCPIIEGEEQLRLLYLHHNSITRIQNLSSLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQSWYRQTILGHMLQLRQLDM 194          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Mouse
Match: Lrrc49 (leucine rich repeat containing 49 [Source:MGI Symbol;Acc:MGI:2442689])

HSP 1 Score: 183.341 bits (464), Expect = 1.802e-50
Identity = 125/240 (52.08%), Postives = 173/240 (72.08%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQI 1115
            +++R  E+K    DR++L+RQ LT CPI++ EE+LRLLN+Q+N+I +IQ++  L++LI LDLYDN+IE ISGL TLKSLRVL+LG+NRI KI  LE+L  LDVLDLH N I  IEN+NHL DLRVLNLA N+++ + NL GL SL+E+N+R N +  V D++  N P LQR+FLSFN++      SCL +  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A  +
Sbjct:   80 ILQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRVASVV 317          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Mouse
Match: Lrrc49 (leucine rich repeat containing 49 [Source:MGI Symbol;Acc:MGI:2442689])

HSP 1 Score: 184.882 bits (468), Expect = 2.438e-48
Identity = 125/237 (52.74%), Postives = 172/237 (72.57%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR++L+RQ LT CPI++ EE+LRLLN+Q+N+I +IQ++  L++LI LDLYDN+IE ISGL TLKSLRVL+LG+NRI KI  LE+L  LDVLDLH N I  IEN+NHL DLRVLNLA N+++ + NL GL SL+E+N+R N +  V D++  N P LQR+FLSFN++      SCL +  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   80 ILQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRVA 314          

HSP 2 Score: 86.6557 bits (213), Expect = 6.973e-17
Identity = 40/120 (33.33%), Postives = 74/120 (61.67%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIP 2282
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  +I  + D RK++  +  E++   P
Sbjct:  464 KFPNSLHLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRMISILGDARKKQFRYLLESKGKKP 583          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Mouse
Match: Lrrc49 (leucine rich repeat containing 49 [Source:MGI Symbol;Acc:MGI:2442689])

HSP 1 Score: 184.882 bits (468), Expect = 2.508e-48
Identity = 125/237 (52.74%), Postives = 172/237 (72.57%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR++L+RQ LT CPI++ EE+LRLLN+Q+N+I +IQ++  L++LI LDLYDN+IE ISGL TLKSLRVL+LG+NRI KI  LE+L  LDVLDLH N I  IEN+NHL DLRVLNLA N+++ + NL GL SL+E+N+R N +  V D++  N P LQR+FLSFN++      SCL +  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   74 ILQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRVA 308          

HSP 2 Score: 86.6557 bits (213), Expect = 8.132e-17
Identity = 40/120 (33.33%), Postives = 74/120 (61.67%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIP 2282
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  +I  + D RK++  +  E++   P
Sbjct:  458 KFPNSLHLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRMISILGDARKKQFRYLLESKGKKP 577          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Mouse
Match: Lrrc49 (leucine rich repeat containing 49 [Source:MGI Symbol;Acc:MGI:2442689])

HSP 1 Score: 184.111 bits (466), Expect = 9.125e-48
Identity = 125/237 (52.74%), Postives = 172/237 (72.57%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR++L+RQ LT CPI++ EE+LRLLN+Q+N+I +IQ++  L++LI LDLYDN+IE ISGL TLKSLRVL+LG+NRI KI  LE+L  LDVLDLH N I  IEN+NHL DLRVLNLA N+++ + NL GL SL+E+N+R N +  V D++  N P LQR+FLSFN++      SCL +  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:  140 ILQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRVA 374          

HSP 2 Score: 87.0409 bits (214), Expect = 6.243e-17
Identity = 40/120 (33.33%), Postives = 74/120 (61.67%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIP 2282
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  +I  + D RK++  +  E++   P
Sbjct:  524 KFPNSLHLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRMISILGDARKKQFRYLLESKGKKP 643          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Mouse
Match: Lrrc49 (leucine rich repeat containing 49 [Source:MGI Symbol;Acc:MGI:2442689])

HSP 1 Score: 183.726 bits (465), Expect = 1.079e-47
Identity = 125/237 (52.74%), Postives = 172/237 (72.57%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR++L+RQ LT CPI++ EE+LRLLN+Q+N+I +IQ++  L++LI LDLYDN+IE ISGL TLKSLRVL+LG+NRI KI  LE+L  LDVLDLH N I  IEN+NHL DLRVLNLA N+++ + NL GL SL+E+N+R N +  V D++  N P LQR+FLSFN++      SCL +  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:  146 ILQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRVA 380          

HSP 2 Score: 87.0409 bits (214), Expect = 5.924e-17
Identity = 40/120 (33.33%), Postives = 74/120 (61.67%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIP 2282
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  +I  + D RK++  +  E++   P
Sbjct:  530 KFPNSLHLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRMISILGDARKKQFRYLLESKGKKP 649          
BLAST of Leucine rich repeat containing 49 vs. UniProt/SwissProt
Match: sp|Q91YK0|LRC49_MOUSE (Leucine-rich repeat-containing protein 49 OS=Mus musculus OX=10090 GN=Lrrc49 PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 2.210e-47
Identity = 125/237 (52.74%), Postives = 172/237 (72.57%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR++L+RQ LT CPI++ EE+LRLLN+Q+N+I +IQ++  L++LI LDLYDN+IE ISGL TLKSLRVL+LG+NRI KI  LE+L  LDVLDLH N I  IEN+NHL DLRVLNLA N+++ + NL GL SL+E+N+R N +  V D++  N P LQR+FLSFN++      SCL +  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   80 ILQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRVA 314          

HSP 2 Score: 86.6557 bits (213), Expect = 5.271e-16
Identity = 40/120 (33.33%), Postives = 74/120 (61.67%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIP 2282
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  +I  + D RK++  +  E++   P
Sbjct:  464 KFPNSLHLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRMISILGDARKKQFRYLLESKGKKP 583          
BLAST of Leucine rich repeat containing 49 vs. UniProt/SwissProt
Match: sp|Q8IUZ0|LRC49_HUMAN (Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=2 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 5.533e-46
Identity = 124/237 (52.32%), Postives = 168/237 (70.89%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            +++R  E+K    DR+SL+RQ LT CPI+  E++LRLLN+Q+N+I +IQ++  L+KLI LDLYDN+IE ISGL TL+ LRVL+LG+NRI KI  LE+L  LDVLDLH N I  IENINHL +LRVLNLA N ++ + NL GL SL+E+N+R N +  V D++  N P LQ +FLSFN++      SCL D  SL++++ D NPI+     +  V+ N  QL  LD K+ITE++R  A
Sbjct:   80 ILQRSSEEKILYSDRLSLERQKLTVCPIINGEDHLRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVD--NLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRMA 314          

HSP 2 Score: 89.3521 bits (220), Expect = 7.010e-17
Identity = 42/127 (33.07%), Postives = 77/127 (60.63%), Query Frame = 3
Query: 1923 RFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNAN 2303
            +FPN   + F+  ++    Q N+LA L+R+++L I+   NP+ +FTL +YYV+FRL+H  ++K N  E+T ++ + A R F  LA ++ +++ Q  LI  + D RK++  +  E++   P  ++  N
Sbjct:  464 KFPNSLHLKFKETNLVMLQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRLISILGDARKKQFRYLLESKGKKPGIINEEN 590          
BLAST of Leucine rich repeat containing 49 vs. UniProt/SwissProt
Match: sp|Q7ZV84|DAAF1_DANRE (Dynein assembly factor 1, axonemal OS=Danio rerio OX=7955 GN=dnaaf1 PE=2 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 9.983e-13
Identity = 60/174 (34.48%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  603 ISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINS-TNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSI----DNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAK 1109
            I GLE    LR L L  N I KIE LE+   L  L LH N I  +EN+  LS L  LN++ N I  + N+  L  LS + I  N + +V D+   ++CP++  + LS N   RISD + +  L  + +L +     N  I    + R  +I    QL  LD + +   DR  A+
Sbjct:   89 IEGLEEYTGLRCLWLECNGIRKIENLENQTELRCLFLHQNLIHTLENLEPLSKLCTLNVSNNYIKVIENISSLSDLSTLQISHNTLGNVCDMEELSHCPSISVLDLSHN---RISDPALVNILEKMPDLRVLNLMGNEVIKKIPNYRKTLIVRLKQLTYLDDRPVFPKDRACAE 259          

HSP 2 Score: 55.4546 bits (132), Expect = 2.296e-6
Identity = 43/125 (34.40%), Postives = 65/125 (52.00%), Query Frame = 3
Query:  636 VLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPIS 1010
             L L     S IEGLE    L  L L  N I+ IEN+ + ++LR L L  N+I  L NL  L  L  +N+  N ++ + +I+S +  +L  + +S N LG + D   L    S++ L + +N IS
Sbjct:   78 TLYLHFKGFSCIEGLEEYTGLRCLWLECNGIRKIENLENQTELRCLFLHQNLIHTLENLEPLSKLCTLNVSNNYIKVIENISSLS--DLSTLQISHNTLGNVCDMEELSHCPSISVLDLSHNRIS 200          
BLAST of Leucine rich repeat containing 49 vs. UniProt/SwissProt
Match: sp|Q8CDN9|LRRC9_MOUSE (Leucine-rich repeat-containing protein 9 OS=Mus musculus OX=10090 GN=Lrrc9 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 8.279e-12
Identity = 63/189 (33.33%), Postives = 95/189 (50.26%), Query Frame = 3
Query:  594 IERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESV---IDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDN-----NPISSNGSSRSAVIFNFPQLNLLDT-----KQITE-DDRNKAKQII 1118
            I  ISGLET   L+ L +    I KIEGL+    L+ L L+ N I  IEN+  L  L VL L  N+I  +  L+ L +L ++N+  N V S+   +D N      L+++ LS N +    D + L  L  L +L +++     NP+    +  + V+++ P L  LDT     KQI E  D    K+I+
Sbjct:   66 IREISGLETCLQLKELWIAECCIEKIEGLQGCRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPNE----QLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLDTFDVSAKQIKELADSTAMKKIM 250          

HSP 2 Score: 62.7734 bits (151), Expect = 1.906e-8
Identity = 54/168 (32.14%), Postives = 83/168 (49.40%), Query Frame = 3
Query:  621 LKSLRVLMLGRNRISKIEGLESLNRL---DVLDLHANSIQVIENINHLSDLRVLNLAGNVITCL--TNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAK 1109
            ++SL VL LG N I  +  L+ LNRL     L L  N I  +E +++L  L+ L +  N I     T      SL  +++  N +  +  + S     L+++FL +N +  I++   L  + SL EL++  NPI      R  +IF  P L +LD   I  DDR KA+
Sbjct: 1191 MQSLEVLHLGYNGICNLVQLQ-LNRLRNLKFLFLQGNEISQVEGLDNLIVLQELVVDHNRIRAFNDTAFSKPSSLLMLHLEENRLRELSKLQSL--VKLEKLFLGYNKIQDITELEKLDVIPSLRELTVYGNPICRKMVHRHVLIFRLPNLQMLDGIPINSDDRAKAE 1355          
BLAST of Leucine rich repeat containing 49 vs. UniProt/SwissProt
Match: sp|B3DH20|TILB_DANRE (Protein tilB homolog OS=Danio rerio OX=7955 GN=lrrc6 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.770e-11
Identity = 50/140 (35.71%), Postives = 75/140 (53.57%), Query Frame = 3
Query:  696 LDVLDLHANSIQVIENINHLS-DLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQ 1112
            L+ L LH   IQ IE+I+    DL++L L  N+I  + N+  L  L  +N+  N +E VI+ N   C +LQ++ L+ N +GR+S    L     L EL +  NP +     R  V+   PQL  LD K+I+  +R +A Q
Sbjct:   23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIE-VIE-NLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVGNPCAEYQGYRQYVVATVPQLQSLDGKEISRAERIQALQ 160          
BLAST of Leucine rich repeat containing 49 vs. TrEMBL
Match: A0A2C9JVG6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106069781 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.064e-73
Identity = 246/717 (34.31%), Postives = 381/717 (53.14%), Query Frame = 3
Query:  384 IPCV-VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIXXXXXXXXXXXXXXXHIQRFHSLKERQKGSLNNSQRIFEGWNQNGRNISPRLSIKCFSSSSNSLYGTELQNSVNSLNDNDTDSTAKSIRANKSMQDFNSNMPKEFMAIEETISKPSNNHSYLLSQQQNSHNKPDIELXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTVDSNETESVISNTISSESKVLTRNPIEIVNENELMQFYSLSALGIFEDKEFWAAKPALSTSVTILVXXXXXXXXXXXXXXXXXARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQI-LQLHLIGTINDIRKRELLHSTENEQVIPMTVHNANFAQVPSVNLDLVGRSGILTNFTPDPDAISEKKLKK-----LSLAMMREVLDNVRKRRDWEERFHSQWELAIWQFI 2513
            IP V VV R  E++  NPDR++LDR+ LT CPILE EE LRLLNYQ+N I  +Q+L  L++LI LDLYDN IE I+GL +L+SLRVLMLG+NRI KIE L+SL +LDVLDLH N I  IEN+ HL++LRVLNLAGN I  +  L GL SL+E+N+RRN + +V +I+    PNLQR+FLSFN +    D  CL +  SL+E+S D NPI+ +G+ +  ++ +  Q+ LLD K++TED+R +A  ++ + E                        ++   + +   LKE+++ ++NN++R +E    +  + + RL+    + S   L+ + L  S+ S++       + S  A+    D  S      +   E  S+P + HS L      S    +++  Q                             D+N+  +   NTI  E      N +E++ E + +  Y + +L  FE    W  + A   +V  +VF+ I+F  I K   +I+ RFP  + + F   +I    QIN+L+ ++RL+ L I+   NP++ FTL R Y VFRLA   L+K ND E++  + + A + F  L+ M+ N    +LH++ T    RK     ++EN++     V+      +   +++++GR+G++   T   DA  E + KK         + +E L N RKR +          L IW +I
Sbjct:   18 IPGVPVVYRTLEERASNPDRLNLDRRKLTMCPILEGEEQLRLLNYQHNLITHMQNLSSLKRLIFLDLYDNHIEEITGLSSLRSLRVLMLGKNRIKKIENLDSLIKLDVLDLHGNQITKIENLRHLTELRVLNLAGNNIGYVDELAGLDSLAELNLRRNRIRAVTEIDL--LPNLQRLFLSFNDITSFEDVQCLGESSSLSEISFDGNPIAQDGNYKQIILRHMHQIKLLDMKRVTEDERRQALVLVKKDE------------------------EKRREMNKIAMLKEKRRLAINNAKRQWETMQGSMMSRTSRLA--KLNGSMPELFASHL-GSIPSMD------VSGSTTADPDGLDIES------LTSGELGSRPGSAHSNLFEASHESSRNTNVKRFQPR---------------------------DTNKESNSNQNTIIDEG----LNMLELI-EGDTLSLYGIQSLDAFERN--WGYQSA--GAVNTIVFKFIDFDAIVKYLPKIRVRFPATQSLVFCSTNIHSLQQINALSLVRRLDNLTIDLDGNPVTKFTLWRMYTVFRLAQFALKKINDIEVSSADIVNAEKLFGLLSQMASNMPQYRLHVL-TAEAQRK----ITSENKK-----VNETGKGNLDKSHMEMIGRAGLVYTVT---DAKQELEAKKKFAHNFVSEISKESLFNERKRTEL---------LKIWPYI 635          
BLAST of Leucine rich repeat containing 49 vs. TrEMBL
Match: A0A2T7NG90 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_20671 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 2.807e-63
Identity = 225/640 (35.16%), Postives = 333/640 (52.03%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIE----------GLESLN------RLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIXXXXXXXXXXXXXXXHIQRFHSLKERQKGSLNNSQRIFEGWNQNGRNISPRLSIKCFSSSSNSLYGTELQNSVNSLNDNDTDSTAKSIRANKSMQDFNSNMPKEFMAIEETISKPSNNHSYLLSQQQNSHNKPDIELXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTVDSNETESVISNTI--SSESKVLTRNPIEIVN-ENELMQFYSLSALGIFEDKEFWAAKPALSTSVTILVXXXXXXXXXXXXXXXXXARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHS 2258
            VV R  E++  NPDR++LDR+ LT CP+LE E+ LRLLNYQ+N I +IQHL  LR+LI LDLYDN+IE+I+GL +L+SLRVLMLG+NR   +E           L  L       +LDVLDLH N I  IEN++HLS+LRVLNLAGN I  + +L GL +L+E+N+RRN + +V D++S   PNLQR+FLSFN +    D  CL D  SL+E+ +D NPI  + S +  V+ +  QL  LD +++TE++R        RL L                       ++   + +   LKER++ ++NN++R +E     G  IS   S      +   LY     N V SL        +  I A  S Q       +E + +     +P + HS L    Q SH++ +                              +  +  N+T+S    T+   SE      N   +   E + +  Y   ALG F+    W  + A   ++T +VF+ I+F EI K  H++++RFP+ + + F   +I    QIN+L+ ++ L+ L I    NP++ FTL R Y +FRLAH  L+K ND E++  + + A R F +L+ +  +Q  Q  L   + D RK+ L H 
Sbjct:  126 VVYRTPEERATNPDRLNLDRRKLTVCPMLEGEDQLRLLNYQHNSITRIQHLSALRRLIFLDLYDNQIEQITGLTSLRSLRVLMLGKNRPLLVELGAFFILLTAELRRLKIWIRFLKLDVLDLHGNQISTIENLSHLSELRVLNLAGNQIVLVDSLSGLDALAELNLRRNKIRAVADVDS--LPNLQRLFLSFNEISNFEDVQCLGDSSSLSEICLDGNPICQDPSYKQVVLRHMQQLKQLDMRRVTEEER--------RLAL----------------VMARKEEERRRELNKVAVLKERRRLAINNAKRQWE--TMQGSLIS-NTSKMAKGPAVRELYA----NHVGSL------PISGDIFACHSAQ------YEESLGVTSE-KRPGSAHSSLTDLSQESHHEGE----------------------------RPRTALRRNDTKSAPKETVIFGSEGGGSAENLNMVAELEGDTLTLYGPLALGAFDRN--WGLQAA--GAITSIVFRFIDFDEITKQLHKVRSRFPSTQSLEFTNTNIHSLQQINALSVVRSLDHLTIALDGNPVTKFTLWRLYTIFRLAHFSLKKINDVEVSGADVINAERLFGSLSLIVTSQFSQQRLDTPVGDGRKKHLTHG 687          
BLAST of Leucine rich repeat containing 49 vs. TrEMBL
Match: A0A1I8HU99 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.424e-54
Identity = 137/253 (54.15%), Postives = 185/253 (73.12%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSG 1154
            V+ R  E++  NPDR+SLDR+ LTSCP+LE EENLRLLNYQ+N I +IQHL   RKLI LDLYDN+I+ ISGL++L+SLRVLMLG+NRIS+I GLESL +LDVLDLH N I  +EN+NHLS+LRVLNLA N I  + NLRG+ +L+E+N+RRN + +V DI S   P+LQR+FLSFN +   ++ +CL +  SL EL++D  P+S   + R+ VI   P L  LD ++++E++R     ++ R E  + S  G
Sbjct:   69 VIYRSPEERAANPDRLSLDRRGLTSCPLLEGEENLRLLNYQHNSIQRIQHLAAFRKLIFLDLYDNQIDEISGLDSLRSLRVLMLGKNRISRIRGLESLTKLDVLDLHGNDIVELENVNHLSELRVLNLASNCIQVVRNLRGMAALTELNLRRNQIHTVHDIGS--LPSLQRLFLSFNGIQSWTNVACLGESPSLAELTMDGTPLSKQANYRNQVISGMPLLRQLDLRRVSEEERRLVAALV-RKEAAASSTGG 318          
BLAST of Leucine rich repeat containing 49 vs. TrEMBL
Match: A0A1I8GKG3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 4.806e-53
Identity = 136/257 (52.92%), Postives = 188/257 (73.15%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKS--NSGLS 1160
            V+ R  E++  NPDR+SLDR+ LTSCP+LE EENLRLLNYQ+N I +IQHL   RKLI LDLYDN+I+ ISGL++L+SLRVLMLG+NRIS+I GLESL +LDVLDLH N I  +EN+NHLS+LRVLNLA N I  + NL G+ +L+E+N+RRN + +V D++S   P+LQR+FLSFN +   ++ +CL +  SL EL++D  P+S   + R+ VI   P L  LD ++++E++R     ++ +    S +  NSGL+
Sbjct:   69 VIYRSPEERAANPDRLSLDRRGLTSCPLLEGEENLRLLNYQHNSIQRIQHLAAFRKLIFLDLYDNQIDEISGLDSLRSLRVLMLGKNRISQIRGLESLTKLDVLDLHGNDIVELENVNHLSELRVLNLASNCIQVVRNLLGMAALTELNLRRNQIHTVHDVDS--LPSLQRLFLSFNGIQSWANVACLGESPSLAELTMDGTPLSKQANYRNQVISGMPLLRQLDLRRVSEEERRLVAALVRKEASASSAGGNSGLA 323          
BLAST of Leucine rich repeat containing 49 vs. TrEMBL
Match: A0A1I8IRL9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.599e-52
Identity = 135/253 (53.36%), Postives = 185/253 (73.12%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSG 1154
            V+ R  E++  NPDR+SLDR+ LTSCP+LE EENLRLLNYQ+N I +IQHL   RKLI LDLYDN+I+ ISGL++L+SLRVLMLG+NRIS+I GLESL +LDVLDLH N I  +EN+NHLS+LRVLNLA N I  + NL G+ +L+E+N+RRN + +V D++S   P+LQR+FLSFN +   ++ +CL +  SL EL++D  P+S   + R+ VI   P L  LD ++++E++R     ++ R E  + S  G
Sbjct:   69 VIYRSPEERAANPDRLSLDRRGLTSCPLLEGEENLRLLNYQHNSIQRIQHLAAFRKLIFLDLYDNQIDEISGLDSLRSLRVLMLGKNRISQIRGLESLTKLDVLDLHGNDIVELENVNHLSELRVLNLASNCIQVVRNLLGMAALTELNLRRNQIHTVHDVDS--LPSLQRLFLSFNGIQSWANVACLGESPSLAELTMDGTPLSKQANYRNQVISGMPLLRQLDLRRVSEEERRLVAALV-RKEASASSAGG 318          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Cavefish
Match: ENSAMXT00000021515.2 (leucine rich repeat containing 49 [Source:NCBI gene;Acc:103024138])

HSP 1 Score: 157.532 bits (397), Expect = 4.189e-39
Identity = 85/183 (46.45%), Postives = 125/183 (68.31%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLE 1130
            YDNR+  +S + +L +LRVLMLG+NRI +I GL++L +LDVLDLH N I  +EN++HLS+LRVLNLAGN I  + NL GL SL+E+N+R N + SV +++  +C  LQR+FLS N +    + +CL    SL EL++D NP++     + A +     L LLD K+IT+++R +A  ++ R E
Sbjct:  219 YDNRLTDMSAISSLSALRVLMLGKNRIQRICGLDNLTKLDVLDLHNNQISKMENLSHLSELRVLNLAGNCICRVENLHGLDSLTELNLRYNHISSVTEVDLLSC--LQRLFLSSNSISSFDELACLGLSCSLCELTLDGNPVAQESCYKQAALRCVLPLRLLDMKRITDEER-RAVSLVARKE 398          

HSP 2 Score: 67.3958 bits (163), Expect = 5.148e-11
Identity = 48/163 (29.45%), Postives = 89/163 (54.60%), Query Frame = 3
Query: 1761 ENELMQFYSLSALGIFEDKEFWAAKPALSTSVTILVXXXXXXXXXXXXXXXXXARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKREL 2249
            + E ++ +   AL   E    W  + A  ++VT + F+ I+F  I     +I+ +FPN+  + F   +I    Q+ +LA ++RLE++ I    NP+ S TL R ++++RL HL L+K N  E+T ++ + + R F  L  ++  +  +  L+  + + RKR+L
Sbjct:  528 DGETVRLFGPGALEALE--RGWGVQTA--SAVTTITFRYIQFDSIVPTLPRIRLKFPNLVHLIFMETNITRLLQLAALAQVRRLEQVTIHPEGNPVVSLTLWRAFLIYRLNHLSLQKINGTEVTLNDVMASERLFGTLGHVASTETPRCRLLLLLEESRKRQL 686          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 71.2478 bits (173), Expect = 1.313e-12
Identity = 53/182 (29.12%), Postives = 90/182 (49.45%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESV-----------IDI---------NSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDT 1073
            N+I  I+ LE L SL +L LG NRI  IE L++L  LD L L  N I  ++N++ L +L VL++  N IT L  L+ + +L E+ +  N +E +           +DI         N ++  +LQ  +++ N +   SD   L +   L  + ++ NP+  +   R  ++   P +  +D 
Sbjct:  160 NKISSIANLEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA 341          

HSP 2 Score: 67.0106 bits (162), Expect = 2.836e-11
Identity = 45/121 (37.19%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDF 950
            N + +I GLE L  ++ L L  N+IS I  LE L  L +L+L +N I++IEN++ L+ L  L L  N IT L NL GL++L+ ++I+ N +  +  +   N  NL+ ++LS N +  I   
Sbjct:  138 NLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQ--NMVNLRELYLSHNGIEVIEGL 256          

HSP 3 Score: 59.3066 bits (142), Expect = 7.713e-9
Identity = 43/129 (33.33%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  591 RIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSL 977
            RI +I GLE L+  + L L +N I KIE LESL+ L  LDL+ N I+ +EN+  L++L  L+++ N++  +  L  L  + ++ +  N + S+   N  +  +L  + L  N +  I +   L  L SL
Sbjct:   73 RIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSI--ANLEHLTSLHMLELGSNRIRIIENLDALTSLDSL 199          

HSP 4 Score: 56.6102 bits (135), Expect = 5.685e-8
Identity = 47/141 (33.33%), Postives = 79/141 (56.03%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPIS 1010
            N I++I  LE+L SLR L L  N+I K+E L++L  L+ LD+  N ++ IE +  L+ ++ L L  N I+ + NL  L SL  + +  N +  + ++++    +L  +FL  N   +I+    L  L +L  LSI +N I+
Sbjct:   94 NLIKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIENLDA--LTSLDSLFLGTN---KITKLQNLDGLHNLTVLSIQSNRIT 229          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Cavefish
Match: dnaaf1 (dynein axonemal assembly factor 1 [Source:NCBI gene;Acc:103025595])

HSP 1 Score: 70.8626 bits (172), Expect = 4.246e-12
Identity = 56/171 (32.75%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  603 ISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTN-CPNLQRIFLSFNHLGRISDFSCLIDLGSLNELS-IDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAK 1109
            I GLE    LR L L  N I KIE L++   L  L LH N I  +EN++ L+ L  LN++ N I  + NL  L  L+ + I  N +E+  D+     CP++  + LS N L      S L  +  L  L  + N  I    + R ++I    QL  LD + +   +R  A+
Sbjct:   88 IEGLEEYTGLRSLWLQCNGIKKIENLQNQTELRCLYLHQNLIHTLENLHPLTMLSTLNVSNNRIRVIQNLACLSQLTTLQISHNALETAQDLMELRLCPSISVLDLSHNRLSDPQIVSILEQMPDLRVLYLVGNEVIKKIPNYRKSLIIRLKQLTYLDDRPVFPRERACAE 258          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 68.1662 bits (165), Expect = 3.714e-11
Identity = 55/172 (31.98%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  594 IERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESV---IDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDN-----NPISSNGSSRSAVIFNFPQLNLLDTKQIT 1085
            I +I GLE   SLR L +   +I +I GLE   +L  L L+ N+I  I ++  L++L+VL L  N+I+ +  L  L +L E+N+  N +ES+   +D N+    NLQ++ LS N +    + + L  L  L EL + +     NP+    +  + ++++ P L  LD+  +T
Sbjct:   69 ITQIQGLENCPSLRELWVVECQIEEISGLEKCLQLLKLFLYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLRELNLADNLIESIGNSLDQNT----NLQKLNLSGNKISSFKELTHLTRLSKLRELGLKDPQSRPNPVCMLCNYFTHILYHVPTLQRLDSYDVT 236          

HSP 2 Score: 54.299 bits (129), Expect = 6.618e-7
Identity = 39/87 (44.83%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIEN-INHLSDLRVLNLAGNVITCLTNLRGLYSLSEV 839
            YDN I +IS LE L +L+VL L  N IS+IEGL  L  L  L+L  N I+ I N ++  ++L+ LNL+GN I+    L  L  LS++
Sbjct:  109 YDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLRELNLADNLIESIGNSLDQNTNLQKLNLSGNKISSFKELTHLTRLSKL 195          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 68.1662 bits (165), Expect = 4.058e-11
Identity = 55/172 (31.98%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  594 IERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESV---IDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDN-----NPISSNGSSRSAVIFNFPQLNLLDTKQIT 1085
            I +I GLE   SLR L +   +I +I GLE   +L  L L+ N+I  I ++  L++L+VL L  N+I+ +  L  L +L E+N+  N +ES+   +D N+    NLQ++ LS N +    + + L  L  L EL + +     NP+    +  + ++++ P L  LD+  +T
Sbjct:   69 ITQIQGLENCPSLRELWVVECQIEEISGLEKCLQLLKLFLYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLRELNLADNLIESIGNSLDQNT----NLQKLNLSGNKISSFKELTHLTRLSKLRELGLKDPQSRPNPVCMLCNYFTHILYHVPTLQRLDSYDVT 236          

HSP 2 Score: 54.299 bits (129), Expect = 7.345e-7
Identity = 39/87 (44.83%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIEN-INHLSDLRVLNLAGNVITCLTNLRGLYSLSEV 839
            YDN I +IS LE L +L+VL L  N IS+IEGL  L  L  L+L  N I+ I N ++  ++L+ LNL+GN I+    L  L  LS++
Sbjct:  109 YDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLRELNLADNLIESIGNSLDQNTNLQKLNLSGNKISSFKELTHLTRLSKL 195          

HSP 3 Score: 53.9138 bits (128), Expect = 9.879e-7
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = 3
Query:  621 LKSLRVLMLGRNRISKIEGLE--SLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLT--NLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAK 1109
            + SL VL LG N IS +  L+   L  L  L L  N +  +E +  L  L+ L L  N + C++  +     +L E+++  N +  +  +++ +   L+ + L  N +  +S+   L  L SL +LS+  NP++     R  V+   P L +LD   IT D+R +A+
Sbjct: 1200 MASLEVLHLGYNGISNLSELQLSRLTNLKSLFLQGNEMVQVEGLEGLRRLQELVLDRNRLRCVSANSFSAQAALLELHMSDNRLRDLSHLHTLS--QLRSLHLDNNKVQDLSELEKLDALPSLIKLSVLGNPVARRCLHRPVVVLRLPGLQVLDGISITLDERTRAE 1364          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 185.652 bits (470), Expect = 9.898e-50
Identity = 123/252 (48.81%), Postives = 176/252 (69.84%), Query Frame = 3
Query:  378 SIIPCV-VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLE 1130
            S  P + +V R  E++  NP+R++LD + +T CPIL+ EE+LRLL+ Q+N I + QHL  LR+L+ LDLY N +E ISGL  L+SLRVLMLG+NRI KI  LESL +LDVLDLH N I  IEN++HLS+LRVLNLAGN IT + +LRGL+SL+E+N+RRN + S+ +++    P+LQR+FLS+N++       CL +  SL E+++D NP++     R   + +  QL  LD K++TE++R  A  +  + E
Sbjct:   13 STAPGIPIVYRTVEERAYNPERLNLDSRGMTMCPILDGEEDLRLLSLQHNLIRRAQHLSHLRRLVFLDLYANELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHVDSLRGLHSLAELNLRRNNISSMKEVDC--LPSLQRLFLSYNNIANFDGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLRQLDMKRVTEEERRLASLLARKQE 262          

HSP 2 Score: 67.781 bits (164), Expect = 8.494e-12
Identity = 35/109 (32.11%), Postives = 59/109 (54.13%), Query Frame = 3
Query: 1920 ARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRE 2246
            ARFP    + F   +++   Q+N+LA L+R+E+L +    N +++ +L   Y  FRL HLGLR+ N +EI+  +   A   F +LA ++  +         + D RK+E
Sbjct:  402 ARFPGTAHLQFTETNLQNLQQLNALAQLRRIEQLTVNPAGNSLTALSLWTAYATFRLHHLGLRRINGQEISATDVTAAEAMFGSLARLTAPRA----STSALGDGRKKE 506          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Sea Lamprey
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 70.8626 bits (172), Expect = 9.241e-13
Identity = 57/186 (30.65%), Postives = 97/186 (52.15%), Query Frame = 3
Query:  585 DNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSS------RSAVIFNFPQLNLLDTKQITEDDRNKAKQIINR 1124
            +N + R+ G+  L SL+ L L RN I  IEGL+ L  L  L+L  NSI+ IE++N  + L  ++L+ N I+ L ++  L +L  + +  N V S+    +   P L  + L+ N +  +++ S L  L SL +LS+  NP   +  S      R  V+     L +LD   +T+ +  KA+ + ++
Sbjct:   66 ENSLVRMGGVARLSSLKQLNLPRNSIPAIEGLKDLCHLQWLNLAGNSIKTIEHLNGCTSLTYVDLSDNNISHLGDMSKLSNLRTLLLHGNMVTSLRTAPTHLPPQLGILSLAENEITDLTEMSHLSCLRSLEQLSVMKNPCMLSAPSAPACDHRPYVLSWCLTLRVLDGHVVTQKESLKAEWLYSQ 251          

HSP 2 Score: 53.1434 bits (126), Expect = 2.355e-7
Identity = 46/161 (28.57%), Postives = 79/161 (49.07%), Query Frame = 3
Query:  585 DNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLL 1067
            D  + R+S +        L+L  N ++K++G+ES   L  L    NS+  +  +  LS L+ LNL  N I  +  L+ L  L  +N+  N ++++  +N   C +L  + LS N++  + D S    L +L  L +  N ++   S R+A     PQL +L
Sbjct:   22 DRGLVRLSAVSLPTDACTLVLDSNNLAKLDGVESCRHLMQLSAAENSLVRMGGVARLSSLKQLNLPRNSIPAIEGLKDLCHLQWLNLAGNSIKTIEHLN--GCTSLTYVDLSDNNISHLGDMS---KLSNLRTLLLHGNMVT---SLRTAPTHLPPQLGIL 174          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 68.5514 bits (166), Expect = 1.765e-12
Identity = 47/121 (38.84%), Postives = 73/121 (60.33%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDF 950
            N + +I GL+TL+ +R L L  N+I+KIE L SL  L +L++ +N I+VIENI  L +L  L +  N IT L NL  L +L+ ++I+ N +  +  ++S    NLQ ++LS N +  I   
Sbjct:  132 NVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSS--LVNLQELYLSHNGIEVIEGL 250          

HSP 2 Score: 66.6254 bits (161), Expect = 7.074e-12
Identity = 45/132 (34.09%), Postives = 79/132 (59.85%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSL 977
            YDN +++I  L+TL +L +L +  N + KIEGL++L ++  L L +N I  IEN+N L++LR+L +A N I  + N+  L +L  + I +N +  + +++S    NL  + +  N + +I   S L++L  L
Sbjct:  108 YDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDS--LTNLTVLSIQSNRITKIEGLSSLVNLQEL 237          

HSP 3 Score: 63.5438 bits (153), Expect = 7.310e-11
Identity = 48/185 (25.95%), Postives = 88/185 (47.57%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESV-----------IDI---------NSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQI 1082
            N+I +I  L +L  LR+L +  NRI  IE +E+L  LD L +  N I  ++N++ L++L VL++  N IT +  L  L +L E+ +  N +E +           +DI         N  +   LQ  +++ N +   +D   L +   L  + ++ NP+  +   R  ++   P +  +D   +
Sbjct:  154 NKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVDELKNARGLQTVYLERNPLQRDPQYRRKIMLALPWVRQIDATYV 338          

HSP 4 Score: 56.6102 bits (135), Expect = 1.099e-8
Identity = 46/141 (32.62%), Postives = 76/141 (53.90%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPIS 1010
            N I +I  LE+L +LR L L  N + KIE L++L  L++LD+  N ++ IE ++ L  +R L L  N IT + NL  L  L  + +  N +  + +I +    NL  +F+  N + ++ +   L +L     LSI +N I+
Sbjct:   88 NMIAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIET--LKNLDSLFIGKNKITKLQNLDSLTNLTV---LSIQSNRIT 223          

HSP 5 Score: 55.8398 bits (133), Expect = 2.101e-8
Identity = 42/129 (32.56%), Postives = 75/129 (58.14%), Query Frame = 3
Query:  591 RIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSL 977
            RI +I  LE L  ++VL L +N I++IE LESL  L  LDL+ N ++ IEN++ L +L +L+++ NV+  +  L  L  + ++ +  N +  + ++NS     L+ + ++ N +  I +   L +L SL
Sbjct:   67 RIGKIERLEILMKVKVLCLRQNMIAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNS--LTELRMLEVASNRIRVIENIETLKNLDSL 193          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005086.1 (pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-1 gene:ENSPMAG00000004613.1 transcript:ENSPMAT00000005086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 8.203e-11
Identity = 52/169 (30.77%), Postives = 86/169 (50.89%), Query Frame = 3
Query:  603 ISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPN--LQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGS------SRSAVIFNFPQLNLLDTKQIT 1085
            I GL   + LR L +  + ++ I+GLE    L  L L++N+I  IE +  L  L VL L  N I  + NL  L  L E+N+  N +E ++    +   N  L+R+ LS N +    + + L  L +L ELS+  +P+ +  S        + ++++ PQL  LDT  ++
Sbjct:   61 IEGLHGCRLLRELWIAESHVTVIKGLEPCRELRKLYLYSNNIARIEGLESLPLLEVLWLNNNCIAAIENLHCLQHLKELNLADNQIEFIVSKGHSLDSNLELERLNLSGNKISCFKELTHLSRLPALTELSL-QDPLYAPCSVSLLCNYATHLLYHLPQLRRLDTIDVS 228          

HSP 2 Score: 55.8398 bits (133), Expect = 3.260e-8
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSD----LRVLNLAGNVITC---LTNLRGLYSLSEVNIR 848
            Y N I RI GLE+L  L VL L  N I+ IE L  L  L  L+L  N I+ I +  H  D    L  LNL+GN I+C   LT+L  L +L+E++++
Sbjct:   98 YSNNIARIEGLESLPLLEVLWLNNNCIAAIENLHCLQHLKELNLADNQIEFIVSKGHSLDSNLELERLNLSGNKISCFKELTHLSRLPALTELSLQ 193          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Sea Lamprey
Match: ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:NCBI gene;Acc:431749])

HSP 1 Score: 61.6178 bits (148), Expect = 9.153e-11
Identity = 54/184 (29.35%), Postives = 82/184 (44.57%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVIT----------CLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFS-CLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRN 1100
            YDNR+ R+  L     L  L L  N + ++EGL +L  L  L L  NSI V+E +  LS+L  L+L    +           CL+ L G  SL  +N+  N +E + ++  T   ++ +     N L  + D +  L     +  L +  NP       R  VI     L++LD K+I E  R 
Sbjct:   15 YDNRLSRMPNLAFASHLTHLYLQNNALERMEGLATLRHLSKLYLGGNSISVVEGVEMLSELTELHLENQHLPPGEKLLFDPRCLSTLAG--SLCVLNVSGNGLEELQEL--TCLSHMMQFMACENQLTDLQDLADVLTCWPKVWRLELLGNPFCQKPKYRDRVIMMSASLDILDGKEIKESARQ 194          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Yeast
Match: SDS22 (Regulatory subunit of the type 1 protein phosphatase (PP1) Glc7p; whether it functions as a positive or negative regulator of Glc7p is controversial; involved in the regulation of Glc7p nuclear localization and function [Source:SGD;Acc:S000001676])

HSP 1 Score: 50.0618 bits (118), Expect = 9.736e-7
Identity = 41/123 (33.33%), Postives = 67/123 (54.47%), Query Frame = 3
Query:  582 YDNRIERISG-LETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLT--NLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRI 941
            YDN+I+ IS  +  L  L  L L  N+I  I+ LE+L  L+ L    NSI  IEN++ L  L+ L L GN +  +   +  GL +L E+ + +N +  +I+++     NL+ + +  N L +I
Sbjct:   98 YDNKIKHISSNVNKLTKLTSLDLSFNKIKHIKNLENLTDLENLYFVQNSISKIENLSTLKSLKNLELGGNKVHSIEPDSFEGLSNLEEIWLGKNSIPRLINLHP--LKNLKILSIQSNKLKKI 218          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Nematostella
Match: EDO45771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA0])

HSP 1 Score: 189.504 bits (480), Expect = 7.068e-51
Identity = 141/297 (47.47%), Postives = 198/297 (66.67%), Query Frame = 3
Query:  396 VVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIXXXXXXXXXXXXXXXHIQRFHSLKERQKGSLNNSQRIFE 1286
            +V R  E++Q NPDR++LDR+ LT CPILE E+NLRLLN+Q+N I  IQHL  LR+LI LD+YDN+IE ISGL +LKSLRVLMLG+NRI KI  LE+L +LDVLDLH N I  IEN++HL++LRVLNLAGN I  + N+ G+ SL+E+N+RRN + +V +++  +  NLQR+FLSFN + R  D +CL    S+ ELS+D NP +S+ + +  V+ +   L  LD K+ITE++R  A  ++ R E   K                         + +   LKE+++ ++NN+QR +E
Sbjct:   17 IVYRLPEERQANPDRLNLDRRRLTVCPILEGEDNLRLLNFQHNLIRNIQHLANLRRLIFLDIYDNQIEEISGLSSLKSLRVLMLGKNRIRKINNLEALTKLDVLDLHGNRISKIENLSHLTELRVLNLAGNEILKVCNISGMRSLAELNLRRNKICTVEEVDRLS--NLQRLFLSFNCISRFEDINCLTRSTSITELSLDGNPFASDVTYKQTVLKSVTCLRQLDMKRITEEERRIA-MVMARKEEEKKKE-----------------------VNKLAVLKEKRRIAINNAQRQWE 287          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 72.0182 bits (175), Expect = 1.458e-13
Identity = 55/182 (30.22%), Postives = 87/182 (47.80%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESV-----------IDI---------NSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDT 1073
            N+I RI GLE L  L ++ LG N+I  +EGLE L +L+ L +  N I  ++N++ L  L+VL++  N I  L  L  L SL E+ I  N +E +           +D+         N  +  NL+  + + N L    D   L     L+ + ++ NP+S + + R  V    P L  +D 
Sbjct:  125 NKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDA 306          

HSP 2 Score: 67.0106 bits (162), Expect = 7.285e-12
Identity = 46/132 (34.85%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINST-NCPNLQRIFLSFNHLGRISDFSCLIDLGSLN 980
            N I+ I  L +L  L  L L +N+I +IEGLE L  L +++L AN I+V+E + HL+ L  L +  N IT L NL GL SL  ++I+ N    ++++    +  +L+ +++S N +  I     L  L +L+
Sbjct:  103 NVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSN---RIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLD 231          

HSP 3 Score: 63.5438 bits (153), Expect = 9.705e-11
Identity = 51/156 (32.69%), Postives = 80/156 (51.28%), Query Frame = 3
Query:  591 RIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCV------ESVIDINSTNC-PNLQRIFLSFNHLG----------RISDFSCLIDLGSLNELSIDNNPI 1007
            RI++I   E L+ ++ L L RN I K+E LE+L  L+ LD + N I  IEN++ L +LR+L+L+ NVI  + NL  L  L ++ + +N +      E + ++       N  R+     HL           +I++   L  L SL  LSI +N I
Sbjct:   38 RIDKIQNFERLRCVKSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRI 193          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Nematostella
Match: EDO35299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU3])

HSP 1 Score: 68.9366 bits (167), Expect = 2.081e-12
Identity = 57/169 (33.73%), Postives = 87/169 (51.48%), Query Frame = 3
Query:  585 DNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINS--TNCPNLQRIFLSFNHLGRISDF-SCLIDLGSLNELSI----DNNPISSNGSSRSAVIFNFPQLNLLD 1070
            D++I  I  L+   +L  L L  N ISKIEGL+ L  L  LDL +N I  IE +  L  LRVLNL+ N I  +  L  L  L+++++  N +E+V  +     N  +L  ++L  N +  +  F S +I   SL EL++    + N + +    R  V+   P L +LD
Sbjct:   21 DSQITSIKSLKLHSNLVTLNLHSNHISKIEGLQHLQNLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLDLSYNFIENVSGLKDLHGNGYSLTTLYLHGNRIASLEHFISSVIGCISLKELTLQMYGEGNHVCNVSGYRDGVLSAMPGLAVLD 189          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Nematostella
Match: EDO31770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ7])

HSP 1 Score: 68.1662 bits (165), Expect = 8.772e-12
Identity = 58/192 (30.21%), Postives = 93/192 (48.44%), Query Frame = 3
Query:  585 DNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDN-----NPISSNGSSRSAVIFNFPQLNLLDT--------KQITEDDRNKAKQIIN 1121
            ++ ++ +SG++   +L+ +    N ISKIE L SL RL VL L+ N+IQ IE +  L+ L  LNLA N IT + +           ++RN    V+D             LS N +G   D + L+ L  L  LS+ +     NP+S   +  + ++F+ P+L  LD+        K++ E   +K K   N
Sbjct:  116 ESSLKELSGIDKCTNLKKVYFYDNHISKIENLSSLTRLTVLWLNNNNIQAIEGLESLAQLTDLNLASNKITSIGD----------TLQRNTHLEVLD-------------LSANRIGSFKDLTNLVHLPHLKSLSLKDPTYGPNPVSLLCNYATHLLFHLPKLTRLDSYDVDNKALKELAEATVSKKKMYYN 284          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Nematostella
Match: EDO31771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ8])

HSP 1 Score: 67.3958 bits (163), Expect = 2.463e-11
Identity = 54/172 (31.40%), Postives = 87/172 (50.58%), Query Frame = 3
Query:  618 TLKSLRVLMLGRNRISKIEGLE--SLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGL--YSLSEVNIRRNCVESVIDINSTNCPNLQ---RIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQ 1112
             L +L VL LG N I  I GL+   L  L  L L  N I  ++ +  L DLR L L  N I C++    +  ++L E++I  N ++ +     +N  +LQ   R++L  N +  +S F  L  L +L ELS+ NN ++     R  ++F  P L  +D   ++ D+R K++ 
Sbjct:  717 VLTNLEVLHLGYNSIPSISGLQLSRLPNLKALFLQGNEITKVDGLEGLQDLRELVLDRNKIKCISEYSFINQWNLIELHIEENRLKDL-----SNLDHLQYQVRLYLGMNRIQDLSQFEKLESLSNLIELSVINNAVTRRLLHRPMLVFRMPSLLCIDGIPVSSDERTKSEM 883          

HSP 2 Score: 58.9214 bits (141), Expect = 8.564e-9
Identity = 53/175 (30.29%), Postives = 83/175 (47.43%), Query Frame = 3
Query:  594 IERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTN--LRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSS-RSAVIFNFPQLNLLDTKQITEDDRNKAK 1109
            + ++S LE L  LR      N ++KIEG ES + L+ L L  N I   E +     L+ LNL+ N +T L    L  L  L  +++  N +  +  +   +   LQ ++L  NHL  I +   L  +  L  L +  NP+  N ++ R  VIF+   L  LD   +  ++ N AK
Sbjct:  430 LGKLSNLEKLVHLRWASFNNNDLTKIEGFESCSSLEELSLEGNCISKFEGLVRNPKLKWLNLSSNNLTILDTGMLERLPELRYLSLENNNITCLKGLQ--HAVELQELYLGNNHLANIREIFSLKPIPMLVILDLYGNPLVENTANYRLFVIFHLTTLKALDGLAVEPNEGNVAK 602          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Medaka
Match: ENSORLT00000027909.1 (leucine rich repeat containing 49 [Source:NCBI gene;Acc:105358210])

HSP 1 Score: 116.701 bits (291), Expect = 1.180e-28
Identity = 60/97 (61.86%), Postives = 80/97 (82.47%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVI 872
            YDN I  +SG+E L+SLRVL+LGRNRI KI  LE+L+RL+VLDLH N I  IE I+HL++L+VLNL+GN I+ L NL+GL SL+E+N+RRNC+ +V+
Sbjct:  153 YDNYISDMSGIEVLQSLRVLLLGRNRIKKICCLENLSRLNVLDLHDNQICRIEKISHLNELQVLNLSGNCISRLENLQGLNSLTELNLRRNCISAVV 249          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Medaka
Match: ENSORLT00000031147.1 (leucine rich repeat containing 49 [Source:NCBI gene;Acc:105358210])

HSP 1 Score: 117.472 bits (293), Expect = 2.416e-28
Identity = 60/97 (61.86%), Postives = 80/97 (82.47%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVI 872
            YDN I  +SG+E L+SLRVL+LGRNRI KI  LE+L+RL+VLDLH N I  IE I+HL++L+VLNL+GN I+ L NL+GL SL+E+N+RRNC+ +V+
Sbjct:  210 YDNYISDMSGIEVLQSLRVLLLGRNRIKKICCLENLSRLNVLDLHDNQICRIEKISHLNELQVLNLSGNCISRLENLQGLNSLTELNLRRNCISAVV 306          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Medaka
Match: ENSORLT00000037788.1 (pep primary_assembly:ASM223467v1:3:31060838:31067821:-1 gene:ENSORLG00000025062.1 transcript:ENSORLT00000037788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 1.186e-12
Identity = 48/163 (29.45%), Postives = 90/163 (55.21%), Query Frame = 3
Query: 1761 ENELMQFYSLSALGIFEDKEFWAAKPALSTSVTILVXXXXXXXXXXXXXXXXXARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKREL 2249
            + + ++ + L AL   E    W  + A   +VT++ F+ I F  I     +I+ +FPN+  + F   +I    Q+ +LA ++RL++L I    NP+ S TL R +V++RL H  L++ N +E+T ++ ++A R F  L  ++  +  +  L+  + + RKR+L
Sbjct:   77 DGDTLRLFGLGALEALERG--WGVQTA--GAVTVITFRYINFDGIIPSLPRIRVKFPNLSHLIFLETNISRLPQLAALAQVRRLDQLTIHPEGNPVVSLTLWRSFVIYRLYHFNLQRINGQEVTMNDVISAERVFGTLGHVAATETPRCRLLLLLEESRKRQL 235          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 69.707 bits (169), Expect = 3.960e-12
Identity = 48/162 (29.63%), Postives = 86/162 (53.09%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDT 1073
            NRI  I  L+ L SL  L LG N+I+K++ L++L+ L VL + +N I  IE + +L +L+ L L+ N I  +  L     L+ ++I  N V+ + +I  ++   LQ  +++ N +   SD   L +  SL  + ++ NP+  +   R  ++   P +  +D 
Sbjct:  182 NRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENI--SHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA 341          

HSP 2 Score: 63.929 bits (154), Expect = 2.799e-10
Identity = 51/142 (35.92%), Postives = 76/142 (53.52%), Query Frame = 3
Query:  591 RIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRI-FLSFNHLG--RISDFSCLIDLGSLNELSIDNNPI 1007
            RI +I GLE L+  + L L +N I KIE LESL+ L  LDL+ N I+ +EN+++L++L  L+++ N++  + NL  L  L ++ +  N +        T   NL+   FL    LG  RI     L  L SL  L +  N I
Sbjct:   73 RIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKI--------TGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKI 206          

HSP 3 Score: 61.2326 bits (147), Expect = 1.980e-9
Identity = 43/118 (36.44%), Postives = 69/118 (58.47%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRI 941
            N + +I  LE L  L+ L L  N+I+ I  LE  + L++L+L +N I+VIEN++ L+ L  L L  N I  L NL  L++LS ++I+ N +  +  +   N  NL+ ++LS N +  I
Sbjct:  138 NILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQ--NLVNLKELYLSHNGIEVI 253          

HSP 4 Score: 57.7658 bits (138), Expect = 2.246e-8
Identity = 46/141 (32.62%), Postives = 78/141 (55.32%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPIS 1010
            N I++I  LE+L SLR L L  N+I K+E L++L  L+ LD+  N ++ IEN+  L+ L+ L L  N IT + NL     L  + +  N +  + +++     +L  +FL  N + ++ +      L +L+ LSI +N I+
Sbjct:   94 NLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDG--LTSLTSLFLGTNKINKLQNLDA---LHNLSVLSIQSNRIT 229          

HSP 5 Score: 56.9954 bits (136), Expect = 5.217e-8
Identity = 43/132 (32.58%), Postives = 69/132 (52.27%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSL 977
            YDN+I ++  L+ L  L  L +  N + KIE LE L +L  L L  N I  I N+ H S L +L L  N I  + NL GL SL+ + +  N +  + ++++ +  NL  + +  N + +I     L++L  L
Sbjct:  114 YDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALH--NLSVLSIQSNRITKIEGLQNLVNLKEL 243          
BLAST of Leucine rich repeat containing 49 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 66.6254 bits (161), Expect = 4.634e-11
Identity = 49/165 (29.70%), Postives = 87/165 (52.73%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQI 1082
            NRI  I  L+ L SL  L LG N+I+K++ L++L+ L VL + +N I  IE + +L +L+ L L+ N I  +  L     L+ ++I  N V+ + +I  ++   LQ  +++ N +   SD   L +  SL  + ++ NP+  +   R  ++   P +  +D   I
Sbjct:  221 NRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENI--SHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 383          

HSP 2 Score: 61.2326 bits (147), Expect = 2.501e-9
Identity = 51/142 (35.92%), Postives = 76/142 (53.52%), Query Frame = 3
Query:  591 RIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRI-FLSFNHLG--RISDFSCLIDLGSLNELSIDNNPI 1007
            RI +I GLE L+  + L L +N I KIE LESL+ L  LDL+ N I+ +EN+++L++L  L+++ N++  + NL  L  L ++ +  N +        T   NL+   FL    LG  RI     L  L SL  L +  N I
Sbjct:  112 RIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKI--------TGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKI 245          

HSP 3 Score: 59.3066 bits (142), Expect = 9.208e-9
Identity = 42/113 (37.17%), Postives = 67/113 (59.29%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFN 926
            N + +I  LE L  L+ L L  N+I+ I  LE  + L++L+L +N I+VIEN++ L+ L  L L  N I  L NL  L++LS ++I+ N +  +  +   N  NL+ ++LS N
Sbjct:  177 NILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQ--NLVNLKELYLSHN 287          

HSP 4 Score: 55.8398 bits (133), Expect = 1.125e-7
Identity = 46/141 (32.62%), Postives = 78/141 (55.32%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPIS 1010
            N I++I  LE+L SLR L L  N+I K+E L++L  L+ LD+  N ++ IEN+  L+ L+ L L  N IT + NL     L  + +  N +  + +++     +L  +FL  N + ++ +      L +L+ LSI +N I+
Sbjct:  133 NLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDG--LTSLTSLFLGTNKINKLQNLDA---LHNLSVLSIQSNRIT 268          

HSP 5 Score: 55.4546 bits (132), Expect = 1.713e-7
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 3
Query:  582 YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPI 1007
            YDN+I ++  L+ L  L  L +  N + KIE LE L +L  L L  N I  I N+ H S L +L L  N I  + NL GL SL+ + +  N +  + ++++ +  NL  + +  N   RI+    L +L +L EL + +N I
Sbjct:  153 YDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALH--NLSVLSIQSN---RITKIEGLQNLVNLKELYLSHNGI 289          
BLAST of Leucine rich repeat containing 49 vs. Planmine SMEST
Match: SMESG000011491.1 (SMESG000011491.1)

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 826/830 (99.52%), Postives = 827/830 (99.64%), Query Frame = 3
Query:  132 MDLSDVRNSRLPNRIDKSLFNDYSKSARHRSSFNMPNFPDNRRTKTSLSEKDLLFNDIREDSLNFFYXXXXXXXXXXXXXXXSIIPCVVVRRKQEDKQKNPDRISLDRQNLTSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIXXXXXXXXXXXXXXXHIQRFHSLKERQKGSLNNSQRIFEGWNQNGRNISPRLSIKCFSSSSNSLYGTELQNSVNSLNDNDTDSTAKSIRANKSMQDFNSNMPKEFMAIEETISKPSNNHSYLLSQQQNSHNKPDIELXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTVDSNETESVISNTISSESKVLTRNPIEIVNENELMQFYSLSALGIFEDKEFWAAKPALSTSVTILVXXXXXXXXXXXXXXXXXARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNANFAQVPSVNLDLVGRSGILTNFTPDPDAISEKKLKKLSLAMMREVLDNVRKRRDWEERFHSQWELAIWQFIHSRVTPITLHRHNFMKQQFDKILFKSNNINSIPSST 2621
            MDLSDVRNSRLPNRIDKSLFNDYSKSARHRSSFNMPNFPDNRRTKTSLSEKDLLFNDIREDS NFFYQKQTQQKKPNQKPEKSIIPCVVVRRKQEDKQKNPDRISLDRQNLTSCPILENEENLRLLNYQYNYINQIQHLDKLRKLILLDLYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESL RLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIQGNNSRTSNSSQQSNHIQRFHSLKERQKGSLNNSQRIFEGWNQNGRNISPRLSIKCFSSSSNSLYGT+LQNSVNSLNDNDTDSTAKSIRANKSMQDFNSNMPKEFMAIEETISKPSNNHSYLLSQQQNSHNKPDIELSQSSKHPSSSSPFSSNVEVSNSSVSSQKGTVDSNETESVISNTISSESKVLTRNPIEIVNENELMQFYSLSALGIFEDKEFWAAKPALSTSVTILVFQEIEFIEIEKIFHQIKARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNANFAQVPSVNLDLVGRSGILTNFTPD DAISEKKLKKLSLAMMREVLDNVRKRRDWEERFHSQWELAIWQFIHSRVTPITLHRHNFMKQQFDKILFKSNNINSIPSST
Sbjct:    1 MDLSDVRNSRLPNRIDKSLFNDYSKSARHRSSFNMPNFPDNRRTKTSLSEKDLLFNDIREDSFNFFYQKQTQQKKPNQKPEKSIIPCVVVRRKQEDKQKNPDRISLDRQNLTSCPILENEENLRLLNYQYNYINQIQHLDKLRKLILLDLYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLTRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIQGNNSRTSNSSQQSNHIQRFHSLKERQKGSLNNSQRIFEGWNQNGRNISPRLSIKCFSSSSNSLYGTDLQNSVNSLNDNDTDSTAKSIRANKSMQDFNSNMPKEFMAIEETISKPSNNHSYLLSQQQNSHNKPDIELSQSSKHPSSSSPFSSNVEVSNSSVSSQKGTVDSNETESVISNTISSESKVLTRNPIEIVNENELMQFYSLSALGIFEDKEFWAAKPALSTSVTILVFQEIEFIEIEKIFHQIKARFPNIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVVFRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTINDIRKRELLHSTENEQVIPMTVHNANFAQVPSVNLDLVGRSGILTNFTPDADAISEKKLKKLSLAMMREVLDNVRKRRDWEERFHSQWELAIWQFIHSRVTPITLHRHNFMKQQFDKILFKSNNINSIPSST 830          
BLAST of Leucine rich repeat containing 49 vs. Planmine SMEST
Match: SMESG000058220.1 (SMESG000058220.1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.276e-12
Identity = 52/157 (33.12%), Postives = 82/157 (52.23%), Query Frame = 3
Query:  645 LGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLS-DLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQ 1112
            L R R    EG   +  L+ L LH   I  IEN++    +L++L L  N+I+ + N+  L  L  +N+  N +E +I+ N  NC +L+++ L+ N +G ++    L +L +  EL +  NP  S    R  VI   PQL  LD  +IT+ +R  A Q
Sbjct:    8 LLRKRAEHNEG--EIFSLEELSLHQQDIDKIENLDKWCRELKILYLQSNLISRIENVSRLKKLEYINLALNNIE-IIE-NLENCESLKKLDLTVNFVGILTSIGNLKNLYNFEELYLTGNPCQSYDGYREYVITTLPQLQTLDGVEITKSERISAFQ 160          
BLAST of Leucine rich repeat containing 49 vs. Planmine SMEST
Match: SMESG000006866.1 (SMESG000006866.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.422e-11
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  648 GRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKA 1106
            G  +I  IE L++LN + VL +  ++I+ IE ++ L +LR L L+ N I  L  L  L +L  +++R N + S+    +  C  L +I  S N    I + S L  L  L +L +  NP+++    R  ++     L +LD +++  D++  A
Sbjct:   36 GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKDLLDLDVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIA 188          
BLAST of Leucine rich repeat containing 49 vs. Planmine SMEST
Match: SMESG000021671.1 (SMESG000021671.1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.446e-11
Identity = 58/177 (32.77%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  594 IERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTN-CPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISS-NGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQII 1118
            + +IS +E L++L+ L L  N I+KIEGL++L  L+ L L  N+I  IEN++ L  L+ ++L  N I  +  L+ L +L  ++I  N    +I  N  + C NL  ++ + N +   S+ S L  L +L    I NNPI+  + + R  +IFN   L  LD   +   +   +K I+
Sbjct:  841 LSKISNIEKLENLKYLTLSNNCITKIEGLDNLVHLEELILDNNAIVKIENLSKLQKLKKISLNENFINSVLFLKNLPNLQIISIHTN---KLISFNGLDGCGNLMELYAANNCINDPSEISTLKSLNNLIIFDIQNNPITEISKNYRLNMIFNLKHLKGLDGVCVDSSEIFHSKDIL 1014          

HSP 2 Score: 65.0846 bits (157), Expect = 2.775e-10
Identity = 54/163 (33.13%), Postives = 83/163 (50.92%), Query Frame = 3
Query:  591 RIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTN-LRGLYSLSEVNIRRNCVESVID-INSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDT 1073
             I  I GL+    +R L L  N+ISKI+ L SL  L++L L+ N I+VIE ++ L  L+ LNLAGN I C+ N L+   S+ ++N+  N +E   D +N T  P L+ +                    ++N      NP+ S+ +    +I++F  L  LDT
Sbjct:   86 EITDIEGLDQCGQIRNLYLYDNKISKIKNLYSLKLLEILWLNNNKIEVIEGLSELIILKELNLAGNAIHCVGNSLKDNISIEKLNLSGNKLEHTHDLLNLTKLPKLKYL--------------------NINGPDYPPNPVFSHTNFYLFIIYHFQNLKKLDT 228          

HSP 3 Score: 62.7734 bits (151), Expect = 1.438e-9
Identity = 50/174 (28.74%), Postives = 91/174 (52.30%), Query Frame = 3
Query:  594 IERISGLE--TLKSLRVLMLGRNRISKIEGL--ESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYS--LSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDR 1097
            ++++ G+    LKSL VL LG N I  I GL    +  L  L L  N I +I+ +++LS+L+ + L  N I  ++    ++S  L E+++  N +++    N  +  +L+R ++  N +  + D        SL ++S+  NP+S     R  +I   P L ++D  +I+ED+R
Sbjct: 1106 LQKVEGVPKVYLKSLEVLHLGYNNIKTIAGLGLHDIPSLKALFLQGNDISMIDGLDYLSNLKEIVLDQNRIKSISENSFIHSGNLKEIHLDDNRLKNCT--NVFHLKHLKRFYVGNNKISDLHDLDLFYSFESLIDVSLFGNPVSRRHQHRQYLIHMIPTLLMIDGIEISEDER 1277          
BLAST of Leucine rich repeat containing 49 vs. Planmine SMEST
Match: SMESG000041551.1 (SMESG000041551.1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.540e-10
Identity = 56/176 (31.82%), Postives = 96/176 (54.55%), Query Frame = 3
Query:  588 NRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSS------RSAVIFNFPQLNLLDTKQITEDDR 1097
            N+I +I+GL  L +L VL L  N+I  I+G++SLN L  L+L  N I+ IE++     L+ L+L+ N+IT ++N+  L  L    +  N + S+  I+     +++ + L+ N +  +++ S L  L +L +LSI  NP     SS      R  +I     L +LD ++I E ++
Sbjct:   52 NQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEK 227          
The following BLAST results are available for this feature:
BLAST of Leucine rich repeat containing 49 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC494.913e-4752.32leucine rich repeat containing 49 [Source:HGNC Sym... [more]
LRRC497.697e-4752.32leucine rich repeat containing 49 [Source:HGNC Sym... [more]
LRRC491.053e-4652.32leucine rich repeat containing 49 [Source:HGNC Sym... [more]
LRRC491.152e-4652.32leucine rich repeat containing 49 [Source:HGNC Sym... [more]
LRRC492.405e-1833.07leucine rich repeat containing 49 [Source:HGNC Sym... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C06A8.61.266e-2136.13pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
K10D2.81.915e-1333.74pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
sds-229.860e-1135.92Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
mog-21.381e-623.08Probable U2 small nuclear ribonucleoprotein A' [S... [more]
mog-21.381e-623.08Probable U2 small nuclear ribonucleoprotein A' [S... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG137087.885e-2340.22gene:FBgn0035577 transcript:FBtr0073358[more]
CG137087.885e-2340.22gene:FBgn0035577 transcript:FBtr0332744[more]
U2A3.603e-1129.68gene:FBgn0033210 transcript:FBtr0088941[more]
sds223.730e-1130.67gene:FBgn0028992 transcript:FBtr0083436[more]
tilB1.329e-1033.33gene:FBgn0014395 transcript:FBtr0077345[more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnaaf11.830e-1435.06dynein, axonemal, assembly factor 1 [Source:NCBI g... [more]
lrguk1.021e-1233.53leucine-rich repeats and guanylate kinase domain c... [more]
lrrc65.452e-1235.71leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc65.452e-1235.71leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc65.452e-1235.71leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbpms21.211e-4852.32RNA binding protein with multiple splicing 2 [Sour... [more]
rbpms21.027e-4252.75RNA binding protein with multiple splicing 2 [Sour... [more]
rbpms21.375e-4252.75RNA binding protein with multiple splicing 2 [Sour... [more]
rbpms23.042e-4252.75RNA binding protein with multiple splicing 2 [Sour... [more]
rbpms21.865e-1431.90RNA binding protein with multiple splicing 2 [Sour... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc491.802e-5052.08leucine rich repeat containing 49 [Source:MGI Symb... [more]
Lrrc492.438e-4852.74leucine rich repeat containing 49 [Source:MGI Symb... [more]
Lrrc492.508e-4852.74leucine rich repeat containing 49 [Source:MGI Symb... [more]
Lrrc499.125e-4852.74leucine rich repeat containing 49 [Source:MGI Symb... [more]
Lrrc491.079e-4752.74leucine rich repeat containing 49 [Source:MGI Symb... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91YK0|LRC49_MOUSE2.210e-4752.74Leucine-rich repeat-containing protein 49 OS=Mus m... [more]
sp|Q8IUZ0|LRC49_HUMAN5.533e-4652.32Leucine-rich repeat-containing protein 49 OS=Homo ... [more]
sp|Q7ZV84|DAAF1_DANRE9.983e-1334.48Dynein assembly factor 1, axonemal OS=Danio rerio ... [more]
sp|Q8CDN9|LRRC9_MOUSE8.279e-1233.33Leucine-rich repeat-containing protein 9 OS=Mus mu... [more]
sp|B3DH20|TILB_DANRE3.770e-1135.71Protein tilB homolog OS=Danio rerio OX=7955 GN=lrr... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JVG61.064e-7334.31Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7NG902.807e-6335.16Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1I8HU994.424e-5454.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GKG34.806e-5352.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IRL91.599e-5253.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000021515.24.189e-3946.45leucine rich repeat containing 49 [Source:NCBI gen... [more]
ppp1r71.313e-1229.12protein phosphatase 1 regulatory subunit 7 [Source... [more]
dnaaf14.246e-1232.75dynein axonemal assembly factor 1 [Source:NCBI gen... [more]
LRRC93.714e-1131.98leucine-rich repeat-containing protein 9-like [Sou... [more]
LRRC94.058e-1131.98leucine-rich repeat-containing protein 9-like [Sou... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC499.898e-5048.81leucine rich repeat containing 49 [Source:HGNC Sym... [more]
cep979.241e-1330.65centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ppp1r71.765e-1238.84protein phosphatase 1, regulatory (inhibitor) subu... [more]
ENSPMAT00000005086.18.203e-1130.77pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-... [more]
ppp1r429.153e-1129.35protein phosphatase 1, regulatory subunit 42 [Sour... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SDS229.736e-733.33Regulatory subunit of the type 1 protein phosphata... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO457717.068e-5147.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449371.458e-1330.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352992.081e-1233.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317708.772e-1230.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317712.463e-1131.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027909.11.180e-2861.86leucine rich repeat containing 49 [Source:NCBI gen... [more]
ENSORLT00000031147.12.416e-2861.86leucine rich repeat containing 49 [Source:NCBI gen... [more]
ENSORLT00000037788.11.186e-1229.45pep primary_assembly:ASM223467v1:3:31060838:310678... [more]
ppp1r73.960e-1229.63protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r74.634e-1129.70protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of Leucine rich repeat containing 49 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011491.10.000e+099.52SMESG000011491.1[more]
SMESG000058220.18.276e-1233.12SMESG000058220.1[more]
SMESG000006866.13.422e-1129.41SMESG000006866.1[more]
SMESG000021671.15.446e-1132.77SMESG000021671.1[more]
SMESG000041551.11.540e-1031.82SMESG000041551.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003580 ID=SMED30003580|Name=Leucine rich repeat containing 49|organism=Schmidtea mediterranea sexual|type=transcript|length=2902bp
ATCCACTCCATAATTTATGATATTTTAAACTGTTACTAAGTGGTTAATTA
ACTTGAAATTTAATGAAACTTTGTTAAAATATTAATAAAAATTTTCTAAT
TTAATTGTACTATATTTTCCTATATAATCAAATGGATTTAAGTGACGTTA
GGAATTCTAGATTGCCAAATAGAATTGATAAATCTCTTTTTAATGATTAT
TCCAAAAGTGCCAGGCACAGATCATCTTTCAATATGCCAAATTTCCCGGA
TAACCGTCGCACAAAAACTTCATTGTCTGAAAAGGATTTATTATTTAATG
ACATACGGGAAGATTCTTTGAATTTCTTTTACCAAAAGCAAACGCAACAG
AAAAAACCGAACCAAAAACCCGAGAAATCCATAATTCCATGTGTTGTAGT
TCGCCGGAAACAAGAAGATAAACAGAAAAATCCCGATAGAATAAGCTTAG
ATCGTCAAAATCTGACCAGTTGTCCAATATTAGAAAATGAAGAAAATTTG
AGATTACTGAATTACCAATACAACTATATCAATCAGATCCAGCATTTAGA
TAAACTGAGGAAATTAATTCTCCTAGATCTCTATGACAACAGAATTGAAA
GAATATCAGGACTAGAAACTCTAAAATCTTTGAGAGTTCTGATGCTCGGA
CGGAATCGAATATCAAAAATCGAGGGTCTCGAATCACTTAATCGTCTCGA
TGTATTAGATTTGCACGCGAATTCCATACAAGTGATTGAAAATATCAATC
ATCTCAGTGATTTGCGAGTGCTTAATCTTGCCGGCAATGTAATTACATGC
TTGACCAACCTCAGGGGGTTATATTCGTTATCAGAAGTAAACATCCGCCG
CAATTGTGTGGAGTCCGTTATTGATATCAATTCGACAAATTGTCCTAATT
TGCAAAGAATTTTTCTCAGTTTTAACCATCTTGGAAGAATATCCGATTTT
TCTTGCTTAATTGATTTGGGTTCACTGAATGAGCTGTCCATTGATAATAA
TCCGATCAGTAGTAACGGAAGCTCTAGATCGGCAGTGATTTTCAATTTTC
CTCAACTGAACTTATTGGATACCAAACAAATAACCGAAGACGATCGCAAC
AAAGCAAAACAGATCATTAATCGTCTGGAGTTGGGATCGAAATCGAATTC
GGGATTGTCAAGGCATATTCAAGGGAACAATTCTCGCACTTCCAACAGTA
GCCAGCAATCGAATCATATACAGAGATTTCACAGCTTGAAAGAAAGACAA
AAAGGATCTTTAAATAATTCTCAAAGAATCTTTGAAGGTTGGAATCAAAA
TGGAAGAAATATTTCTCCACGGTTGTCTATAAAATGCTTCAGTAGTTCAT
CTAATTCTCTGTATGGTACCGAATTACAGAATAGTGTAAATTCACTCAAT
GATAATGACACTGACTCAACCGCAAAGTCTATCAGAGCAAATAAATCAAT
GCAAGATTTCAATAGTAATATGCCTAAAGAATTCATGGCCATCGAAGAAA
CTATCTCAAAACCTTCTAATAACCATTCATATCTCCTAAGCCAACAGCAG
AATTCACACAATAAACCGGATATAGAATTGTCCCAGTCTTCAAAGCATCC
ATCAAGTTCCTCGCCGTTTTCATCCAATGTAGAAGTTTCTAATTCGTCAG
TTTCATCTCAGAAAGGTACCGTTGATAGCAATGAAACCGAGTCAGTGATC
AGCAATACTATTTCTAGTGAAAGCAAAGTACTGACAAGGAATCCTATTGA
AATTGTAAATGAAAACGAGCTCATGCAATTCTATTCTTTATCCGCATTAG
GTATATTTGAAGATAAAGAGTTCTGGGCAGCGAAACCTGCCCTATCAACC
AGTGTAACAATTCTCGTGTTTCAGGAAATTGAATTCATTGAAATCGAGAA
AATTTTCCATCAGATTAAAGCACGATTCCCCAATATAAAAAAAATAGCGT
TTCAAGGATGTGATATCAAATGCTATTCTCAAATTAATTCTTTGGCCAAT
TTGAAGCGACTGGAAGAATTGGTTATAGAGAAATTGAACAATCCGATTTC
GTCTTTCACCTTGATTCGCTATTATGTAGTTTTCAGACTCGCCCATTTGG
GACTGAGGAAGTTCAATGATGAGGAAATAACCGATCACGAATATTTGACA
GCCCGTCGATATTTCCTAAATCTAGCAACAATGAGTCCGAACCAGATTTT
GCAGCTTCATCTGATTGGAACCATAAATGACATTCGGAAGCGAGAATTGT
TGCACTCAACTGAAAATGAACAAGTGATTCCTATGACAGTCCATAATGCC
AATTTTGCTCAAGTGCCATCAGTGAATCTGGATCTCGTTGGCAGATCGGG
TATTTTGACAAATTTTACTCCAGATCCAGATGCTATATCAGAGAAAAAAT
TGAAAAAACTGAGCTTAGCAATGATGAGAGAAGTGCTGGACAATGTGAGA
AAGCGGCGGGATTGGGAAGAACGATTTCACAGCCAATGGGAGCTGGCTAT
TTGGCAATTTATCCATTCACGCGTTACTCCAATCACATTACACCGGCACA
ATTTTATGAAGCAGCAATTCGATAAAATTCTGTTCAAATCAAATAATATC
AATTCAATTCCCTCATCAACAAAAATAAAAAATAATAATTAATTCGATTT
TATAAATAATTATCATTGAAAACTAGAAATTGGAAAGTTTTTATAAAGAA
AAAAAATGTTTTGTAATGTCCGGATTTGAAAGCCACGCGGAATTGGATTC
TGAATTTACGGCGATTTGAAAAAAAAGATTTAATTTCATTCATAGGATCT
AGCAAAATGTATATAATAAAATATGGGGAGAATCTAATGAAATATAAATA
ATATCCGGAAATAACATTAAAATTTTGAAATTTTCCCAATGCTTTATGGC
AG
back to top

protein sequence of SMED30003580-orf-1

>SMED30003580-orf-1 ID=SMED30003580-orf-1|Name=SMED30003580-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=837bp
MDLSDVRNSRLPNRIDKSLFNDYSKSARHRSSFNMPNFPDNRRTKTSLSE
KDLLFNDIREDSLNFFYQKQTQQKKPNQKPEKSIIPCVVVRRKQEDKQKN
PDRISLDRQNLTSCPILENEENLRLLNYQYNYINQIQHLDKLRKLILLDL
YDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLNRLDVLDLHANSIQ
VIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDIN
STNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRS
AVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIQGNN
SRTSNSSQQSNHIQRFHSLKERQKGSLNNSQRIFEGWNQNGRNISPRLSI
KCFSSSSNSLYGTELQNSVNSLNDNDTDSTAKSIRANKSMQDFNSNMPKE
FMAIEETISKPSNNHSYLLSQQQNSHNKPDIELSQSSKHPSSSSPFSSNV
EVSNSSVSSQKGTVDSNETESVISNTISSESKVLTRNPIEIVNENELMQF
YSLSALGIFEDKEFWAAKPALSTSVTILVFQEIEFIEIEKIFHQIKARFP
NIKKIAFQGCDIKCYSQINSLANLKRLEELVIEKLNNPISSFTLIRYYVV
FRLAHLGLRKFNDEEITDHEYLTARRYFLNLATMSPNQILQLHLIGTIND
IRKRELLHSTENEQVIPMTVHNANFAQVPSVNLDLVGRSGILTNFTPDPD
AISEKKLKKLSLAMMREVLDNVRKRRDWEERFHSQWELAIWQFIHSRVTP
ITLHRHNFMKQQFDKILFKSNNINSIPSSTKIKNNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 186..207
e-value: 0.0067
score: 25.6
coord: 164..185
e-value: 0.049
score: 22.8
coord: 142..163
e-value: 0.16
score: 21.0
coord: 254..275
e-value: 270.0
score: 3.9
coord: 208..229
e-value: 100.0
score: 7.3
NoneNo IPR availablePFAMPF14580LRR_9coord: 192..329
e-value: 1.1E-15
score: 57.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 469..523
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 339..363
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 72..771
NoneNo IPR availablePANTHERPTHR45973:SF8LEUCINE RICH REPEAT CONTAINING 49coord: 72..771
NoneNo IPR availableSUPERFAMILYSSF52075Outer arm dynein light chain 1coord: 161..328
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 96..192
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 228..325
e-value: 1.6E-16
score: 61.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 571..685
e-value: 1.2E-7
score: 32.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 63..227
e-value: 3.2E-23
score: 83.7
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 122..143
score: 7.319
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 210..231
score: 8.128
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 144..165
score: 8.698
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 188..209
score: 8.074
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 256..277
score: 7.327
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 232..253
score: 4.639
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 281..302
score: 5.602
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 166..187
score: 9.229