Enhancer of yellow 2 transcription factor

Overview
NameEnhancer of yellow 2 transcription factor
Smed IDSMED30003577
Length (bp)436
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003577

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v6_928_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v6_928_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30003577SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Human
Match: ENY2 (ENY2 transcription and export complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:24449])

HSP 1 Score: 43.5134 bits (101), Expect = 8.585e-6
Identity = 23/95 (24.21%), Postives = 49/95 (51.58%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            +++   IN  +   G+R++LK+ +  +L + GW D +K+ C + I           + + ++D+V  +      L+P  +KKE+L ++ + LA  
Sbjct:    5 AQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEK------GLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 93          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Human
Match: ENY2 (ENY2 transcription and export complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:24449])

HSP 1 Score: 43.5134 bits (101), Expect = 8.987e-6
Identity = 25/102 (24.51%), Postives = 54/102 (52.94%), Query Frame = 1
Query:   31 TEMNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            ++MN+  +++   IN  +   G+R++LK+ +  +L + GW D +K+ C + I           + + ++D+V  +      L+P  +KKE+L ++ + LA  
Sbjct:    4 SKMNKD-AQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEK------GLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 98          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Zebrafish
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:436700])

HSP 1 Score: 48.521 bits (114), Expect = 6.627e-8
Identity = 28/97 (28.87%), Postives = 53/97 (54.64%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFI-DNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQD 339
            S++   IN  +  +G+R++LK+ +  +L + GW D +K+ C + I +  +EN       + +ED+V  V      L+P  +KKE+L ++ + LA   
Sbjct:    5 SQMRAAINQKLIEMGERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIEN-------VTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 94          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Zebrafish
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:436700])

HSP 1 Score: 48.521 bits (114), Expect = 6.627e-8
Identity = 28/97 (28.87%), Postives = 53/97 (54.64%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFI-DNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQD 339
            S++   IN  +  +G+R++LK+ +  +L + GW D +K+ C + I +  +EN       + +ED+V  V      L+P  +KKE+L ++ + LA   
Sbjct:    5 SQMRAAINQKLIEMGERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIEN-------VTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 94          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Xenopus
Match: eny2 (enhancer of yellow 2 homolog [Source:NCBI gene;Acc:100170422])

HSP 1 Score: 43.8986 bits (102), Expect = 5.752e-6
Identity = 23/95 (24.21%), Postives = 49/95 (51.58%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            +++   IN  +   G+R++LK+ +  +L + GW D +K+ C   I+          + + ++D+V  +      L+P  +KKE+L ++ + LA  
Sbjct:    5 AQMKAAINQKLIETGERERLKELLRAKLIECGWRDQLKAHCKDVINEK------GVEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRAFLAQH 93          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Mouse
Match: Eny2 (ENY2 transcription and export complex 2 subunit [Source:MGI Symbol;Acc:MGI:1919286])

HSP 1 Score: 43.5134 bits (101), Expect = 5.894e-6
Identity = 23/95 (24.21%), Postives = 49/95 (51.58%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            +++   IN  +   G+R++LK+ +  +L + GW D +K+ C + I           + + ++D+V  +      L+P  +KKE+L ++ + LA  
Sbjct:    5 AQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEK------GLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 93          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Mouse
Match: Eny2 (ENY2 transcription and export complex 2 subunit [Source:MGI Symbol;Acc:MGI:1919286])

HSP 1 Score: 43.5134 bits (101), Expect = 6.170e-6
Identity = 25/102 (24.51%), Postives = 54/102 (52.94%), Query Frame = 1
Query:   31 TEMNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            ++MN+  +++   IN  +   G+R++LK+ +  +L + GW D +K+ C + I           + + ++D+V  +      L+P  +KKE+L ++ + LA  
Sbjct:    4 SKMNKD-AQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEK------GLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 98          
BLAST of Enhancer of yellow 2 transcription factor vs. UniProt/SwissProt
Match: sp|Q6DH42|ENY2_DANRE (Transcription and mRNA export factor ENY2 OS=Danio rerio OX=7955 GN=eny2 PE=3 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 5.003e-7
Identity = 28/97 (28.87%), Postives = 53/97 (54.64%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFI-DNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQD 339
            S++   IN  +  +G+R++LK+ +  +L + GW D +K+ C + I +  +EN       + +ED+V  V      L+P  +KKE+L ++ + LA   
Sbjct:    5 SQMRAAINQKLIEMGERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIEN-------VTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 94          
BLAST of Enhancer of yellow 2 transcription factor vs. UniProt/SwissProt
Match: sp|Q4H3N8|ENY2_CIOIN (Transcription and mRNA export factor ENY2 OS=Ciona intestinalis OX=7719 GN=ENY2 PE=3 SV=1)

HSP 1 Score: 48.1358 bits (113), Expect = 7.305e-7
Identity = 27/89 (30.34%), Postives = 49/89 (55.06%), Query Frame = 1
Query:   70 INVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            IN  +   G+R+KLK+ +  RL + GW D +K  C + +           + + ++D+VQ++     +L+P  +KKE+L K+ + LA Q
Sbjct:   19 INQQLVETGEREKLKELLRVRLAECGWRDQLKQLCKEIVRER------GLEHVSVDDLVQDITPKARQLVPDTVKKELLQKIRNFLAQQ 101          
BLAST of Enhancer of yellow 2 transcription factor vs. UniProt/SwissProt
Match: sp|B5XGH3|ENY2B_SALSA (Transcription and mRNA export factor ENY2-2 OS=Salmo salar OX=8030 GN=eny2-2 PE=3 SV=1)

HSP 1 Score: 47.3654 bits (111), Expect = 1.224e-6
Identity = 26/95 (27.37%), Postives = 50/95 (52.63%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            S++   IN  +  +G+R++LK+ +  +LT+ GW D +K+ C   I           + + +ED+V  +      L+P  +KKE+L ++ + LA  
Sbjct:    5 SKMRATINQKLTEMGERERLKELLRAKLTECGWRDQLKAHCKDVIKEK------GLEHVTVEDLVVEITPKGRVLVPDSVKKELLQRIRAFLAQH 93          
BLAST of Enhancer of yellow 2 transcription factor vs. UniProt/SwissProt
Match: sp|B4L1Z8|ENY2_DROMO (Enhancer of yellow 2 transcription factor OS=Drosophila mojavensis OX=7230 GN=e(y)2 PE=3 SV=1)

HSP 1 Score: 45.0542 bits (105), Expect = 9.668e-6
Identity = 27/82 (32.93%), Postives = 45/82 (54.88%), Query Frame = 1
Query:   94 GQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQD 339
            G R K+K  +  RLT+ GW D V+  C   +   VE  K    S+ +E ++  V      L+P  +KKE+L+K+ ++LA+ +
Sbjct:   15 GDRSKIKDLLCNRLTECGWRDEVRLLCRNIL---VE--KNGNNSLSVEQLIAEVTPKARTLVPDAVKKELLMKIRTILAENE 91          
BLAST of Enhancer of yellow 2 transcription factor vs. TrEMBL
Match: A0A075A2D1 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00326 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.458e-8
Identity = 34/114 (29.82%), Postives = 60/114 (52.63%), Query Frame = 1
Query:   40 NEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVEN-----LKIPPQSI----PLE----DIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 342
            +EPP ELVEK+   + + G+  +L  FI  RL+++GWCD V   C ++I N   +        PP +     PLE    D+V+ +       +P++L KE+  +++  + +Q +
Sbjct:   16 SEPPEELVEKVVRRLQTTGELMRLAAFIPGRLSELGWCDRVMELCREYIRNHSASGPGIKTGSPPGTGGLKEPLEVSVDDMVRELTPNVKYWVPEELYKELKYRIMEFIGEQGL 129          
BLAST of Enhancer of yellow 2 transcription factor vs. TrEMBL
Match: G7YK19 (Enhancer of yellow 2 transcription factor OS=Clonorchis sinensis OX=79923 GN=ENY2 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.087e-8
Identity = 30/114 (26.32%), Postives = 60/114 (52.63%), Query Frame = 1
Query:   40 NEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDN------TVENLKIP-------PQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 342
            +EPP ELVEK+   + + G+  +L  FI  RL+++GWCD V   C ++I N       ++    P       P  + ++D+V+ +       +P++L K++  +++  + +Q +
Sbjct:   16 SEPPEELVEKVVRRLQTTGELMRLAAFIPGRLSELGWCDRVMELCREYIRNHSASGPGIKTGSPPGTGGLKEPSEVSVDDMVRELTPNAKYWVPEELYKQLKYRIMEFIGEQGL 129          
BLAST of Enhancer of yellow 2 transcription factor vs. TrEMBL
Match: A0A4S2ME16 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002089 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.945e-8
Identity = 31/114 (27.19%), Postives = 60/114 (52.63%), Query Frame = 1
Query:   40 NEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDN------TVENLKIP-------PQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 342
            +EPP ELVEK+   + + G+  +L  FI  RL+++GWCD V   C ++I N       ++    P       P  + ++D+V+ +       +P++L KE+  +++  + +Q +
Sbjct:   16 SEPPEELVEKVVRRLQTTGELMRLVAFIPGRLSELGWCDRVMELCREYIRNHSASGPGIKTGSPPGTGGLKEPSEVSVDDMVRELTPNVKYWVPEELYKELKYRIMEFIGEQGL 129          
BLAST of Enhancer of yellow 2 transcription factor vs. TrEMBL
Match: A0A1S8X2U3 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_03160 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 5.502e-8
Identity = 34/112 (30.36%), Postives = 59/112 (52.68%), Query Frame = 1
Query:   40 NEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVEN-----LKIPPQSI----PLE----DIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            +EPP ELVEK+   + + G+  +L  FI  RL+++GWCD V   C ++I N   +        PP +     PLE    D+V+ +       +P++L KE+  +++  + +Q
Sbjct:   16 SEPPEELVEKVVRRLQTTGELMRLAAFIPGRLSELGWCDRVMELCREYIRNHSASGPGIKTGSPPGTGGLKEPLEVSVDDMVRELTPNVKYWVPEELYKELKYRIMEFIGEQ 127          
BLAST of Enhancer of yellow 2 transcription factor vs. TrEMBL
Match: A0A5J4N6K1 (Transcription and mRNA export factor ENY2 OS=Paragonimus westermani OX=34504 GN=DEA37_0001947 PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 5.756e-8
Identity = 31/103 (30.10%), Postives = 60/103 (58.25%), Query Frame = 1
Query:   37 MNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDN-TVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 342
            M E  +E+  KI  L+   G+R++L++F+  RLT+ GW D VK  C ++I    V+N       I +E++VQ +  +  +++P +++++VL ++   L   D+
Sbjct:    1 MTEKRAEIKSKIADLLVKTGERERLREFVENRLTETGWNDKVKQACKEYIRTKGVDN-------ITVEEVVQAITPLARQIVPVEVRQDVLEQLRKFLVQHDI 96          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Cavefish
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:103039940])

HSP 1 Score: 49.2914 bits (116), Expect = 2.494e-8
Identity = 27/91 (29.67%), Postives = 50/91 (54.95%), Query Frame = 1
Query:   70 INVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFI-DNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQD 339
            IN  +  +G+R++LK+ +  +L + GW D +K+ C + I +  +EN       + +ED+V  V      L+P  +KKE+L ++ + LA   
Sbjct:   11 INQKLIEMGERERLKELLRAKLIECGWRDQLKAHCKEVIKEKGIEN-------VTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 94          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Sea Lamprey
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:436700])

HSP 1 Score: 46.2098 bits (108), Expect = 8.710e-8
Identity = 25/94 (26.60%), Postives = 52/94 (55.32%), Query Frame = 1
Query:   52 SELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFI-DNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLA 330
            +++   IN  +   G+R++LK+ +  RL + GW D +++ C   I D  +E+       + +ED++  +      L+P ++KKE+L ++ + LA
Sbjct:   13 AQMRAAINQKLIETGERERLKELLKTRLMECGWKDQLRAHCKDVIRDKGLEH-------VTVEDLISEITPKGRALVPDNVKKELLQRIRAFLA 99          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Nematostella
Match: EDO41625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S403])

HSP 1 Score: 42.743 bits (99), Expect = 2.979e-6
Identity = 23/89 (25.84%), Postives = 49/89 (55.06%), Query Frame = 1
Query:   70 INVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            IN  +   G+R++LK+ +  +L + GW D +K  C + I     +      ++ +ED+V+ +      L+P ++K+E+L ++   LA++
Sbjct:   17 INQALVESGERERLKELLRTKLIECGWRDQLKDYCKEIIKQKGLD------NVTVEDLVKTITPKGRALVPDEVKRELLQRIRQFLAEK 99          
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Medaka
Match: ENY2 (transcription and mRNA export factor ENY2 [Source:NCBI gene;Acc:101173720])

HSP 1 Score: 46.2098 bits (108), Expect = 4.567e-7
Identity = 25/94 (26.60%), Postives = 49/94 (52.13%), Query Frame = 1
Query:   55 ELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ 336
            +L   IN  +  +G+R++LK+ +  +L + GW D +K+ C   +           + + +ED+V  V      L+P ++KKE+L ++ + LA  
Sbjct:    6 QLKASINQKLIEMGERERLKELLRAKLVESGWKDQLKAHCKDVVREK------GLEHVTVEDLVTEVTPKGRALVPDNVKKELLQRIRAFLAQH 93          
BLAST of Enhancer of yellow 2 transcription factor vs. Planmine SMEST
Match: SMESG000004604.1 (SMESG000004604.1)

HSP 1 Score: 202.216 bits (513), Expect = 2.066e-68
Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
Query:   37 MNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 342
            MNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM
Sbjct:    1 MNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 102          
BLAST of Enhancer of yellow 2 transcription factor vs. Planmine SMEST
Match: SMESG000004650.1 (SMESG000004650.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.246e-12
Identity = 32/103 (31.07%), Postives = 60/103 (58.25%), Query Frame = 1
Query:   37 MNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDN-TVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 342
            M +  +E+  KI+  + + G+R+KLK+FI +RL + GW D VK  C  +I N  V+N       + ++++V  V  +   ++P+++K++VL +M   L + D 
Sbjct:    1 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDN-------VTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDF 96          
The following BLAST results are available for this feature:
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENY28.585e-624.21ENY2 transcription and export complex 2 subunit [S... [more]
ENY28.987e-624.51ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eny26.627e-828.87ENY2 transcription and export complex 2 subunit [S... [more]
eny26.627e-828.87ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eny25.752e-624.21enhancer of yellow 2 homolog [Source:NCBI gene;Acc... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Eny25.894e-624.21ENY2 transcription and export complex 2 subunit [S... [more]
Eny26.170e-624.51ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6DH42|ENY2_DANRE5.003e-728.87Transcription and mRNA export factor ENY2 OS=Danio... [more]
sp|Q4H3N8|ENY2_CIOIN7.305e-730.34Transcription and mRNA export factor ENY2 OS=Ciona... [more]
sp|B5XGH3|ENY2B_SALSA1.224e-627.37Transcription and mRNA export factor ENY2-2 OS=Sal... [more]
sp|B4L1Z8|ENY2_DROMO9.668e-632.93Enhancer of yellow 2 transcription factor OS=Droso... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A2D12.458e-829.82Uncharacterized protein OS=Opisthorchis viverrini ... [more]
G7YK194.087e-826.32Enhancer of yellow 2 transcription factor OS=Clono... [more]
A0A4S2ME164.945e-827.19Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8X2U35.502e-830.36Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A5J4N6K15.756e-830.10Transcription and mRNA export factor ENY2 OS=Parag... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eny22.494e-829.67ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eny28.710e-826.60ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO416252.979e-625.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENY24.567e-726.60transcription and mRNA export factor ENY2 [Source:... [more]
back to top
BLAST of Enhancer of yellow 2 transcription factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000004604.12.066e-68100.00SMESG000004604.1[more]
SMESG000004650.11.246e-1231.07SMESG000004650.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003577 ID=SMED30003577|Name=Enhancer of yellow 2 transcription factor|organism=Schmidtea mediterranea sexual|type=transcript|length=436bp
ATTAATATTAATTTGAAATAAAAAATCAATACAGAAATGAACGAACCACC
ATCGGAATTAGTTGAAAAAATAAATGTTTTAATTGATTCTTTGGGACAGA
GACAGAAATTAAAACAATTCATATCACGTAGACTAACAGATGTAGGATGG
TGTGATGTCGTCAAATCCCAATGTTCGAAATTTATCGACAACACGGTAGA
AAATTTAAAAATCCCACCACAATCAATACCATTAGAAGATATAGTACAAA
ATGTAATGAAAATGTGTATTGAGCTAATACCCAAAGATCTAAAAAAGGAG
GTTCTATTGAAAATGCTTTCGATGTTAGCTGATCAAGATATGTAAAATTA
AGTTAATATTAAGTAAATAATATTCGTTTAATATTGCAGACAAAAAACAT
TTAATAAATACAAATTTTATTTATATTAAAAAAAAA
back to top

protein sequence of SMED30003577-orf-1

>SMED30003577-orf-1 ID=SMED30003577-orf-1|Name=SMED30003577-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFI
DNTVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQ
DM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0000124SAGA complex
GO:0005634nucleus
GO:0005643nuclear pore
GO:0005654nucleoplasm
GO:0070390transcription export complex 2
GO:0071819DUBm complex
Vocabulary: biological process
TermDefinition
GO:0006325chromatin organization
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006368transcription elongation from RNA polymerase II promoter
GO:0006406mRNA export from nucleus
GO:0006810transport
GO:0015031protein transport
GO:0016569covalent chromatin modification
GO:0016578histone deubiquitination
GO:0045893positive regulation of transcription, DNA-templated
GO:0051028mRNA transport
Vocabulary: molecular function
TermDefinition
GO:0030374ligand-dependent nuclear receptor transcription coactivator activity
GO:0043035chromatin insulator sequence binding
GO:0003713transcription coactivator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000028Category 2 cell
PLANA:0000429neoblast