Chromo domain-containing protein

Overview
NameChromo domain-containing protein
Smed IDSMED30003568
Length (bp)751
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromo domain-containing protein (SMED30003568) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromo domain-containing protein (SMED30003568) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromo domain-containing protein (SMED30003568) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromo domain-containing protein (SMED30003568) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003568

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30003568SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000046659.1 SMESG000043147.1 SMESG000042302.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034880.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000017989.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000003989.1 SMESG000080004.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig11765uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003568SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000046659.1 SMESG000043147.1 SMESG000042302.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034880.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000017989.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000003989.1 SMESG000080004.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig11765newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003568SMESG000079942.1 SMESG000079430.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057533.1 SMESG000055140.1 SMESG000053372.1 SMESG000048922.1 SMESG000044728.1 SMESG000042302.1 SMESG000034701.1 SMESG000031049.1 SMESG000029226.1 SMESG000023611.1 SMESG000019334.1 SMESG000017989.1 SMESG000005221.1 SMESG000001234.1 SMESG000026425.1 Contig19631uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003568SMESG000079942.1 SMESG000079430.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057533.1 SMESG000055140.1 SMESG000053372.1 SMESG000048922.1 SMESG000044728.1 SMESG000042302.1 SMESG000034701.1 SMESG000031049.1 SMESG000029226.1 SMESG000023611.1 SMESG000019334.1 SMESG000017989.1 SMESG000005221.1 SMESG000001234.1 SMESG000026425.1 Contig19631newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003568SMESG000081267.1 SMESG000076652.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000036590.1 SMESG000035558.1 SMESG000034701.1 SMESG000030608.1 SMESG000029226.1 SMESG000014974.1 SMESG000003230.1 SMESG000003226.1 SMESG000003218.1 Contig19325uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003568SMESG000081267.1 SMESG000076652.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000042302.1 SMESG000040193.1 SMESG000037212.1 SMESG000036590.1 SMESG000035558.1 SMESG000034701.1 SMESG000030608.1 SMESG000029226.1 SMESG000014974.1 SMESG000003230.1 SMESG000003226.1 SMESG000003218.1 Contig19325newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30003568SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000053240.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000026425.1 dd_Smed_v4_9908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003568SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000053240.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000026425.1 dd_Smed_v4_9908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30003568SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003568SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30003568SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003568SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003568SMESG000081199.1 SMESG000076404.1 SMESG000069658.1 SMESG000068312.1 SMESG000068042.1 SMESG000057533.1 SMESG000056465.1 SMESG000051141.1 SMESG000046304.1 SMESG000044801.1 SMESG000043241.1 SMESG000042662.1 SMESG000035558.1 SMESG000033266.1 SMESG000023611.1 SMESG000010351.1 SMESG000009500.1 SMESG000005685.1 SMESG000002786.1 SMESG000001786.1 Contig12059newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003568SMESG000081199.1 SMESG000076404.1 SMESG000069658.1 SMESG000068312.1 SMESG000068042.1 SMESG000057533.1 SMESG000056465.1 SMESG000051141.1 SMESG000046304.1 SMESG000044801.1 SMESG000043241.1 SMESG000042662.1 SMESG000035558.1 SMESG000033266.1 SMESG000023611.1 SMESG000010351.1 SMESG000009500.1 SMESG000005685.1 SMESG000002786.1 SMESG000001786.1 Contig12059uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30003568SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000034701.1 SMESG000031049.1 SMESG000029226.1 SMESG000022704.1 SMESG000005221.1 Contig15904uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003568SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000034701.1 SMESG000031049.1 SMESG000029226.1 SMESG000022704.1 SMESG000005221.1 Contig15904uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30003568SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000034701.1 SMESG000031049.1 SMESG000029226.1 SMESG000022704.1 SMESG000005221.1 Contig15904newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30003568SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000053372.1 SMESG000053240.1 SMESG000051837.1 SMESG000048922.1 SMESG000042302.1 SMESG000034701.1 SMESG000031049.1 SMESG000029226.1 SMESG000022704.1 SMESG000005221.1 Contig15904newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003568SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000051837.1 SMESG000050353.1 SMESG000048922.1 SMESG000046053.1 SMESG000045239.1 SMESG000042816.1 SMESG000042302.1 SMESG000040193.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000006220.1 SMESG000005221.1 Contig20519newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003568SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000051837.1 SMESG000050353.1 SMESG000048922.1 SMESG000046053.1 SMESG000045239.1 SMESG000042816.1 SMESG000042302.1 SMESG000040193.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000006220.1 SMESG000005221.1 Contig20519uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromo domain-containing protein vs. TrEMBL
Match: A0A3C1P802 (Uncharacterized protein OS=Planktothrix sp. UBA8402 OX=2055759 GN=DCQ63_02380 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 5.021e-30
Identity = 70/160 (43.75%), Postives = 99/160 (61.88%), Query Frame = 3
Query:    3 SSHRGLNVLRPVDI---------------SSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKD-SDNNVIQGKFYEQELQVI--SKPTVFRIQKILKTKMVGKDKQYYVKWHGYQ--KPSWISSKDLVK 422
            +SHR L    PVD+                  T V+ ++ T+    Y VG  VRIS+IS SPF KNFD NWS+E+F+I  ++    PVMYV+KD + + +I+GKFY +ELQ +  S P V+RI+KI++TK  G+ KQY+VKW+G+   + SWI+   LVK
Sbjct:  211 ASHRSLKGKSPVDLYVNDPNNLNDWLHQQQKDTNVRKRRQTL----YSVGSLVRISRISTSPFRKNFDQNWSEEIFRIASVDKASKPVMYVLKDVATDELIEGKFYHEELQDVGDSLPNVYRIEKIIRTKGKGEHKQYFVKWYGFNDSRNSWITKDQLVK 366          
BLAST of Chromo domain-containing protein vs. TrEMBL
Match: A0A1Y1KRZ5 (Chromo domain-containing protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.513e-22
Identity = 58/117 (49.57%), Postives = 81/117 (69.23%), Query Frame = 3
Query:   84 TKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVIS--KPTVFRIQKILKTKMVGKDKQYYVKWHGYQKP--SWISSKDLVK 422
             +PKYKVG HVRI++ S   F K ++SN+S EVF+I K+  ++ PV Y I D +   I+G FYE+ELQV++  + TVF+I KIL+ K  GK+K+Y VKW GY +   SWIS+ +L K
Sbjct:   46 AQPKYKVGQHVRIAR-SKHHFEKGYESNFSQEVFKIVKVINRRPPV-YRIVDLNGEDIEGTFYEEELQVVTLDENTVFKIDKILEEKGRGKNKKYLVKWKGYSEKFNSWISASELKK 160          
BLAST of Chromo domain-containing protein vs. TrEMBL
Match: A0A5N4AMP8 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_09536 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.107e-20
Identity = 58/117 (49.57%), Postives = 81/117 (69.23%), Query Frame = 3
Query:   84 TKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVIS--KPTVFRIQKILKTKMVGKDKQYYVKWHGYQKP--SWISSKDLVK 422
             +PKYKVG HVRI++ S   F K ++SN+S EVF+I K+  ++ PV Y I D +   I+G FYE+ELQV++  + TVF+I KIL+ K  GK+K+Y VKW GY +   SWIS+ +L K
Sbjct:  236 AQPKYKVGQHVRIAR-SKHHFEKGYESNFSQEVFKIVKVINRRPPV-YRIVDLNGEDIEGTFYEEELQVVTLDENTVFKIDKILEEKGRGKNKKYLVKWKGYSEKFNSWISASELKK 350          
BLAST of Chromo domain-containing protein vs. TrEMBL
Match: A0A151IZ96 (Chromo domain-containing protein OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_13584 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.914e-20
Identity = 50/132 (37.88%), Postives = 81/132 (61.36%), Query Frame = 3
Query:   39 DISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVISK---PTVFRIQKILKTKMVGKDKQYYVKWHGYQK--PSWISSKDLV 419
            +I+ + + ++ K  + K KY+VGDHVRIS+  A+ F K +++NWS+E+FQI ++   ++P +Y ++D    VI G FYEQEL  + K      F + +++K+K  G +KQ  V W GY     SWI +  L+
Sbjct:   17 NIARRWKNETLKKRVRKVKYRVGDHVRISRAKAA-FEKGYEANWSEEIFQIYRVLDWRNPRVYELRDLAGEVIDGIFYEQELARVEKNVEEEQFIVDRVIKSKGRGANKQVLVSWRGYPSKFDSWIPASSLI 147          
BLAST of Chromo domain-containing protein vs. TrEMBL
Match: A0A1Y1N5I8 (Uncharacterized protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.209e-18
Identity = 54/115 (46.96%), Postives = 77/115 (66.96%), Query Frame = 3
Query:   84 TKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVIS--KPTVFRIQKILKTKMVGKDKQYYVKWHGYQKP--SWISSKDL 416
            T+P YKVG HVRI++ +   F K ++SN+S EVF+I K+  K+ P +Y I D     I+G FYE+ELQ ++  + TVF+I +IL+ K  GK+K+Y VKW GY     SWIS+ +L
Sbjct:  236 TRPIYKVGQHVRITR-TKYHFEKGYESNFSQEVFKIIKV-IKRRPPVYRIVDLSGEDIEGTFYEEELQAVTIDEDTVFKIDEILEEKGRGKNKKYLVKWRGYSDKFNSWISAAEL 348          
BLAST of Chromo domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055500.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001032.1:12601:13692:-1 gene:ENSAMXG00000041341.1 transcript:ENSAMXT00000055500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 2.200e-16
Identity = 46/113 (40.71%), Postives = 70/113 (61.95%), Query Frame = 3
Query:   93 KYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQ--VISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKP--SWISSKDLV 419
            K+K+GD VRIS++ A  F K ++ N++DE F I++   +  PV Y + D+D   I G FYE ELQ  ++ K   F+I+KI++ +M  + K   VKW G+     SWI +KD+V
Sbjct:  248 KFKIGDVVRISRLKAH-FEKGYEQNYTDEYFTISERIPRDPPV-YKLHDADGEEITGTFYEPELQKIIVGKDKSFKIEKIIQERMQNRKKMCLVKWVGWPDKFNSWIPAKDIV 358          
BLAST of Chromo domain-containing protein vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 261.536 bits (667), Expect = 1.051e-103
Identity = 128/131 (97.71%), Postives = 129/131 (98.47%), Query Frame = 3
Query:    3 SSHRGLNVLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKPS 395
            SSHRGLN LRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNN+IQGKFYEQELQVISKPTVFRIQKILK KMVGKDKQYYVKWHGYQKPS
Sbjct:  399 SSHRGLNGLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNLIQGKFYEQELQVISKPTVFRIQKILKIKMVGKDKQYYVKWHGYQKPS 529          

HSP 2 Score: 91.6633 bits (226), Expect = 1.051e-103
Identity = 54/67 (80.60%), Postives = 58/67 (86.57%), Query Frame = 2
Query:  443 PSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQXXXXXXXXXXXXSQCKINYKRNVRKKSSCIL 643
            PSNSCPLIHPENQASKFMV+LQNP+YLHGNWEVALQDFTF Y+TFPFYS CKI YK+ V K  S I 
Sbjct:  528 PSNSCPLIHPENQASKFMVNLQNPMYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIF 594          

HSP 3 Score: 63.929 bits (154), Expect = 1.051e-103
Identity = 27/36 (75.00%), Postives = 32/36 (88.89%), Query Frame = 1
Query:  643 ERYYHIPNQLLDEHCQMFYRDGLNISCDFSPFTIIF 750
            ERY HIPNQ+LDE+  MF++DGLN+SCDFSPFTI F
Sbjct:  600 ERYCHIPNQILDENSGMFFKDGLNVSCDFSPFTIKF 635          
BLAST of Chromo domain-containing protein vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 261.922 bits (668), Expect = 1.088e-103
Identity = 128/131 (97.71%), Postives = 129/131 (98.47%), Query Frame = 3
Query:    3 SSHRGLNVLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKPS 395
            SSHRGLN LRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNN+IQGKFYEQELQVISKPTVFRIQKILK KMVGKDKQYYVKWHGYQKPS
Sbjct:  198 SSHRGLNGLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNLIQGKFYEQELQVISKPTVFRIQKILKIKMVGKDKQYYVKWHGYQKPS 328          

HSP 2 Score: 91.6633 bits (226), Expect = 1.088e-103
Identity = 54/67 (80.60%), Postives = 58/67 (86.57%), Query Frame = 2
Query:  443 PSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQXXXXXXXXXXXXSQCKINYKRNVRKKSSCIL 643
            PSNSCPLIHPENQASKFMV+LQNP+YLHGNWEVALQDFTF Y+TFPFYS CKI YK+ V K  S I 
Sbjct:  327 PSNSCPLIHPENQASKFMVNLQNPMYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIF 393          

HSP 3 Score: 63.929 bits (154), Expect = 1.088e-103
Identity = 27/37 (72.97%), Postives = 32/37 (86.49%), Query Frame = 1
Query:  640 FERYYHIPNQLLDEHCQMFYRDGLNISCDFSPFTIIF 750
             ERY HIPNQ+LDE+  MF++DGLN+SCDFSPFTI F
Sbjct:  398 IERYCHIPNQILDENSGMFFKDGLNVSCDFSPFTIKF 434          
BLAST of Chromo domain-containing protein vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 261.536 bits (667), Expect = 1.142e-103
Identity = 128/131 (97.71%), Postives = 129/131 (98.47%), Query Frame = 3
Query:    3 SSHRGLNVLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKPS 395
            SSHRGLN LRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNN+IQGKFYEQELQVISKPTVFRIQKILK KMVGKDKQYYVKWHGYQKPS
Sbjct:  198 SSHRGLNGLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNLIQGKFYEQELQVISKPTVFRIQKILKIKMVGKDKQYYVKWHGYQKPS 328          

HSP 2 Score: 91.6633 bits (226), Expect = 1.142e-103
Identity = 54/67 (80.60%), Postives = 58/67 (86.57%), Query Frame = 2
Query:  443 PSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQXXXXXXXXXXXXSQCKINYKRNVRKKSSCIL 643
            PSNSCPLIHPENQASKFMV+LQNP+YLHGNWEVALQDFTF Y+TFPFYS CKI YK+ V K  S I 
Sbjct:  327 PSNSCPLIHPENQASKFMVNLQNPMYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIF 393          

HSP 3 Score: 63.929 bits (154), Expect = 1.142e-103
Identity = 27/37 (72.97%), Postives = 32/37 (86.49%), Query Frame = 1
Query:  640 FERYYHIPNQLLDEHCQMFYRDGLNISCDFSPFTIIF 750
             ERY HIPNQ+LDE+  MF++DGLN+SCDFSPFTI F
Sbjct:  398 IERYCHIPNQILDENSGMFFKDGLNVSCDFSPFTIKF 434          
BLAST of Chromo domain-containing protein vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 253.447 bits (646), Expect = 3.079e-101
Identity = 124/127 (97.64%), Postives = 125/127 (98.43%), Query Frame = 3
Query:   15 GLNVLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKPS 395
            GLN LRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNN+IQGKFYEQELQVISKPTVFRIQKILK KMVGKDKQYYVKWHGYQKPS
Sbjct:  130 GLNGLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNLIQGKFYEQELQVISKPTVFRIQKILKIKMVGKDKQYYVKWHGYQKPS 256          

HSP 2 Score: 91.6633 bits (226), Expect = 3.079e-101
Identity = 54/67 (80.60%), Postives = 58/67 (86.57%), Query Frame = 2
Query:  443 PSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQXXXXXXXXXXXXSQCKINYKRNVRKKSSCIL 643
            PSNSCPLIHPENQASKFMV+LQNP+YLHGNWEVALQDFTF Y+TFPFYS CKI YK+ V K  S I 
Sbjct:  255 PSNSCPLIHPENQASKFMVNLQNPMYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIF 321          

HSP 3 Score: 63.929 bits (154), Expect = 3.079e-101
Identity = 27/37 (72.97%), Postives = 32/37 (86.49%), Query Frame = 1
Query:  640 FERYYHIPNQLLDEHCQMFYRDGLNISCDFSPFTIIF 750
             ERY HIPNQ+LDE+  MF++DGLN+SCDFSPFTI F
Sbjct:  326 IERYCHIPNQILDENSGMFFKDGLNVSCDFSPFTIKF 362          
BLAST of Chromo domain-containing protein vs. Planmine SMEST
Match: SMESG000065288.1 (SMESG000065288.1)

HSP 1 Score: 272.707 bits (696), Expect = 1.059e-83
Identity = 132/139 (94.96%), Postives = 136/139 (97.84%), Query Frame = 3
Query:    3 SSHRGLNVLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKPSWISSKDLV 419
            SSHRGLN LRPVDISSKTRVQSKKV IT PKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNN+I+GKFYEQELQVISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKPSWISS+DL+
Sbjct:  349 SSHRGLNGLRPVDISSKTRVQSKKVAITTPKYKVGDHVRISKISASPFIKNFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNLIKGKFYEQELQVISKPTVFRIQKILKTKMVGKDKQYYVKWHGYQKPSWISSRDLI 487          
The following BLAST results are available for this feature:
BLAST of Chromo domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3C1P8025.021e-3043.75Uncharacterized protein OS=Planktothrix sp. UBA840... [more]
A0A1Y1KRZ51.513e-2249.57Chromo domain-containing protein (Fragment) OS=Pho... [more]
A0A5N4AMP81.107e-2049.57Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A151IZ965.914e-2037.88Chromo domain-containing protein OS=Trachymyrmex c... [more]
A0A1Y1N5I81.209e-1846.96Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000055500.12.200e-1640.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromo domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029226.11.051e-10397.71SMESG000029226.1[more]
SMESG000029226.11.088e-10397.71SMESG000029226.1[more]
SMESG000029226.11.142e-10397.71SMESG000029226.1[more]
SMESG000029226.13.079e-10197.64SMESG000029226.1[more]
SMESG000065288.11.059e-8394.96SMESG000065288.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003568 ID=SMED30003568|Name=Chromo domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=751bp
ATTCATCACATCGAGGTCTGAATGTTTTGAGACCCGTAGATATCAGCTCA
AAAACACGAGTACAGTCTAAAAAAGTTACTATTACAAAACCAAAATATAA
AGTTGGTGATCACGTTAGAATTAGTAAAATATCTGCTTCACCTTTCATCA
AAAATTTCGATAGTAATTGGAGTGATGAGGTATTTCAAATTACTAAAATT
AATACTAAACAGAGTCCTGTAATGTATGTTATTAAAGATAGTGATAACAA
TGTAATACAAGGGAAATTCTATGAACAGGAATTACAAGTTATTTCCAAAC
CTACAGTGTTCAGAATTCAGAAAATATTGAAAACTAAAATGGTGGGTAAG
GATAAACAATACTATGTCAAATGGCATGGATATCAAAAACCCTCATGGAT
ATCATCAAAAGACCTAGTAAAATGAGTTTCTATACAATTTTACCGAGTAA
TAGTTGCCCACTAATCCATCCGGAAAATCAAGCAAGTAAATTTATGGTTG
ATCTTCAAAATCCCATTTATTTACATGGAAATTGGGAAGTTGCTTTGCAA
GACTTTACATTTTAATACGACACATTCCCATTTTATAGTCAATGTAAAAT
CAATTACAAGAGGAATGTTCGCAAAAAAAGTAGTTGTATTTTGAACGATA
TTATCATATTCCGAATCAATTGTTAGATGAGCATTGTCAAATGTTTTACA
GAGATGGATTAAATATTAGTTGCGATTTTTCTCCATTTACAATAATATTT
G
back to top

protein sequence of SMED30003568-orf-1

>SMED30003568-orf-1 ID=SMED30003568-orf-1|Name=SMED30003568-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
SSHRGLNVLRPVDISSKTRVQSKKVTITKPKYKVGDHVRISKISASPFIK
NFDSNWSDEVFQITKINTKQSPVMYVIKDSDNNVIQGKFYEQELQVISKP
TVFRIQKILKTKMVGKDKQYYVKWHGYQKPSWISSKDLVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000953Chromo/chromo_shadow_dom
IPR016197Chromo-like_dom_sf