Teneurin-2

Overview
NameTeneurin-2
Smed IDSMED30003560
Length (bp)8949
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Teneurin-2 (SMED30003560) t-SNE clustered cells

Violin plots show distribution of expression levels for Teneurin-2 (SMED30003560) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Teneurin-2 (SMED30003560) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Teneurin-2 (SMED30003560) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003560

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003560SMESG000016735.1 dd_Smed_v4_5439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003560SMESG000016735.1 dd_Smed_v4_5439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30003560SMESG000016735.1 dd_Smed_v4_5439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003560SMESG000016735.1 dd_Smed_v4_5439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003560SMESG000016735.1 dd_Smed_v4_5439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003560SMESG000016735.1 Contig52548uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003560SMESG000016735.1 Contig52548newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30003560SMESG000016735.1 dd_Smed_v4_5439_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Teneurin-2 vs. Ensembl Human
Match: TENM3 (teneurin transmembrane protein 3 [Source:HGNC Symbol;Acc:HGNC:29944])

HSP 1 Score: 544.658 bits (1402), Expect = 1.642e-155
Identity = 391/1316 (29.71%), Postives = 612/1316 (46.50%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFE-----RISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKV-------------------EGDAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  + F +    + FN ++     +G++ R    P+  +Y   E     R+  R  R +L      R  RS++        GF+ YL+ G+W L+  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G G C+ G C C  GY G++C    C    CS +GVC  +G C C  GW   +C   K+   D+ S    +   +G       C C   ++G  C   +CS  C +    + GTC C EG++G  C +R C  RC +HG C +G C C +GWNG+HCT++GCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+    L +   +   +F+++I FL     T         N+   SV+RG+V+ +DG+P  G  +        G+T T +DG+FDLV  GG+ + L   R P    T Y+ V++P N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  ++ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    ++ I G  G+ R +  C  C+G+       +  A+     G + + D  Y+R +  +GN     ++ S     +             +LA    +P V  DL   +    +IY  +SL+G+      +L K+  +V   GE C    E  C      +   L+ PKGM +     ++F DG  I+ +   N  I T++G     +  +R   C + +  S+ RL+WPT +  N +D+SIY +DN N+V ++  +N  V   AG    C  P +E       A++        I ++  G L+I E     I     V +DG +  V                    GD   K A   + +S+  +  G L +AD G  +I +V   + +  +   Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S +  ++ +   +GN   ++ RD      ++ +P      +T+     + ++ A       F Y+    L++  +S E     F  Y   GRL +V  P+GV T
Sbjct:  404 WRSQLFIDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRSLLETERAGRQARSVSLH----EAGFIQYLDSGIWHLAFYNDGKNAEQVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGESCEEADCIDPGCSNHGVCI-HGECHCSPGWGGSNCEILKTMCPDQCSGHGTYLQESGS------CTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSC----QNQPYC-RGLPDPQDIISQSLQSPSQQAAKSFYDRISFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGYTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIPWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPNPIIVSSPLSTFFRSSPEDS-PIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQSIIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVSSIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVLELSSNPAHRY-------------YLA---TDP-VTGDLYVSDTNTRRIYRPKSLTGA-----KDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAVDKNGLIYFVDGTMIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDN-NVVLQI-TENRQVRIAAGRPMHCQVPGVEYPVGK-HAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLSAPSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSY---SNDNDITAVTDSNGN-TLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLAT-KSDETGWTTFFDYDSEGRLTNVTFPTGVVT 1649          

HSP 2 Score: 136.346 bits (342), Expect = 7.953e-31
Identity = 151/644 (23.45%), Postives = 286/644 (44.41%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  ++NG+N L V +D  ++ E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      +++YD   R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  +     ++ F Y    +L  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I       Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I + YD    N   V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L  ++ A   P+ Y + D  T L    G V Y  ++DGFL Q+      E F Y++ GLL       S   ++    Y YD   R +  +  +   Q  Q+FY D     R+TH+Y+H+S +++S YY+   GHLF++ +     +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD
Sbjct: 1765 RKLRVNGRNLLSVDFDRTTKTE--KIYDDHR-KFLLRIAYDTSGHPTLWLP---SSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFA-DGKTWSYTY-----LEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNE-EGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDIS--GKVEQFGKFGVIYYDINQIISTAVMTYTKHF-----DAHGRIKEIQYEIFRSLMYWITIQYD----NMGRVTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTPLRYDLRDRITRL----GDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKGSGWTVI----YRYDGLGRRVSSKTSL--GQHLQFFYADLTYPTRITHVYNHSSSEITSLYYD-LQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNIDFQLVIGFHGGLYDPLTKLIHFGERDYD 2358          
BLAST of Teneurin-2 vs. Ensembl Human
Match: TENM2 (teneurin transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:29943])

HSP 1 Score: 540.806 bits (1392), Expect = 2.313e-154
Identity = 384/1329 (28.89%), Postives = 602/1329 (45.30%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRA-WRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVI-----NPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  +   +    + FN ++      G+++R    P+  +Y   ER+ G+  W  V       R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+         DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C    Q       S   +D +          +   +F+++I+ L  +  T         N   +S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       A   + I+P           +  VL   ++L  + +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR                    +F ++   ++  L     KH NNP  +   LA +P    +Y+S++ S  I+ +       +L  +  +V   GE C    E  C      I   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  346 WRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV----ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GVCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCSAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDTG------LCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIGRQTAGTETDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSAC----QNSLLCRGSRDPLDIIQQGQTDWPAVK---SFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGASLTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSAAPGQNPIVP-----------ETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIR-------------------RIFPSRNVTSILELRNKEFKHSNNP-AHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGTKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---STDNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1600          

HSP 2 Score: 140.969 bits (354), Expect = 3.480e-32
Identity = 167/690 (24.20%), Postives = 293/690 (42.46%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   D    V K++   +  GF    ++   GPLV +  Y       S++ +  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  KNV   P   N Y F
Sbjct: 1716 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGY-DETTGVLKMVNLQS-GGFSCTIRYRKIGPLVDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWKNVGKEPAPFNLYMF 2339          
BLAST of Teneurin-2 vs. Ensembl Human
Match: TENM2 (teneurin transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:29943])

HSP 1 Score: 540.421 bits (1391), Expect = 4.105e-154
Identity = 382/1316 (29.03%), Postives = 599/1316 (45.52%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVI-----NPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            + FN ++      G+++R    P+  +Y   ER+ G+    V+      R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+         DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C    Q       S   +D +          +   +F+++I+ L  +  T         N   +S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       A   + I+P           +  VL   ++L  + +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR                    +F ++   ++  L     KH NNP  +   LA +P    +Y+S++ S  I+ +       +L  +  +V   GE C    E  C      I   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  479 LKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV---ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GVCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCSAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDTG------LCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIGRQTAGTETDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSAC----QNSLLCRGSRDPLDIIQQGQTDWPAVK---SFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGASLTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSAAPGQNPIVP-----------ETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIR-------------------RIFPSRNVTSILELRNKEFKHSNNP-AHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGTKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---STDNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1721          

HSP 2 Score: 141.739 bits (356), Expect = 1.911e-32
Identity = 165/690 (23.91%), Postives = 295/690 (42.75%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   ++  ++ K++   +  GF    ++   GPLV +  Y       S++ +  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  KNV   P   N Y F
Sbjct: 1837 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVL-KMVNLQS-GGFSCTIRYRKIGPLVDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWKNVGKEPAPFNLYMF 2460          
BLAST of Teneurin-2 vs. Ensembl Human
Match: TENM2 (teneurin transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:29943])

HSP 1 Score: 536.184 bits (1380), Expect = 3.901e-153
Identity = 379/1321 (28.69%), Postives = 598/1321 (45.27%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  +   +    + FN ++      G+++R    P+  +Y   ER+ G+    V+      R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+         DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C  +          C    D   ++   +   P   +F+++I+ L  +  T         N   +S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       A   + I+P           +  VL   ++L  + +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR +  + N           +   +  R N      + +     +  V++       +IY  +SLSG+      +L  +  +V   GE C    E  C      I   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  235 WRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV---ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GVCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCSAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDTG------LCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIGRQTAGTETDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNS--------LLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGASLTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSAAPGQNPIVP-----------ETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIRRIFPSRN-----------VTSILELRNNPAHKYYLAVDPVSGSLYVSD---TNSRRIYRVKSLSGT-----KDLAGNSEVVAGTGEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---STDNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1482          

HSP 2 Score: 140.969 bits (354), Expect = 2.898e-32
Identity = 167/690 (24.20%), Postives = 293/690 (42.46%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   D    V K++   +  GF    ++   GPLV +  Y       S++ +  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  KNV   P   N Y F
Sbjct: 1598 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGY-DETTGVLKMVNLQS-GGFSCTIRYRKIGPLVDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWKNVGKEPAPFNLYMF 2221          
BLAST of Teneurin-2 vs. Ensembl Human
Match: TENM4 (teneurin transmembrane protein 4 [Source:HGNC Symbol;Acc:HGNC:29945])

HSP 1 Score: 501.901 bits (1291), Expect = 3.578e-142
Identity = 377/1330 (28.35%), Postives = 600/1330 (45.11%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGR-AWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESC---PKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQ-IFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIW-----VINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQI-FSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMF 5440
            W  + F +H  ++ FN ++     +GI+ R    P+  ++   E + GR    Q      G   +        S  TGF+ YL+ G+W L+  ND    E + F L T +     CP  C  +G C   G C CF GF G DC +   P +CSG+G Y +G C C+  WKG EC     +C    CS +G C++G C+C  GY G++C  + C    CS  GVC R G C C  GW   +C   ++   D+ S    F  + G      +C C   ++G  C   +C+  C      V GTC C +G+ G  C +R C  RC +HG C +G C C  GWNG+HCT+         +GCP  CN NG+C L+    ++C C   W+G  C+ S E+ C D  DND DGL DC DPDCC    C        +    C   P   D+          +   +F+++I+FL  R  T         +     V+RG+V+ SDG+P  G  I      + G+T + +DG FDLV  GG  + L   R P    T  + +++P + F     F ++ +++    +    P C   + +  +  V   P  L  ++S        +   +  +   L   + +    ++L + SSR  G+KS L + L    +P NL +++L + V G+   +     P L+Y F WD+ + Y + +FGL+   V VGY YE+C   I WE + TV+ G+++ A  +G W+L+  H  +   GI+++G+G + F++Q    I  I G  G+ R +  C  C+G        +  A+     G + + D  YIR +  +GN                     N+  L     +H ++P  +   LA +P    ++LS+S S  ++     V+  +L K+  +V   G+ C    +  C          L +P+G+T+     ++F DG  I+ I   N  I T++G     +  +R   C S +  S+  L+WPT +  N +D+S+Y +DN N+V ++  +N  V  VAG    C  P ++    + +AI         + ++  G L+IAE     I     V + G +  V G                   D   K A   + +S+ +   GEL VAD G  +I F    K  +    +Y++ SP  +ELY F++ G+H  T S  TG  LY+  Y   + +G ++ I   +GN+   V RD+      L  P G  Y VT+     + ++              +  +   +S+E     F  Y   GRL +V  P+G  + F
Sbjct:  452 WRSQVFIDHPVHLKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGTPRQSRGTVPPSSHETGFIQYLDSGIWHLAFYNDGKESEVVSF-LTTAIESVDNCPSNCYGNGDCIS-GTCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSNHGTCITGTCICNPGYKGESCEEVDCMDPTCSGRGVCVR-GECHCSVGWGGTNCETPRATCLDQCSGHGTFLPDTG------LCSCDPSWTGHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLD-LNGWHCVCQLGWRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLC--------HINPLCLGSPNPLDIIQETQVPVSQQNLHSFYDRIKFLVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFVNNPLFGYTISRQDGSFDLVTNGGISIILRFERAP--FITQEHTLWLPWDRF-----FVMETIIMRHEEN--EIPSCDLSNFARPNPVV--SPSPLTSFASSC-----AEKGPIVPEIQALQEEISISGCKMRLSYLSSRTPGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVYNQKVFGLSEAFVSVGYEYESCPDLILWEKRTTVLQGYEIDASKLGGWSLDKHHALNIQSGILHKGNGENQFVSQQPPVIGSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALTCGSDGSLYVGDFNYIRRIFPSGNV-------------------TNILELRNKDFRHSHSP-AHKYYLATDPMSGAVFLSDSNSRRVFKIKSTVVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKFGLIYFVDGTMIRRID-QNGIISTLLGSNDLTS--ARPLSCDSVMDISQVHLEWPTDLAINPMDNSLYVLDN-NVVLQIS-ENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHNGVLYIAETDEKKINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNTPSSLAVCADGELYVADLGNIRIRFIRKNKPFLNTQNMYELSSPIDQELYLFDTTGKHLYTQSLPTGDYLYNFTY---TGDGDITLITDNNGNM-VNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVTTQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSF 1716          

HSP 2 Score: 126.331 bits (316), Expect = 8.657e-28
Identity = 146/660 (22.12%), Postives = 280/660 (42.42%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNR-TSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSS--MEILNFRFSYYKDSSLILNAYSADS-IQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLL-QEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  +++ +N L + +D  +R E   +Y++ + K  ++ +Y+   Q  +   +   + L  + V Y+  G +  I+       + YD   R TS I+       + Y+        K   +   + ++Y   ++  D+  S+  PN    +++ + S+GY R +Y+P   +++ I DF   +G+L    Y     ++ + Y   ++L   +Y   ++ F   ++  ++ K I   N  GF    ++   GPL   ID ++   T    +   +++  Y+YD+  ++  +  ++ + P      R +   V     Q  ++    ++IN                      QI+T ++ M ++K         D    +    Y+I RS    M +            L +  Y+  +   Y+Y  DG+L ++ +N      Y YD N  L                     +   G V Y  ++DGFL Q R G   + F YN+ GLL + Y R  S S     V Y YD   R +  +         Q+FY D  N  ++TH+Y+H+S +++S YY+   GHLF++ +     +Y+  D +G+P  + S    ++ +  Y  +GE     + +  + IG+ G ++D  + ++ M  R YD
Sbjct: 1829 RRLRVHNRNLLSLDFDRVTRTE--KIYDDHR-KFTLRILYD---QAGRPSLWSPSSRLNGVNVTYSPGGYIAGIQRGIMSERMEYDQAGRITSRIFADGKTWSYTYL-------EKSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVARQTLETIRSVGYYRNIYQPPEGNASVIQDFTE-DGHLLHTFYLGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGML-KTINLQNE-GFTCTIRYRQIGPL---IDRQIFRFTEEGMV---NARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDD--VSGKTEQFGKFGVIYYDIN----------------------QIITTAV-MTHTK-------HFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRLGDVQYKMDEDGFLRQ-RGG---DIFEYNSAGLLIKAYNRAGSWS-----VRYRYDGLGRRVSSKSSH--SHHLQFFYADLTNPTKVTHLYNHSSSEITSLYYD-LQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILYTAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYD 2422          
BLAST of Teneurin-2 vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 412.535 bits (1059), Expect = 3.028e-115
Identity = 352/1365 (25.79%), Postives = 600/1365 (43.96%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHF-----ERISGRAWRQVLIDNNGNRVKRSLN---------EQYFSESTGFVHYLEKGLWFLSVINDQPREENIQF--------TLNTKMSMKQT-------------CPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDC-VSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCS----------------------------------------KRKSDKQ------------SARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCI-EGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNH-AMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAE--ESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRK----YTTKS-LNQKKISVVRGKVI---QSDGS------------PFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYY-NVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSV---IGGPRILADW--SSDIIPIYNT-DSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC---SQIFWETKMTVINGHDLVAKDIGN-WNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVIN---PELEK--HKLLVGE---------SCKERTCIR-QKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC----PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK--------------RTVWIVKSDGY--------------LYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHR-----DTQSRATQLETPSGINYNVTLDE 5260
            I FN T+ +   L + +     P++  +        +RI        +++  G+R +RSL          E     S  F  ++ +G  +L+ IN++ R E I F        T   K S   T             C   CN+ G C   GKC C  GF G+ C +   P VCSG+G +  G C C   +KGKEC+     CE  DC+G G C   G C C  G++G+ C    CP ++C + GVC  NG C C  GW   DCS                                        K+K  ++            +  S+ C  +G+L   D+C C  G+    C ++ C  +C NG C  +G+C C +G+ G  C  + C   C   G+C  +G+C C  GWNG++C +DGCP  C+  G+C ++  + E+ C C     G+ C++S E  CDDG+DND+DGL DC DP+CC +  C   +     A   E   +M  +             + F +++ FL   K    YT  S  N+  ISV+RG+V+      GS            P  G R+ D    + G T T +DG FDL V G   V L+ +R    +F     +V+V   + ++I D  L         SG + P           S     I    ++++W  +SD I    T DS  +  D+  +  S+ ++ T ++L++ S+R     S++L+ L+   V + L+++++ I +AG+   + L P   LTY F WD++NAY +   GL  V VRVGY Y+ C   S+  W+T+ + + G     K IG  W L+  H  D  + +V  G+G +  +T+   +++  +G  G  R    C++C+G+    + +    ++    G ++I D   IR +++ G                          L++ LA   ++  +    + G   I +S  L   +W I+   P+  +  + +L G+         SC +    +  +L+ PKG++     +L+ AD R I++I  T       IG+ +   +   +  C       + +++WPTS+  + I  S+  +D  N+VY + + + +VT   G+   C     +  ++++++   RH   + RDI +   G +++ E               R+ + + + G                  +   A ++    S  ++ ++  G++I+AD+G  +I  V  + A    ++  Y+V   + +E Y+FN  GQH  T S ITG   ++  Y+++S    +S+I + SG +   + R     D ++   Q  T +   Y+ TL++
Sbjct:  304 IRFNATVGSGAQLVLLMSAGVHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATFEQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCNQRGECVH-GKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCV-NGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQL-IDDICQCESGWDSVDCSQQAC--QCVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPIEVLMRMPPIF-----------NANFAQRVGFLIMEKSVQSYTDSSQFNENLISVIRGRVMWGGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFLR---TQFQSVKKSVFVSPRQIIHIDDIVLY------RQSGGSPPAISMAPARAKCSPTLRRIPDVVLISNWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLYDRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYEYQGCDRTSERVWQTRRSQMMGA-TARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITESEPRVSTFAGLDGVKRDVE-CLKCEGKVDSISLFRPTTVVYAQDGSLIIGDHNMIRRVSQDGQVSTI---------------------LTLGLADTSHSYYIAVSPVDG--TIAISLPLHKQVWRISSLEPQDSRNNYDVLAGDGTVCASAVDSCGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHI--RSIGETTP--DQHPIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDT-NVVYEIDVVHDVVTIALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKLSSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIADSGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQVDSPISMISEIRAASGVVLRVLKRNDSLFDLETTLGQRTTLTMSAYDGTLEQ 1613          
BLAST of Teneurin-2 vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 412.535 bits (1059), Expect = 3.697e-115
Identity = 352/1365 (25.79%), Postives = 600/1365 (43.96%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHF-----ERISGRAWRQVLIDNNGNRVKRSLN---------EQYFSESTGFVHYLEKGLWFLSVINDQPREENIQF--------TLNTKMSMKQT-------------CPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDC-VSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCS----------------------------------------KRKSDKQ------------SARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCI-EGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNH-AMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAE--ESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRK----YTTKS-LNQKKISVVRGKVI---QSDGS------------PFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYY-NVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSV---IGGPRILADW--SSDIIPIYNT-DSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC---SQIFWETKMTVINGHDLVAKDIGN-WNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVIN---PELEK--HKLLVGE---------SCKERTCIR-QKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC----PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK--------------RTVWIVKSDGY--------------LYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHR-----DTQSRATQLETPSGINYNVTLDE 5260
            I FN T+ +   L + +     P++  +        +RI        +++  G+R +RSL          E     S  F  ++ +G  +L+ IN++ R E I F        T   K S   T             C   CN+ G C   GKC C  GF G+ C +   P VCSG+G +  G C C   +KGKEC+     CE  DC+G G C   G C C  G++G+ C    CP ++C + GVC  NG C C  GW   DCS                                        K+K  ++            +  S+ C  +G+L   D+C C  G+    C ++ C  +C NG C  +G+C C +G+ G  C  + C   C   G+C  +G+C C  GWNG++C +DGCP  C+  G+C ++  + E+ C C     G+ C++S E  CDDG+DND+DGL DC DP+CC +  C   +     A   E   +M  +             + F +++ FL   K    YT  S  N+  ISV+RG+V+      GS            P  G R+ D    + G T T +DG FDL V G   V L+ +R    +F     +V+V   + ++I D  L         SG + P           S     I    ++++W  +SD I    T DS  +  D+  +  S+ ++ T ++L++ S+R     S++L+ L+   V + L+++++ I +AG+   + L P   LTY F WD++NAY +   GL  V VRVGY Y+ C   S+  W+T+ + + G     K IG  W L+  H  D  + +V  G+G +  +T+   +++  +G  G  R    C++C+G+    + +    ++    G ++I D   IR +++ G                          L++ LA   ++  +    + G   I +S  L   +W I+   P+  +  + +L G+         SC +    +  +L+ PKG++     +L+ AD R I++I  T       IG+ +   +   +  C       + +++WPTS+  + I  S+  +D  N+VY + + + +VT   G+   C     +  ++++++   RH   + RDI +   G +++ E               R+ + + + G                  +   A ++    S  ++ ++  G++I+AD+G  +I  V  + A    ++  Y+V   + +E Y+FN  GQH  T S ITG   ++  Y+++S    +S+I + SG +   + R     D ++   Q  T +   Y+ TL++
Sbjct:  457 IRFNATVGSGAQLVLLMSAGVHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATFEQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCNQRGECVH-GKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCV-NGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQL-IDDICQCESGWDSVDCSQQAC--QCVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPIEVLMRMPPIF-----------NANFAQRVGFLIMEKSVQSYTDSSQFNENLISVIRGRVMWGGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFLR---TQFQSVKKSVFVSPRQIIHIDDIVLY------RQSGGSPPAISMAPARAKCSPTLRRIPDVVLISNWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLYDRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYEYQGCDRTSERVWQTRRSQMMGA-TARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITESEPRVSTFAGLDGVKRDVE-CLKCEGKVDSISLFRPTTVVYAQDGSLIIGDHNMIRRVSQDGQVSTI---------------------LTLGLADTSHSYYIAVSPVDG--TIAISLPLHKQVWRISSLEPQDSRNNYDVLAGDGTVCASAVDSCGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHI--RSIGETTP--DQHPIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDT-NVVYEIDVVHDVVTIALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKLSSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIADSGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQVDSPISMISEIRAASGVVLRVLKRNDSLFDLETTLGQRTTLTMSAYDGTLEQ 1766          
BLAST of Teneurin-2 vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 412.149 bits (1058), Expect = 4.125e-115
Identity = 352/1365 (25.79%), Postives = 600/1365 (43.96%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHF-----ERISGRAWRQVLIDNNGNRVKRSLN---------EQYFSESTGFVHYLEKGLWFLSVINDQPREENIQF--------TLNTKMSMKQT-------------CPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDC-VSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCS----------------------------------------KRKSDKQ------------SARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCI-EGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNH-AMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAE--ESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRK----YTTKS-LNQKKISVVRGKVI---QSDGS------------PFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYY-NVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSV---IGGPRILADW--SSDIIPIYNT-DSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC---SQIFWETKMTVINGHDLVAKDIGN-WNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVIN---PELEK--HKLLVGE---------SCKERTCIR-QKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC----PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK--------------RTVWIVKSDGY--------------LYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHR-----DTQSRATQLETPSGINYNVTLDE 5260
            I FN T+ +   L + +     P++  +        +RI        +++  G+R +RSL          E     S  F  ++ +G  +L+ IN++ R E I F        T   K S   T             C   CN+ G C   GKC C  GF G+ C +   P VCSG+G +  G C C   +KGKEC+     CE  DC+G G C   G C C  G++G+ C    CP ++C + GVC  NG C C  GW   DCS                                        K+K  ++            +  S+ C  +G+L   D+C C  G+    C ++ C  +C NG C  +G+C C +G+ G  C  + C   C   G+C  +G+C C  GWNG++C +DGCP  C+  G+C ++  + E+ C C     G+ C++S E  CDDG+DND+DGL DC DP+CC +  C   +     A   E   +M  +             + F +++ FL   K    YT  S  N+  ISV+RG+V+      GS            P  G R+ D    + G T T +DG FDL V G   V L+ +R    +F     +V+V   + ++I D  L         SG + P           S     I    ++++W  +SD I    T DS  +  D+  +  S+ ++ T ++L++ S+R     S++L+ L+   V + L+++++ I +AG+   + L P   LTY F WD++NAY +   GL  V VRVGY Y+ C   S+  W+T+ + + G     K IG  W L+  H  D  + +V  G+G +  +T+   +++  +G  G  R    C++C+G+    + +    ++    G ++I D   IR +++ G                          L++ LA   ++  +    + G   I +S  L   +W I+   P+  +  + +L G+         SC +    +  +L+ PKG++     +L+ AD R I++I  T       IG+ +   +   +  C       + +++WPTS+  + I  S+  +D  N+VY + + + +VT   G+   C     +  ++++++   RH   + RDI +   G +++ E               R+ + + + G                  +   A ++    S  ++ ++  G++I+AD+G  +I  V  + A    ++  Y+V   + +E Y+FN  GQH  T S ITG   ++  Y+++S    +S+I + SG +   + R     D ++   Q  T +   Y+ TL++
Sbjct:  383 IRFNATVGSGAQLVLLMSAGVHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATFEQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCNQRGECVH-GKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCV-NGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQL-IDDICQCESGWDSVDCSQQAC--QCVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPIEVLMRMPPIF-----------NANFAQRVGFLIMEKSVQSYTDSSQFNENLISVIRGRVMWGGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFLR---TQFQSVKKSVFVSPRQIIHIDDIVLY------RQSGGSPPAISMAPARAKCSPTLRRIPDVVLISNWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLYDRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYEYQGCDRTSERVWQTRRSQMMGA-TARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITESEPRVSTFAGLDGVKRDVE-CLKCEGKVDSISLFRPTTVVYAQDGSLIIGDHNMIRRVSQDGQVSTI---------------------LTLGLADTSHSYYIAVSPVDG--TIAISLPLHKQVWRISSLEPQDSRNNYDVLAGDGTVCASAVDSCGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHI--RSIGETTP--DQHPIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDT-NVVYEIDVVHDVVTIALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKLSSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIADSGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQVDSPISMISEIRAASGVVLRVLKRNDSLFDLETTLGQRTTLTMSAYDGTLEQ 1692          
BLAST of Teneurin-2 vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 411.764 bits (1057), Expect = 4.845e-115
Identity = 352/1365 (25.79%), Postives = 600/1365 (43.96%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHF-----ERISGRAWRQVLIDNNGNRVKRSLN---------EQYFSESTGFVHYLEKGLWFLSVINDQPREENIQF--------TLNTKMSMKQT-------------CPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDC-VSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCS----------------------------------------KRKSDKQ------------SARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCI-EGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNH-AMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAE--ESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRK----YTTKS-LNQKKISVVRGKVI---QSDGS------------PFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYY-NVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSV---IGGPRILADW--SSDIIPIYNT-DSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC---SQIFWETKMTVINGHDLVAKDIGN-WNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVIN---PELEK--HKLLVGE---------SCKERTCIR-QKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC----PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK--------------RTVWIVKSDGY--------------LYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHR-----DTQSRATQLETPSGINYNVTLDE 5260
            I FN T+ +   L + +     P++  +        +RI        +++  G+R +RSL          E     S  F  ++ +G  +L+ IN++ R E I F        T   K S   T             C   CN+ G C   GKC C  GF G+ C +   P VCSG+G +  G C C   +KGKEC+     CE  DC+G G C   G C C  G++G+ C    CP ++C + GVC  NG C C  GW   DCS                                        K+K  ++            +  S+ C  +G+L   D+C C  G+    C ++ C  +C NG C  +G+C C +G+ G  C  + C   C   G+C  +G+C C  GWNG++C +DGCP  C+  G+C ++  + E+ C C     G+ C++S E  CDDG+DND+DGL DC DP+CC +  C   +     A   E   +M  +             + F +++ FL   K    YT  S  N+  ISV+RG+V+      GS            P  G R+ D    + G T T +DG FDL V G   V L+ +R    +F     +V+V   + ++I D  L         SG + P           S     I    ++++W  +SD I    T DS  +  D+  +  S+ ++ T ++L++ S+R     S++L+ L+   V + L+++++ I +AG+   + L P   LTY F WD++NAY +   GL  V VRVGY Y+ C   S+  W+T+ + + G     K IG  W L+  H  D  + +V  G+G +  +T+   +++  +G  G  R    C++C+G+    + +    ++    G ++I D   IR +++ G                          L++ LA   ++  +    + G   I +S  L   +W I+   P+  +  + +L G+         SC +    +  +L+ PKG++     +L+ AD R I++I  T       IG+ +   +   +  C       + +++WPTS+  + I  S+  +D  N+VY + + + +VT   G+   C     +  ++++++   RH   + RDI +   G +++ E               R+ + + + G                  +   A ++    S  ++ ++  G++I+AD+G  +I  V  + A    ++  Y+V   + +E Y+FN  GQH  T S ITG   ++  Y+++S    +S+I + SG +   + R     D ++   Q  T +   Y+ TL++
Sbjct:  122 IRFNATVGSGAQLVLLMSAGVHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATFEQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCNQRGECVH-GKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCV-NGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHPCSAHGQL-IDDICQCESGWDSVDCSQQAC--QCVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPIEVLMRMPPIF-----------NANFAQRVGFLIMEKSVQSYTDSSQFNENLISVIRGRVMWGGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFLR---TQFQSVKKSVFVSPRQIIHIDDIVLY------RQSGGSPPAISMAPARAKCSPTLRRIPDVVLISNWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLYDRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYEYQGCDRTSERVWQTRRSQMMGA-TARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITESEPRVSTFAGLDGVKRDVE-CLKCEGKVDSISLFRPTTVVYAQDGSLIIGDHNMIRRVSQDGQVSTI---------------------LTLGLADTSHSYYIAVSPVDG--TIAISLPLHKQVWRISSLEPQDSRNNYDVLAGDGTVCASAVDSCGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHI--RSIGETTP--DQHPIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDT-NVVYEIDVVHDVVTIALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKLSSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIADSGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQVDSPISMISEIRAASGVVLRVLKRNDSLFDLETTLGQRTTLTMSAYDGTLEQ 1431          
BLAST of Teneurin-2 vs. Ensembl Celegans
Match: T01D3.1 (pep chromosome:WBcel235:V:13689892:13703330:1 gene:WBGene00011326.1 transcript:T01D3.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.122e-18
Identity = 72/214 (33.64%), Postives = 102/214 (47.66%), Query Frame = 2
Query: 2216 CSGNGDCVSGECVCKHGYSGKNCST-LLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNN----GELNTKDVCMCPLGYSGEKCEKRLC-SGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIE-GNCICRKGWNGKHCTL------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDD 2818
            CS  G C  G C+C HGY+G +CS  L C  NCS NG+C     C C  GW   DCS  +          CL N    G+    + C C  G+ GE C    C   +C +G+C  NG C C +G+ G +C   +C+S C  +G C   G C C + + G  C+       + C  +CN+ G C+    +   CSC   W G +C++    KC++
Sbjct: 1113 CSRRGTCKEGICICPHGYTGFDCSIPLFC--NCSGNGLCNLLNICLCNDGWSGSDCSIPR----------CLTNCTGHGKCIQPNSCECDAGWMGETCSVTSCIDSQCTHGHCGTNGLCKCEDGWQGSRCQIPLCNS-CSLNGICTRPGFCSCFEDYGGSDCSKCVGDSCEACDFDCNH-GICE---PLTKTCSCAKGWMGGACDVCSIGKCEN 1309          

HSP 2 Score: 87.0409 bits (214), Expect = 2.307e-16
Identity = 70/216 (32.41%), Postives = 94/216 (43.52%), Query Frame = 2
Query: 2114 CSGHGNYFQGTCTCNPEWKGKECQTIWYECEYP---DCSGNGDC-VSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGK------RICDSRCYKHGRC--IEGNCICRKGWNGKHCTLDGCPKNCNNNGQC 2725
            CS  G   +G C C   + G       ++C  P   +CSGNG C +   C+C  G+SG +CS   C +NC+ +G C +   C C  GW  + CS             C  NG      +C C  G+ G +C+  LC+    NG C+  G C C E + G  C K        CD  C  HG C  +   C C KGW G  C +    K C N+ Q 
Sbjct: 1113 CSRRGTCKEGICICPHGYTG-------FDCSIPLFCNCSGNGLCNLLNICLCNDGWSGSDCSIPRCLTNCTGHGKCIQPNSCECDAGWMGETCSVTSCIDSQCTHGHCGTNG------LCKCEDGWQGSRCQIPLCNSCSLNGICTRPGFCSCFEDYGGSDCSKCVGDSCEACDFDC-NHGICEPLTKTCSCAKGWMGGACDVCSIGK-CENSSQI 1313          

HSP 3 Score: 80.1073 bits (196), Expect = 3.092e-14
Identity = 70/184 (38.04%), Postives = 90/184 (48.91%), Query Frame = 2
Query: 2003 TCPDFCN--KHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQ-GTCTCNPEWKGKECQT---IWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNG--ELNTKDVCMCPLGYSGEKCEKRLCS-GKCYN 2527
            + P FCN   +G+C     C C  G+ G DCS       C+GHG   Q  +C C+  W G+ C     I  +C +  C  N     G C C+ G+ G  C   LC S CS NG+C R GFC CF+ +   DCSK   D   A  +F  N+G  E  TK  C C  G+ G  C+  +CS GKC N
Sbjct: 1136 SIPLFCNCSGNGLCNLLNICLCNDGWSGSDCSIPRCLTNCTGHGKCIQPNSCECDAGWMGETCSVTSCIDSQCTHGHCGTN-----GLCKCEDGWQGSRCQIPLCNS-CSLNGICTRPGFCSCFEDYGGSDCSKCVGDSCEA-CDFDCNHGICEPLTK-TCSCAKGWMGGACD--VCSIGKCEN 1309          
BLAST of Teneurin-2 vs. Ensembl Fly
Match: Ten-m (gene:FBgn0004449 transcript:FBtr0078509)

HSP 1 Score: 605.52 bits (1560), Expect = 5.593e-175
Identity = 392/1292 (30.34%), Postives = 641/1292 (49.61%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNG--ELNTKDVCMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFL----TRRKYTT-KSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNP--NVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQ-KLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRT-----VWIVKSDGYL-------------------YKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYK-QAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSG 5425
            W+ +++Q+    + F++TI    S+G++ R N++PT  +Y   E +SG +              R+    + S +     Y+E G WF+S+ ND    + + F       M Q CP+ C+ +G C   G C C  GF G DCS+   P +CS HG Y  G C CNP WKGKEC     ECE  DCSG+G CVSG+C C  GY GK C  + CP  NCS +G C  +G C C +GW+  DC+    D      + C  +G  +L+T+  C C   +SG+ C K LC   C  +G C  +  C C+  + G+ C  R+CD RC +HG+C  G C+C  GWNGKHCT++GCP +C  +GQC+++   ++ C C   W G  C I+ E  C D  DND DGL DC+DP+CC +  C     K      S PK  D+ L      ++   ++F E+++FL    + + Y   ++ N+ + +V+RG+V+ S G    G R+      + G T T  DG FDL+V GG  V L+  R P    +    V VP NE V I D  +  +   K  +  T   CF      HD  ++  P +LA W          D  ++  ++ V+  S+ +  TGL L++ SSR  G+ S++ + L    +P +L  I+L+I + G    +  E DP + +T+ W+RLN Y + ++G+ +  V+VGY Y +C+ I W+ + T ++GHD+   ++G WNL+  H ++++ GI+ +GDGS+++L      I    G  G  R    C  CDG+  ++   +  A+ +   G + + D  YIR +   G+     K+ +  +        + L G +++++  E++    V +     +P++   E++ GS     P  E H       C +    +  KL +PKG+ I+    L+FADG  I+M+    + + T+IG+    +    +P C   L   E  L+WPT +  + +D++++ +D+ +M+ R+  D   V  ++G    C +  +  +T LA        + I   PLGEL++AE  +     V ++ +DG +                   ++ E    T   F +I ++ +T    + +AD    +I SV         +  Y++ +PD +E+Y FN  GQH  T + +TG   Y   Y +N+ NG LS +   +GN  F + RD  S+   +E   G    + +   K +  L+ P + +  ++Y+    L+  +  S    Y +  Y + GRL S + P+G
Sbjct:  411 WNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFS-----------ASTRTARAAHLSITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCL-LGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCA-DGTCICKKGWKGPDCATMDQDALQCLPD-CSGHGTFDLDTQ-TCTCEAKWSGDDCSKELCDLDCGQHGRCEGDA-CACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVC-----KTSQLCVSAPKPIDVLLRKQPPAIT---ASFFERMKFLIDESSLQNYAKLETFNESRSAVIRGRVVTSLGMGLVGVRVSTTTL-LEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRI--VQVPWNEVVII-DLVVMSMSEEKGLAVTTTHTCF-----AHDYDLM-KPVVLASWKHGFQGAC-PDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGD-GHQRPLE-CPDCDGQATKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDG-TLYVSDPESHQIIRVRDTNDYSQPELNW-EAVVGSGERCLPGDEAH-------CGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGI-VSTLIGNHMHKSHWKPIP-CEGTLKLEEMHLRWPTELAVSPMDNTLHIIDD-HMILRMTPDG-RVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLL-RDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYN-YDEFGRLTSAVTPTG 1650          

HSP 2 Score: 121.709 bits (304), Expect = 1.021e-26
Identity = 141/687 (20.52%), Postives = 286/687 (41.63%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAF-INKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILY------KPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQIL-----------TRSIDMDNSKITI-EVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFH 7993
            R  ++NG N L + YD  ++  +  V + +++ NV    Y+  ++ +   P  Q  + A++ +EY R G L   KW   +L+  Y + +R   +      D    +Y   ++   +   +       Y L Y+     +S+ TP     +     S+G+ +  Y       P+ +  N         G +   I+P +  ++ F + T  +L+ ++ G     +   D+  LV+ +       GF L ++F Y+    A I  +  L   S++ ++  ++  Y+YD   +++ I + + DK    +  +               + + + ++ +V  +K+  N  F RT + ++ +              +S+ M+   I +  +  D D +N +        RS++ + +N     Y     ++     ++ +Y + E+G  + + V+ G      YD    ++K   +    Y+  GF++++  G+Q  K+ YN  G L+  + R    S       Y+YD R R++   D  +     QY+Y +P     +TH++     +    +Y+     L ++  + + YYV +D  GSP      N  IV E     FG           VPI F G + D  + +++ + R YDP+   +    W  L T++     +P  +  Y++H
Sbjct: 1783 RKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNV---TYDRTSRPISFRP--QSGDYADVDLEYDRFGRLVSWKW--GVLQEAY-SFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYN-------DEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTTSLVKSVEVQEP--GFELRREFKYH----AGILKDEKLRFGSKNSLA-SARYKYAYDGNARLSGIEMAIDDKELPTTRYK---------------YSQNLGQLEVVQDLKITRN-AFNRTVIQDSAKQFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRSTAFDKIN-----YNADGHVVEVLGTNNWKYLFDENGNTVGV-VDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKR--GEQ--KYRYNNRGQLIHSFERERFQSW------YYYDDRSRLVAWHD--NKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDD-RDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMS----HPTDVFIYRYH 2408          
BLAST of Teneurin-2 vs. Ensembl Fly
Match: Ten-m (gene:FBgn0004449 transcript:FBtr0330159)

HSP 1 Score: 601.668 bits (1550), Expect = 5.696e-173
Identity = 393/1312 (29.95%), Postives = 642/1312 (48.93%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNG--ELNTKDVCMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFL---------TRRKYTTKSL-----NQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPR-----MANG------CVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNP--NVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQ-KLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRT-----VWIVKSDGYL-------------------YKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYK-QAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSG 5425
            W+ +++Q+    + F++TI    S+G++ R N++PT  +Y   E +SG +              R+    + S +     Y+E G WF+S+ ND    + + F       M Q CP+ C+ +G C   G C C  GF G DCS+   P +CS HG Y  G C CNP WKGKEC     ECE  DCSG+G CVSG+C C  GY GK C  + CP  NCS +G C  +G C C +GW+  DC+    D      + C  +G  +L+T+  C C   +SG+ C K LC   C  +G C  +  C C+  + G+ C  R+CD RC +HG+C  G C+C  GWNGKHCT++GCP +C  +GQC+++   ++ C C   W G  C I+ E  C D  DND DGL DC+DP+CC +  C     K      S PK  D+ L      ++   ++F E+++FL          + +   +S+     N  + +V+RG+V+ S G    G R+      + G T T  DG FDL+V GG  V L+  R P    +    V VP NE V I D  +  +   K  +  T   CF      HD  ++  P +LA W          D  ++  ++ V+  S+ +  TGL L++ SSR  G+ S++ + L    +P +L  I+L+I + G    +  E DP + +T+ W+RLN Y + ++G+ +  V+VGY Y +C+ I W+ + T ++GHD+   ++G WNL+  H ++++ GI+ +GDGS+++L               KPR     M +G      C  CDG+  ++   +  A+ +   G + + D  YIR +   G+     K+ +  +        + L G +++++  E++    V +     +P++   E++ GS     P  E H       C +    +  KL +PKG+ I+    L+FADG  I+M+    + + T+IG+    +    +P C   L   E  L+WPT +  + +D++++ +D+ +M+ R+  D   V  ++G    C +  +  +T LA        + I   PLGEL++AE  +     V ++ +DG +                   ++ E    T   F +I ++ +T    + +AD    +I SV         +  Y++ +PD +E+Y FN  GQH  T + +TG   Y   Y +N+ NG LS +   +GN  F + RD  S+   +E   G    + +   K +  L+ P + +  ++Y+    L+  +  S    Y +  Y + GRL S + P+G
Sbjct:  968 WNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFSAS-----------TRTARAAHLSITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCL-LGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCA-DGTCICKKGWKGPDCATMDQDALQCLPD-CSGHGTFDLDTQ-TCTCEAKWSGDDCSKELCDLDCGQHGRCEGDA-CACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVC-----KTSQLCVSAPKPIDVLLRKQPPAIT---ASFFERMKFLIDESSLQNYAKLETFNESIFWNYFNASRSAVIRGRVVTSLGMGLVGVRVSTTTL-LEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRI--VQVPWNEVVII-DLVVMSMSEEKGLAVTTTHTCF-----AHDYDLM-KPVVLASWKHGFQGAC-PDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRN-------------KPRIILTTMGDGHQRPLECPDCDGQATKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDG-TLYVSDPESHQIIRVRDTNDYSQPELNW-EAVVGSGERCLPGDEAH-------CGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGI-VSTLIGNHMHKSHWKPIP-CEGTLKLEEMHLRWPTELAVSPMDNTLHIIDD-HMILRMTPDG-RVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLL-RDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYN-YDEFGRLTSAVTPTG 2216          

HSP 2 Score: 120.553 bits (301), Expect = 2.311e-26
Identity = 141/687 (20.52%), Postives = 286/687 (41.63%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAF-INKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILY------KPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQIL-----------TRSIDMDNSKITI-EVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFH 7993
            R  ++NG N L + YD  ++  +  V + +++ NV    Y+  ++ +   P  Q  + A++ +EY R G L   KW   +L+  Y + +R   +      D    +Y   ++   +   +       Y L Y+     +S+ TP     +     S+G+ +  Y       P+ +  N         G +   I+P +  ++ F + T  +L+ ++ G     +   D+  LV+ +       GF L ++F Y+    A I  +  L   S++ ++  ++  Y+YD   +++ I + + DK    +  +               + + + ++ +V  +K+  N  F RT + ++ +              +S+ M+   I +  +  D D +N +        RS++ + +N     Y     ++     ++ +Y + E+G  + + V+ G      YD    ++K   +    Y+  GF++++  G+Q  K+ YN  G L+  + R    S       Y+YD R R++   D  +     QY+Y +P     +TH++     +    +Y+     L ++  + + YYV +D  GSP      N  IV E     FG           VPI F G + D  + +++ + R YDP+   +    W  L T++     +P  +  Y++H
Sbjct: 2349 RKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNV---TYDRTSRPISFRP--QSGDYADVDLEYDRFGRLVSWKW--GVLQEAY-SFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYN-------DEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTTSLVKSVEVQEP--GFELRREFKYH----AGILKDEKLRFGSKNSLA-SARYKYAYDGNARLSGIEMAIDDKELPTTRYK---------------YSQNLGQLEVVQDLKITRN-AFNRTVIQDSAKQFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRSTAFDKIN-----YNADGHVVEVLGTNNWKYLFDENGNTVGV-VDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKR--GEQ--KYRYNNRGQLIHSFERERFQSW------YYYDDRSRLVAWHD--NKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDD-RDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMS----HPTDVFIYRYH 2974          
BLAST of Teneurin-2 vs. Ensembl Fly
Match: Ten-m (gene:FBgn0004449 transcript:FBtr0306107)

HSP 1 Score: 600.512 bits (1547), Expect = 9.436e-173
Identity = 393/1312 (29.95%), Postives = 642/1312 (48.93%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNG--ELNTKDVCMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFL---------TRRKYTTKSL-----NQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPR-----MANG------CVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNP--NVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQ-KLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRT-----VWIVKSDGYL-------------------YKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYK-QAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSG 5425
            W+ +++Q+    + F++TI    S+G++ R N++PT  +Y   E +SG +              R+    + S +     Y+E G WF+S+ ND    + + F       M Q CP+ C+ +G C   G C C  GF G DCS+   P +CS HG Y  G C CNP WKGKEC     ECE  DCSG+G CVSG+C C  GY GK C  + CP  NCS +G C  +G C C +GW+  DC+    D      + C  +G  +L+T+  C C   +SG+ C K LC   C  +G C  +  C C+  + G+ C  R+CD RC +HG+C  G C+C  GWNGKHCT++GCP +C  +GQC+++   ++ C C   W G  C I+ E  C D  DND DGL DC+DP+CC +  C     K      S PK  D+ L      ++   ++F E+++FL          + +   +S+     N  + +V+RG+V+ S G    G R+      + G T T  DG FDL+V GG  V L+  R P    +    V VP NE V I D  +  +   K  +  T   CF      HD  ++  P +LA W          D  ++  ++ V+  S+ +  TGL L++ SSR  G+ S++ + L    +P +L  I+L+I + G    +  E DP + +T+ W+RLN Y + ++G+ +  V+VGY Y +C+ I W+ + T ++GHD+   ++G WNL+  H ++++ GI+ +GDGS+++L               KPR     M +G      C  CDG+  ++   +  A+ +   G + + D  YIR +   G+     K+ +  +        + L G +++++  E++    V +     +P++   E++ GS     P  E H       C +    +  KL +PKG+ I+    L+FADG  I+M+    + + T+IG+    +    +P C   L   E  L+WPT +  + +D++++ +D+ +M+ R+  D   V  ++G    C +  +  +T LA        + I   PLGEL++AE  +     V ++ +DG +                   ++ E    T   F +I ++ +T    + +AD    +I SV         +  Y++ +PD +E+Y FN  GQH  T + +TG   Y   Y +N+ NG LS +   +GN  F + RD  S+   +E   G    + +   K +  L+ P + +  ++Y+    L+  +  S    Y +  Y + GRL S + P+G
Sbjct:  968 WNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFSAS-----------TRTARAAHLSITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCL-LGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCA-DGTCICKKGWKGPDCATMDQDALQCLPD-CSGHGTFDLDTQ-TCTCEAKWSGDDCSKELCDLDCGQHGRCEGDA-CACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVC-----KTSQLCVSAPKPIDVLLRKQPPAIT---ASFFERMKFLIDESSLQNYAKLETFNESIFWNYFNASRSAVIRGRVVTSLGMGLVGVRVSTTTL-LEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRI--VQVPWNEVVII-DLVVMSMSEEKGLAVTTTHTCF-----AHDYDLM-KPVVLASWKHGFQGAC-PDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRN-------------KPRIILTTMGDGHQRPLECPDCDGQATKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDG-TLYVSDPESHQIIRVRDTNDYSQPELNW-EAVVGSGERCLPGDEAH-------CGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGI-VSTLIGNHMHKSHWKPIP-CEGTLKLEEMHLRWPTELAVSPMDNTLHIIDD-HMILRMTPDG-RVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLL-RDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYN-YDEFGRLTSAVTPTG 2216          

HSP 2 Score: 120.939 bits (302), Expect = 1.948e-26
Identity = 141/687 (20.52%), Postives = 286/687 (41.63%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAF-INKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILY------KPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQIL-----------TRSIDMDNSKITI-EVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFH 7993
            R  ++NG N L + YD  ++  +  V + +++ NV    Y+  ++ +   P  Q  + A++ +EY R G L   KW   +L+  Y + +R   +      D    +Y   ++   +   +       Y L Y+     +S+ TP     +     S+G+ +  Y       P+ +  N         G +   I+P +  ++ F + T  +L+ ++ G     +   D+  LV+ +       GF L ++F Y+    A I  +  L   S++ ++  ++  Y+YD   +++ I + + DK    +  +               + + + ++ +V  +K+  N  F RT + ++ +              +S+ M+   I +  +  D D +N +        RS++ + +N     Y     ++     ++ +Y + E+G  + + V+ G      YD    ++K   +    Y+  GF++++  G+Q  K+ YN  G L+  + R    S       Y+YD R R++   D  +     QY+Y +P     +TH++     +    +Y+     L ++  + + YYV +D  GSP      N  IV E     FG           VPI F G + D  + +++ + R YDP+   +    W  L T++     +P  +  Y++H
Sbjct: 2349 RKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNV---TYDRTSRPISFRP--QSGDYADVDLEYDRFGRLVSWKW--GVLQEAY-SFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYN-------DEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTTSLVKSVEVQEP--GFELRREFKYH----AGILKDEKLRFGSKNSLA-SARYKYAYDGNARLSGIEMAIDDKELPTTRYK---------------YSQNLGQLEVVQDLKITRN-AFNRTVIQDSAKQFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRSTAFDKIN-----YNADGHVVEVLGTNNWKYLFDENGNTVGV-VDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKR--GEQ--KYRYNNRGQLIHSFERERFQSW------YYYDDRSRLVAWHD--NKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDD-RDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMS----HPTDVFIYRYH 2974          
BLAST of Teneurin-2 vs. Ensembl Fly
Match: Ten-a (gene:FBgn0267001 transcript:FBtr0300201)

HSP 1 Score: 457.988 bits (1177), Expect = 5.822e-129
Identity = 299/1063 (28.13%), Postives = 495/1063 (46.57%), Query Frame = 2
Query: 1763 VPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSN-CSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNN-GELNTKDV----CMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTK-----SLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFEL----------KDLLISKANSGKT--EPGCFNGDQSVHDSSVIG--------GPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSP------YLL-------MFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSET-VLAIRHKFSDIRDIEINPLGELFIAE 4813
             P      H +RI       V   + G+ +  +L+    + +   + YL+ GLWF+SV ND+    ++         +  TCP+ C+  G C   GKCDC  G++G DCSK   P +CS HG+Y  G C C   WKG EC     ECE P+CS +G C+ GEC C+ G+ G  C    C    CS +G C   G C C  GW+ +DC     D+Q  +   CL    E  T D+    C+C   ++G  C + +CS  C  NG C  +G C CN G++G  C +  CDSRC +HG+C  G C+C +GWNG+HCTL GC   C+ +GQC L +  EY C C+  W G  C+I+ E  C D +DND DG+TDC D +CC    C             C   +D   +LL  +     ++F+++++FL               ++ ++SV+RG+VI   G    G R+        G T T + G FD++V GG  V L+  R P    T    V+VP N  V +   ++          +++ ++  N   T      ++     +D+S +          P++++ W  + +          A +  ++  S+ +  + L L ++SS+  G+ S + + L G+ +P  L  +++ + + G    +  E DP L +TF W++ N Y + ++G+   ++ VGY +  C    W  +   + G+D+   DIG W L+  H ++++ GI+ +GDGS L + +    +  + G  G  R       C+G  K+    +  A+ +   G + + D   +R +T  G      ++ +       YL        ++I+  E + Q L +   +   +P++N+D + G          SG   +   E        G        +  +L HPKG+ I    +++ ADG  I+ +    + IHT+IG        S  P C   L A++ +L+WPT +  + +D S++F+D+  +V RL  D   +  VAG    C +   +         +    +  +  +P G L+IA+
Sbjct:  378 TPLDTAKQHLQRIGKPQSHWVNKRSAGDGLP-ALDVDAMTVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCY-LGKCDCIDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPYCDQHDCLDPLCSGHGTCVA-GQCYCKAGWQGEDCGT--IDQQVYQ---CLPGCSEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCE-SGKCRCNSGWTGNLCDQLPCDSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENG-EYRCDCIEGWAGRDCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACS--------EHIMCLSSNDPVEVLLRKQPPSVTASFYQRVKFLIEENSVQSYAHMDEYSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLT--RTVFVPWNRIVVLPPVQMQLSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGKRVIFA-ETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMG-TGLQRPLTCPDYCNGVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYISDPERH-QILRLVRLEKVKDPSINSDPVVG----------SGQRCIPGDE--------GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGV-IHTLIGHHGHHNHWSPAP-CSGTLMANQAQLQWPTGLALSPLDGSLHFIDD-RLVLRLTSD-MKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGTVLAMAFSPFGNLYIAD 1395          

HSP 2 Score: 160.229 bits (404), Expect = 2.508e-38
Identity = 248/1171 (21.18%), Postives = 460/1171 (39.28%), Query Frame = 2
Query: 4790 LGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSV-HYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGN-LQF--------KVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYN-DQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQ-VINDEGYRNGFQYPNDESASSLSPDP---RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAE--IDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKG-FIRTTLNENGQILTRSIDMDNSKITI---EVSYD-EDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKN-RIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTT------KPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKH 8215
            LG    A       +  DG L   E    +   F++I++I +   G + VAD G   + ++ HY  +  +N  + +  P + E+Y FN  GQH  T    +G   YS  Y  N+  G LS +   SGN +QF            +TQ   ++++  +GI     L E+ R           +  Y+ +  LL S     E   Y+   Y + GR+  +I PSG            E V    +L +           S  LT Y   +++ + S +   ++              G AN++ +  G +   +    +H+  EL  + T   H +  NG+      + +                  P L+A +   + +    ++Q V   EG  N             +P     R   +N    + V +D  +  E F  Y+  +   ++   Y+         P    TN   + + Y R   ++   W    L+ +YD     S I  +  + I  ++Y+   + S+I   ++   +K+ L Y+       +  P+    S     SIG+ R  Y P G +  ++  + S  G L + I P    +I + Y+   QL  V++G  R EF  +++  +   +  T     +R    F Y   L+AE  IDY              ++K  Y YDS++++     + +       +L  ++        +     +F F     N+ +L +    F RT    +G+  T+ + +   ++ +   E SY    R +     +  +  +S   + N+  ++  D  L+    + +   ++Y ++G L+SL    G  +   Y++   ++K  G   Y Y+  G + Q  N ++ E+F YN  GLL   +R     +    V Y+YD   R+   +D      + Q+FYT+      ++ +Y     KL S  Y+   GHL   +V +  YYV +D  G+P  + +   + + E     FG      +  +++PI F G I D  + ++ M + R+YDP    +    W  +  ++    + P  L+ Y+F+      +V  +  + + F    W+  +G N   +V        +P  ++      P    L+  F++    ++ S    H
Sbjct: 1553 LGAKTTAAGIGAATLNDDGTLSNAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSSEIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSSIENTQDHKSEIQI-NGIGIMTKLSEKGR--------QEIELDYDSNTGLLNSRSSGGETYIYQ---YDEFGRVTGMILPSG------------EIVRITSQLAD-----------SQGLTVY---VHASVESLFSRERI-------------AGEANELLVLGGVRSTFLKRGQAHADAELKANNTLVIHGD--NGVVVEASAVAR-----------------HPLLEAALPVEAEMLAMWSHQSVTMGEGLTNSMYSVYSLVGDVRNPQQTLNREIWVNQSRVIGVEFDQFTNRETF--YDARRTP-ILIVAYDQSGLPKSYYP----TNGYPVNITYDRFNRVEGWAWGPAELKYSYDRHGLLSEI-TSQQDGIVSFVYNDWNLVSEIGLASQ---RKFVLQYDDAGGLRHVVLPSGTRHSFSMQTSIGFIRCTYTPPGSTRAYLQHY-SHAGALLQTILPGDGARIVYRYNAAGQLTEVVHGDGRSEFQYNEATGMPSTVSHTERELEYRW--DFEYAAGLLAEERIDYVAKTGLS-------NAKFSYEYDSQLRV-----VALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTRTV---DGRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRNMAVNSYTNVKNY--TWDCDGQLV-GVEAQEPWGFRYDDNGNLLSLTYR-GNTIPMEYNAQDRIVK-FGEGQYKYDARGLVAQ--NARE-ERFHYNTQGLL---VRASKRGRF--DVRYYYDHLKRLTTRKDNF--GNVTQFFYTNQQRPYEVSQIYSPRDGKLMSLTYDDV-GHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERI----ITPTRLHLYRFNG-NDPINVGHERHYPEDFAA--WMRTLGYNVGNLVPQLARDLWQPPALWGRPPANPVALNLRRPFDNIPTMAVESGFLAH 2601          
BLAST of Teneurin-2 vs. Ensembl Fly
Match: Ten-a (gene:FBgn0267001 transcript:FBtr0299859)

HSP 1 Score: 458.373 bits (1178), Expect = 6.648e-129
Identity = 299/1063 (28.13%), Postives = 495/1063 (46.57%), Query Frame = 2
Query: 1763 VPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSN-CSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNN-GELNTKDV----CMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTK-----SLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFEL----------KDLLISKANSGKT--EPGCFNGDQSVHDSSVIG--------GPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSP------YLL-------MFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSET-VLAIRHKFSDIRDIEINPLGELFIAE 4813
             P      H +RI       V   + G+ +  +L+    + +   + YL+ GLWF+SV ND+    ++         +  TCP+ C+  G C   GKCDC  G++G DCSK   P +CS HG+Y  G C C   WKG EC     ECE P+CS +G C+ GEC C+ G+ G  C    C    CS +G C   G C C  GW+ +DC     D+Q  +   CL    E  T D+    C+C   ++G  C + +CS  C  NG C  +G C CN G++G  C +  CDSRC +HG+C  G C+C +GWNG+HCTL GC   C+ +GQC L +  EY C C+  W G  C+I+ E  C D +DND DG+TDC D +CC    C             C   +D   +LL  +     ++F+++++FL               ++ ++SV+RG+VI   G    G R+        G T T + G FD++V GG  V L+  R P    T    V+VP N  V +   ++          +++ ++  N   T      ++     +D+S +          P++++ W  + +          A +  ++  S+ +  + L L ++SS+  G+ S + + L G+ +P  L  +++ + + G    +  E DP L +TF W++ N Y + ++G+   ++ VGY +  C    W  +   + G+D+   DIG W L+  H ++++ GI+ +GDGS L + +    +  + G  G  R       C+G  K+    +  A+ +   G + + D   +R +T  G      ++ +       YL        ++I+  E + Q L +   +   +P++N+D + G          SG   +   E        G        +  +L HPKG+ I    +++ ADG  I+ +    + IHT+IG        S  P C   L A++ +L+WPT +  + +D S++F+D+  +V RL  D   +  VAG    C +   +         +    +  +  +P G L+IA+
Sbjct:  854 TPLDTAKQHLQRIGKPQSHWVNKRSAGDGLP-ALDVDAMTVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCY-LGKCDCIDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPYCDQHDCLDPLCSGHGTCVA-GQCYCKAGWQGEDCGT--IDQQVYQ---CLPGCSEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCE-SGKCRCNSGWTGNLCDQLPCDSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENG-EYRCDCIEGWAGRDCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACS--------EHIMCLSSNDPVEVLLRKQPPSVTASFYQRVKFLIEENSVQSYAHMDEYSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLT--RTVFVPWNRIVVLPPVQMQLSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGKRVIFA-ETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMG-TGLQRPLTCPDYCNGVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYISDPERH-QILRLVRLEKVKDPSINSDPVVG----------SGQRCIPGDE--------GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGV-IHTLIGHHGHHNHWSPAP-CSGTLMANQAQLQWPTGLALSPLDGSLHFIDD-RLVLRLTSD-MKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGTVLAMAFSPFGNLYIAD 1871          

HSP 2 Score: 159.458 bits (402), Expect = 3.738e-38
Identity = 247/1171 (21.09%), Postives = 464/1171 (39.62%), Query Frame = 2
Query: 4790 LGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSV-HYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGN-LQF--------KVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYN-DQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQ-VINDEGYRNGFQYPNDESASSLSPDPRIFK---MNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAE--IDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKG-FIRTTLNENGQILTRSIDMDNSKITI---EVSYD-EDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKN-RIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTT------KPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKH 8215
            LG    A       +  DG L   E    +   F++I++I +   G + VAD G   + ++ HY  +  +N  + +  P + E+Y FN  GQH  T    +G   YS  Y  N+  G LS +   SGN +QF            +TQ   ++++  +GI     L E+ R           +  Y+ +  LL S     E   Y++  +   GR+  +I PSG            E V    +L +           S  LT Y   +++ + S +   ++              G AN++ +  G +   +    +H+  EL  + T   H +  NG+      + +                  P L+A +   + +    ++Q V   EG  N             +P   + +   +N    + V +D  +  E F  Y+  +   ++   Y+         P    TN   + + Y R   ++   W    L+ +YD     S I  +  + I  ++Y+   + S+I   ++   +K+ L Y+       +  P+    S     SIG+ R  Y P G +  ++  + S  G L + I P    +I + Y+   QL  V++G  R EF  +++  +   +  T     +R    F Y   L+AE  IDY       ++  +S ++K  Y YDS++++     + +       +L  ++        +     +F F     N+ +L +    F RT    +G+  T+ + +   ++ +   E SY    R +     +  +  +S   + N+ +    D  L+    + +   ++Y ++G L+SL    G  +   Y++   ++K  G   Y Y+  G + Q  N ++ E+F YN  GLL   +R     +    V Y+YD   R+   +D      + Q+FYT+      ++ +Y     KL S  Y+   GHL   +V +  YYV +D  G+P  + +   + + E     FG      +  +++PI F G I D  + ++ M + R+YDP    +    W  +  ++    + P  L+ Y+F+      +V  +  + + F    W+  +G N   +V        +P  ++      P    L+  F++    ++ S    H
Sbjct: 2029 LGAKTTAAGIGAATLNDDGTLSNAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSSEIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSSIENTQDHKSEIQI-NGIGIMTKLSEKGR--------QEIELDYDSNTGLLNSRSSGGETYIYQYDEF---GRVTGMILPSG------------EIVRITSQLAD-----------SQGLTVY---VHASVESLFSRERI-------------AGEANELLVLGGVRSTFLKRGQAHADAELKANNTLVIHGD--NGVVVEASAVAR-----------------HPLLEAALPVEAEMLAMWSHQSVTMGEGLTNSMYSVYSLVGDVRNPQQTLNREIWVNQSRVIGVEFDQFTNRETF--YDARRTP-ILIVAYDQSGLPKSYYP----TNGYPVNITYDRFNRVEGWAWGPAELKYSYDRHGLLSEI-TSQQDGIVSFVYNDWNLVSEIGLASQ---RKFVLQYDDAGGLRHVVLPSGTRHSFSMQTSIGFIRCTYTPPGSTRAYLQHY-SHAGALLQTILPGDGARIVYRYNAAGQLTEVVHGDGRSEFQYNEATGMPSTVSHTERELEYRW--DFEYAAGLLAEERIDYV------AKTGLS-NAKFSYEYDSQLRV-----VALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTRTV---DGRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRNMAVNSYTNVKNYTWDC--DGQLV-GVEAQEPWGFRYDDNGNLLSLTYR-GNTIPMEYNAQDRIVK-FGEGQYKYDARGLVAQ--NARE-ERFHYNTQGLL---VRASKRGRF--DVRYYYDHLKRLTTRKDNF--GNVTQFFYTNQQRPYEVSQIYSPRDGKLMSLTYDDV-GHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERI----ITPTRLHLYRFNG-NDPINVGHERHYPEDFAA--WMRTLGYNVGNLVPQLARDLWQPPALWGRPPANPVALNLRRPFDNIPTMAVESGFLAH 3077          
BLAST of Teneurin-2 vs. Ensembl Zebrafish
Match: BX537102.3 (si:dkey-34l15.2 [Source:NCBI gene;Acc:563197])

HSP 1 Score: 585.489 bits (1508), Expect = 1.513e-169
Identity = 546/2177 (25.08%), Postives = 938/2177 (43.09%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRA-WRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL----------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---------GESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRA--TQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDL-LISIQQSSEIAPYRFTYYPD-------------------SGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNR--LASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHL-IGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRN-GFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSS--MEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            W      N    + FN ++      G+++R    P+  +Y + ER+ G+  W  V       R +RS+     +E+  FV YL+ G W L+  ND   +E++ F+     S+ Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P C G+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      VC C   + G  C   +CS  C      + G+C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+          D     CN NGQC L     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C    Q       S    D L ++       +   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +    LK           T P C        D  V+  P  L+ + S           S+  +  VL   +++  T LKL H SSR  G++S L + +    VP +L +++L + V G    +     P L YTF WD+ +AY + ++GL+   V VGY YE+C S + WE +  ++ G++L    +G W+L+  HI +   GI+++G G ++F++Q    I  I G  G+ R +  C  C+G        +  A+ +   G + + D  ++R +         +  L+   ++ +  ++           +H NNP  +   LA +P    +++S++ S  I+ +   L   +LL          GE C    ER       +   L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C S +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C         V  I +  S +                                       A +S T+I I+  G L +A+  +K+I  V   + +  N    +L+  T E    N    +        G + Y+    LNS    +S  VSP G L      + + RA  T    PS +              +A P     + +N++ L L +I   + +  Y F+Y PD                   +G L+ V++P          P      +S    +  + G+N N   LA+ A     +  Y   +     +         +  LH  I  +  + + +  +   +++I + S +E +    T       N  Q     T ++++        + +E   ++++ S+  TI +        N  +  D G  +  ++   + S   ++   R  + +G+N L + +D N+R E   +Y++ + K  ++  Y+   +     P    ++LA + V Y+ +G L  +          +D   R  S  +     ++ Y Y       K   +   + ++Y   +++ ++  ++  P+    ++   +SIGY R  Y P   +++ IYDF S +G      +     ++ + Y    +L  ++Y +  I F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P                   + ++DE      I  K++     G I   +N   QI+T ++      +T+   +D   +  +    Y+I RS    M +            L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DG+L Q+ +    + F YN+ G L++ Y R+         V+Y YD   R +  ++ +   Q  Q+FY D  N  R+TH+++H+S ++SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++DS + ++    R YD
Sbjct:   79 WRSLMHLNQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV----ESPRERRSIQTVVLNEAV-FVQYLDPGTWHLAFYNDGKEKESVSFSTAVLDSV-QECPRNCHGNGECVS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCICYSGWKGPECDVPISQCIDPQCGGHGTCTEGTCVCSLGYKGENCAEVDCLDPTCSNNGICV-NGECHCKPGWGGPSCELPRAQCPDQCHGHGAFIPDTG------VCSCDPNWMGPDCSVEVCSVDCGTHGVCMGGSCRCEEGWTGAACDQRVCNPLCVKHGTCKDGKCECEQGWNGEHCTIGRHNMSTAEPDTDSFLCNGNGQCLLGQN-SWHCECKTGWRGTGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQSPC----QNSPLCRGS---RDPLQVIQQGQHPEQKVRSFYDRVKMLVGRDSTHIIPADNPFNASLASLIRGQVVTTDGTPLVGVNVSFVKYPQYGYTLTRQDGTFDLIANGGASLTLRFERAP--FLSQERTVWLPWNIFYAMDTLMLK-------TEENTIPSCDLSGFVRPDPVVVASP--LSSFFSS-----KPGERSIIPETQVLHEQLEIPGTNLKLCHLSSRTSGYRSLLKITMTQAVVPLSLVKVHLMVAVEGHLFQKWFHASPNLAYTFIWDKTDAYGQHVYGLSDAVVSVGYEYESCPSLVLWEKRTAMLQGYELEPSSLGGWSLDKHHILNLRSGILHKGSGENVFVSQQPPIITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAAGIDGSLYVGDLNFVRRV---------YPNLNTTRILELRNKD----------FRHSNNP-THKYFLAVDPVSGALFISDTNSRRIYKVR-SLTGGRLLADNAEVVAGTGEQCLPFDERCGDGGKAVEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDSSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHC--------QVPGIDYSLSKL-----------------------------------AIHSALESATAIGISHTGVLYIAETDEKKINRV---RQVSTNGEMSLLAGATSECDCKNDVNCN-----CFAGDDGYATDASLNSP---MSLAVSPDGTLYIADLNNIRIRAVRTNRPGPSALGR----------YEVASPQEQELYVFNEEGLHLQTISLVTGLPLYNFSYGPDGELATVVDNCNNTVKVRRDAGLLRLVLQPENQVVTLGLDPAGSLRSISALNQEIVLLGYNGNTGLLATKADETGWTTFYEYDSEGRLTNVTYPTG--MVTSLHREIEKSINIDIESSNRDDDVTVITNLSSVEASY---TVVQDQVRNSYQLCNNGTLRVMYANGMGIS-YHTE--PHILAGSVSPTIGRR-------NITLPTDNGLNSIEWRLRKELSKGKVTVFGRKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRITYDAQGRPAIWQP---SSSLAVVNVSYSSTGQLVGLHRGSMSERTEFDAQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYIFEFDASNRITAVTMPSVARHTMFTHVSIGYIRNTYNPPESNASIIYDF-SEDGRPQATYFLGTGRRVLYKYGKLAKLSEILYDSTAITFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPV---------------DLYRYDE------ISGKVEHFGKFGVIYYDIN---QIITTAV------MTLSKHFDAHGR--IKEVQYEIFRSLMYWMTVQYDNMGRVIKRELKIGPY-ANTTQYRYEYDGDGQLSGVKVNDWSTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYRLDEDGYLSQRGS----DVFDYNSKGQLVRAYSRVAGGWS----VQYRYDGLGRRVSTKNSL--GQHLQFFYADLNNPTRVTHVFNHSSSEISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYHDSNPEFQLVVGFHGGLYDSLTKLVHFTQRDYD 2043          
BLAST of Teneurin-2 vs. Ensembl Zebrafish
Match: BX537102.3 (si:dkey-34l15.2 [Source:NCBI gene;Acc:563197])

HSP 1 Score: 583.178 bits (1502), Expect = 8.992e-169
Identity = 547/2177 (25.13%), Postives = 939/2177 (43.13%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRA-WRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL----------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---------GESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRA--TQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDL-LISIQQSSEIAPYRFTYYP-------------------DSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGF--NKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHL-IGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRN-GFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSS--MEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            W      N    + FN ++      G+++R    P+  +Y + ER+ G+  W  V       R +RS+     +E+  FV YL+ G W L+  ND   +E++ F+     S+ Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P C G+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      VC C   + G  C   +CS  C      + G+C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+          D     CN NGQC L     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C    Q       S    D L ++       +   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +    LK           T P C        D  V+  P  L+ + S           S+  +  VL   +++  T LKL H SSR  G++S L + +    VP +L +++L + V G    +     P L YTF WD+ +AY + ++GL+   V VGY YE+C S + WE +  ++ G++L    +G W+L+  HI +   GI+++G G ++F++Q    I  I G  G+ R +  C  C+G        +  A+ +   G + + D  ++R +         +  L+   ++ +  ++           +H NNP  +   LA +P    +++S++ S  I+ +   L   +LL          GE C    ER       +   L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C S +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C         V  I +  S +                                       A +S T+I I+  G L +A+  +K+I  V   + +  N    +L+  T E    N    +        G + Y+    LNS    +S  VSP G L      + + RA  T    PS +              +A P     + +N++ L L +I   + +  Y F+Y P                   D+G L+ V++P          P      +S    +  + G+  N   LA+ A     +  Y   +     +         +  LH  I  +  + + +  +   +++I + S +E +    T       N  Q     T ++++        + +E   ++++ S+  TI +        N  +  D G  +  ++   + S   ++   R  + +G+N L + +D N+R E   +Y++ + K  ++  Y  D Q    I ++  ++LA + V Y+ +G L  +          +D   R  S  +     ++ Y Y       K   +   + ++Y   +++ ++  ++  P+    ++   +SIGY R  Y P   +++ IYDF S +G      +     ++ + Y    +L  ++Y +  I F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P                   + ++DE      I  K++     G I   +N   QI+T ++      +T+   +D   +  +    Y+I RS    M +            L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DG+L Q+ +    + F YN+ G L++ Y R+         V+Y YD   R +  ++ +   Q  Q+FY D  N  R+TH+++H+S ++SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++DS + ++    R YD
Sbjct:   86 WRSLMHLNQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV----ESPRERRSIQTVVLNEAV-FVQYLDPGTWHLAFYNDGKEKESVSFSTAVLDSV-QECPRNCHGNGECVS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCICYSGWKGPECDVPISQCIDPQCGGHGTCTEGTCVCSLGYKGENCAEVDCLDPTCSNNGICV-NGECHCKPGWGGPSCELPRAQCPDQCHGHGAFIPDTG------VCSCDPNWMGPDCSVEVCSVDCGTHGVCMGGSCRCEEGWTGAACDQRVCNPLCVKHGTCKDGKCECEQGWNGEHCTIGRHNMSTAEPDTDSFLCNGNGQCLLGQN-SWHCECKTGWRGTGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQSPC----QNSPLCRGS---RDPLQVIQQGQHPEQKVRSFYDRVKMLVGRDSTHIIPADNPFNASLASLIRGQVVTTDGTPLVGVNVSFVKYPQYGYTLTRQDGTFDLIANGGASLTLRFERAP--FLSQERTVWLPWNIFYAMDTLMLK-------TEENTIPSCDLSGFVRPDPVVVASP--LSSFFSS-----KPGERSIIPETQVLHEQLEIPGTNLKLCHLSSRTSGYRSLLKITMTQAVVPLSLVKVHLMVAVEGHLFQKWFHASPNLAYTFIWDKTDAYGQHVYGLSDAVVSVGYEYESCPSLVLWEKRTAMLQGYELEPSSLGGWSLDKHHILNLRSGILHKGSGENVFVSQQPPIITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAAGIDGSLYVGDLNFVRRV---------YPNLNTTRILELRNKD----------FRHSNNP-THKYFLAVDPVSGALFISDTNSRRIYKVR-SLTGGRLLADNAEVVAGTGEQCLPFDERCGDGGKAVEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDSSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHC--------QVPGIDYSLSKL-----------------------------------AIHSALESATAIGISHTGVLYIAETDEKKINRV---RQVSTNGEMSLLAGATSECDCKNDVNCN-----CFAGDDGYATDASLNSP---MSLAVSPDGTLYIADLNNIRIRAVRTNRPGPSALGR----------YEVASPQEQELYVFNEEGLHLQTISLVTGLPLYNFSYGPDGELATVVDNCNNTVKVRRDAGLLRLVLQPENQVVTLGLDPAGSLRSISALNQEIVLLGYNGNTGLLATKADETGWTTFYEYDSEGRLTNVTYPTG--MVTSLHREIEKSINIDIESSNRDDDVTVITNLSSVEASY---TVVQDQVRNSYQLCNNGTLRVMYANGMGIS-YHTE--PHILAGSVSPTIGRR-------NITLPTDNGLNSIEWRLRKELSKGKVTVFGRKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRITY--DAQGRPAI-WQPSSSLAVVNVSYSSTGQLVGLHRGSMSERTEFDAQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYIFEFDASNRITAVTMPSVARHTMFTHVSIGYIRNTYNPPESNASIIYDF-SEDGRPQATYFLGTGRRVLYKYGKLAKLSEILYDSTAITFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPV---------------DLYRYDE------ISGKVEHFGKFGVIYYDIN---QIITTAV------MTLSKHFDAHGR--IKEVQYEIFRSLMYWMTVQYDNMGRVIKRELKIGPY-ANTTQYRYEYDGDGQLSGVKVNDWSTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYRLDEDGYLSQRGS----DVFDYNSKGQLVRAYSRVAGGWS----VQYRYDGLGRRVSTKNSL--GQHLQFFYADLNNPTRVTHVFNHSSSEISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYHDSNPEFQLVVGFHGGLYDSLTKLVHFTQRDYD 2050          
BLAST of Teneurin-2 vs. Ensembl Zebrafish
Match: BX537102.3 (si:dkey-34l15.2 [Source:NCBI gene;Acc:563197])

HSP 1 Score: 580.482 bits (1495), Expect = 6.967e-168
Identity = 549/2177 (25.22%), Postives = 933/2177 (42.86%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRA-WRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL----------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---------GESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRA--TQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDL-LISIQQSSEIAPYRFTYYP-------------------DSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGF--NKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHL-IGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRN-GFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSS--MEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            W      N    + FN ++      G+++R    P+  +Y + ER+ G+  W  V       R +RS+     +E+  FV YL+ G W L+  ND   +E++ F+     S+ Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P C G+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      VC C   + G  C   +CS  C      + G+C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+          D     CN NGQC L     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C    Q       S    D L ++       +   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +    LK           T P C        D  V+  P  L+ + S           S+  +  VL   +++  T LKL H SSR  G++S L + +    VP +L +++L + V G    +     P L YTF WD+ +AY + ++GL+   V VGY YE+C S + WE +  ++ G++L    +G W+L+  HI +   GI+++G G ++F++Q    I  I G  G+ R +  C  C+G        +  A+ +   G + + D                        L F+ +   NL    I   +  NNP  +   LA +P    +++S++ S  I+ +   L   +LL          GE C    ER       +   L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C S +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C         V  I +  S +                                       A +S T+I I+  G L +A+  +K+I  V   + +  N    +L+  T E    N    +        G + Y+    LNS    +S  VSP G L      + + RA  T    PS +              +A P     + +N++ L L +I   + +  Y F+Y P                   D+G L+ V++P          P      +S    +  + G+  N   LA+ A     +  Y   +     +         +  LH  I  +  + + +  +   +++I + S +E +    T       N  Q     T ++++        + +E   ++++ S+  TI +        N  +  D G  +  ++   + S   ++   R  + +G+N L + +D N+R E   +Y++ + K  ++  Y  D Q    I ++  ++LA + V Y+ +G L  +          +D   R  S  +     ++ Y Y       K   +   + ++Y   +++ ++  ++  P+    ++   +SIGY R  Y P   +++ IYDF S +G      +     ++ + Y    +L  ++Y +  I F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P                   + ++DE      I  K++     G I   +N   QI+T ++      +T+   +D   +  +    Y+I RS    M +            L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DG+L Q+ +    + F YN+ G L++ Y R+         V+Y YD   R +  ++ +   Q  Q+FY D  N  R+TH+++H+S ++SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++DS + ++    R YD
Sbjct:   79 WRSLMHLNQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV----ESPRERRSIQTVVLNEAV-FVQYLDPGTWHLAFYNDGKEKESVSFSTAVLDSV-QECPRNCHGNGECVS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCICYSGWKGPECDVPISQCIDPQCGGHGTCTEGTCVCSLGYKGENCAEVDCLDPTCSNNGICV-NGECHCKPGWGGPSCELPRAQCPDQCHGHGAFIPDTG------VCSCDPNWMGPDCSVEVCSVDCGTHGVCMGGSCRCEEGWTGAACDQRVCNPLCVKHGTCKDGKCECEQGWNGEHCTIGRHNMSTAEPDTDSFLCNGNGQCLLGQN-SWHCECKTGWRGTGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQSPC----QNSPLCRGS---RDPLQVIQQGQHPEQKVRSFYDRVKMLVGRDSTHIIPADNPFNASLASLIRGQVVTTDGTPLVGVNVSFVKYPQYGYTLTRQDGTFDLIANGGASLTLRFERAP--FLSQERTVWLPWNIFYAMDTLMLK-------TEENTIPSCDLSGFVRPDPVVVASP--LSSFFSS-----KPGERSIIPETQVLHEQLEIPGTNLKLCHLSSRTSGYRSLLKITMTQAVVPLSLVKVHLMVAVEGHLFQKWFHASPNLAYTFIWDKTDAYGQHVYGLSDAVVSVGYEYESCPSLVLWEKRTAMLQGYELEPSSLGGWSLDKHHILNLRSGILHKGSGENVFVSQQPPIITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAAGIDGSLYVGD------------------------LNFVRRVYPNLNTTRIL--ELSNNP-THKYFLAVDPVSGALFISDTNSRRIYKVR-SLTGGRLLADNAEVVAGTGEQCLPFDERCGDGGKAVEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDSSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHC--------QVPGIDYSLSKL-----------------------------------AIHSALESATAIGISHTGVLYIAETDEKKINRV---RQVSTNGEMSLLAGATSECDCKNDVNCN-----CFAGDDGYATDASLNSP---MSLAVSPDGTLYIADLNNIRIRAVRTNRPGPSALGR----------YEVASPQEQELYVFNEEGLHLQTISLVTGLPLYNFSYGPDGELATVVDNCNNTVKVRRDAGLLRLVLQPENQVVTLGLDPAGSLRSISALNQEIVLLGYNGNTGLLATKADETGWTTFYEYDSEGRLTNVTYPTG--MVTSLHREIEKSINIDIESSNRDDDVTVITNLSSVEASY---TVVQDQVRNSYQLCNNGTLRVMYANGMGIS-YHTE--PHILAGSVSPTIGRR-------NITLPTDNGLNSIEWRLRKELSKGKVTVFGRKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRITY--DAQGRPAI-WQPSSSLAVVNVSYSSTGQLVGLHRGSMSERTEFDAQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYIFEFDASNRITAVTMPSVARHTMFTHVSIGYIRNTYNPPESNASIIYDF-SEDGRPQATYFLGTGRRVLYKYGKLAKLSEILYDSTAITFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPV---------------DLYRYDE------ISGKVEHFGKFGVIYYDIN---QIITTAV------MTLSKHFDAHGR--IKEVQYEIFRSLMYWMTVQYDNMGRVIKRELKIGPY-ANTTQYRYEYDGDGQLSGVKVNDWSTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYRLDEDGYLSQRGS----DVFDYNSKGQLVRAYSRVAGGWS----VQYRYDGLGRRVSTKNSL--GQHLQFFYADLNNPTRVTHVFNHSSSEISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYHDSNPEFQLVVGFHGGLYDSLTKLVHFTQRDYD 2036          
BLAST of Teneurin-2 vs. Ensembl Zebrafish
Match: TENM2 (si:dkey-34l15.2 [Source:ZFIN;Acc:ZDB-GENE-081027-5])

HSP 1 Score: 545.814 bits (1405), Expect = 2.580e-156
Identity = 386/1329 (29.04%), Postives = 609/1329 (45.82%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---------GESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAM-PSSSWK-----------FQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W      N    + FN ++      G+++R    P+  +Y + ER+ G+    V+      R +RS+     +E+  FV YL+ G W L+  ND   +E++ F+     S+ Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P C G+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      VC C   + G  C   +CS  C      + G+C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+DGCP  CN NGQC L     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C    Q       S    D L ++       +   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +    LK           T P C        D  V+  P  L+ + S           S+  +  VL   +++  T LKL H SSR  G++S L + +    VP +L +++L + V G    +     P L YTF WD+ +AY + ++GL+   V VGY YE+C S + WE +  ++ G++L    +G W+L+  HI +   GI+++G G ++F++Q    I  I G  G+ R +  C  C+G        +  A+ +   G + + D  ++R +         +  L+   ++ +  ++           +H NNP  +   LA +P    +++S++ S  I+ +   L   +LL          GE C    ER       +   L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C S +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+IAE        V  V ++G +  + G                       T  +  S  S+ ++  G L +AD    +I +V   +        Y+V SP  +ELY FN  G H +T S +TG  LY+  Y     +G L+ +V    N   KV RD   +             + L    +++ L + P+ S +             YN    L++  ++ E     F  Y   GRL +V  P+G+ T
Sbjct:  254 WRSLMHLNQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV---ESPRERRSIQTVVLNEAV-FVQYLDPGTWHLAFYNDGKEKESVSFSTAVLDSV-QECPRNCHGNGECVS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCICYSGWKGPECDVPISQCIDPQCGGHGTCTEGTCVCSLGYKGENCAEVDCLDPTCSNNGICV-NGECHCKPGWGGPSCELPRAQCPDQCHGHGAFIPDTG------VCSCDPNWMGPDCSVEVCSVDCGTHGVCMGGSCRCEEGWTGAACDQRVCNPLCVKHGTCKDGKCECEQGWNGEHCTIDGCPNRCNGNGQCLLGQN-SWHCECKTGWRGTGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQSPC----QNSPLCRGS---RDPLQVIQQGQHPEQKVRSFYDRVKMLVGRDSTHIIPADNPFNASLASLIRGQVVTTDGTPLVGVNVSFVKYPQYGYTLTRQDGTFDLIANGGASLTLRFERAP--FLSQERTVWLPWNIFYAMDTLMLK-------TEENTIPSCDLSGFVRPDPVVVASP--LSSFFSS-----KPGERSIIPETQVLHEQLEIPGTNLKLCHLSSRTPGYRSLLKITMTQAVVPLSLVKVHLMVAVEGHLFQKWFHASPNLAYTFIWDKTDAYGQHVYGLSDAVVSVGYEYESCPSLVLWEKRTAMLQGYELEPSSLGGWSLDKHHILNLRSGILHKGSGENVFVSQQPPIITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAAGIDGSLYVGDLNFVRRV---------YPNLNTTRILELRNKD----------FRHSNNP-THKYFLAVDPVSGALFISDTNSRRIYKVR-SLTGGRLLADNAEVVAGTGEQCLPFDERCGDGGKAVEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDSSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESATAIGISHTGVLYIAETDEKKINRVRQVSTNGEMSLLAGATSECDCKNDVNCNCFAGDDGYATDASLNSPMSLAVSPDGTLYIADLNNIRIRAVRTNRPGPSALGRYEVASPQEQELYVFNEEGLHLQTISLVTGLPLYNFSY---GPDGELATVVDNCNN-TVKVRRDGAGQGGAGLL------RLVLQPENQVVTLGLDPAGSLRSISALNQEIVLLGYNGNTGLLAT-KADETGWTTFYEYDSEGRLTNVTYPTGMVT 1503          

HSP 2 Score: 130.954 bits (328), Expect = 1.834e-29
Identity = 155/661 (23.45%), Postives = 293/661 (44.33%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSS--MEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  + +G+N L + +D N+R E   +Y++ + K  ++  Y  D Q    I ++  ++LA + V Y+ +G L  +          +D   R  S  +     ++ Y Y       K   +   + ++Y   +++ ++  ++  P+    ++   +SIGY R  Y P   +++ IYDF S +G      +     ++ + Y    +L  ++Y +  I F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P                   + ++DE      I  K++     G I   +N   QI+T ++      +T+   +D   +  +    Y+I RS    M +            L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DG+L Q+ +    + F YN+ G L++ Y R+         V+Y YD   R +  ++ +   Q  Q+FY D  N  R+TH+++H+S ++SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++DS + ++    R YD
Sbjct: 1619 RKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRITY--DAQGRPAI-WQPSSSLAVVNVSYSSTGQLVGLHRGSMSERTEFDAQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYIFEFDASNRITAVTMPSVARHTMFTHVSIGYIRNTYNPPESNASIIYDF-SEDGRPQATYFLGTGRRVLYKYGKLAKLSEILYDSTAITFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPV---------------DLYRYDE------ISGKVEHFGKFGVIYYDIN---QIITTAV------MTLSKHFDAHGR--IKEVQYEIFRSLMYWMTVQYDNMGRVIKRELKIGPY-ANTTQYRYEYDGDGQLSGVKVNDWSTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYRLDEDGYLSQRGS----DVFDYNSKGQLVRAYSRVAGGWS----VQYRYDGLGRRVSTKNSLG--QHLQFFYADLNNPTRVTHVFNHSSSEISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYHDSNPEFQLVVGFHGGLYDSLTKLVHFTQRDYD 2214          
BLAST of Teneurin-2 vs. Ensembl Zebrafish
Match: BX537102.3 (si:dkey-34l15.2 [Source:NCBI gene;Acc:563197])

HSP 1 Score: 543.888 bits (1400), Expect = 4.310e-156
Identity = 388/1319 (29.42%), Postives = 608/1319 (46.10%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRA-WRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---------GESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W      N    + FN ++      G+++R    P+  +Y + ER+ G+  W  V       R +RS+     +E+  FV YL+ G W L+  ND   +E++ F+     S+ Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P C G+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      VC C   + G  C   +CS  C      + G+C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+DGCP  CN NGQC L     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C    Q       S    D L ++       +   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +    LK           T P C        D  V+  P  L+ + S           S+  +  VL   +++  T LKL H SSR  G++S L + +    VP +L +++L + V G    +     P L YTF WD+ +AY + ++GL+   V VGY YE+C S + WE +  ++ G++L    +G W+L+  HI +   GI+++G G ++F++Q    I  I G  G+ R +  C  C+G        +  A+ +   G + + D  ++R +         +  L+   ++ +  ++           +H NNP  +   LA +P    +++S++ S  I+ +   L   +LL          GE C    ER       +   L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C S +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+IAE        V  V ++G +  + G                       T  +  S  S+ ++  G L +AD    +I +V   +        Y+V SP  +ELY FN  G H +T S +TG  LY+  Y     +G L+ +V    N   KV RD       L+ P      + LD    + ++ A+        YN    L++  ++ E     F  Y   GRL +V  P+G+ T
Sbjct:  114 WRSLMHLNQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV----ESPRERRSIQTVVLNEAV-FVQYLDPGTWHLAFYNDGKEKESVSFSTAVLDSV-QECPRNCHGNGECVS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCICYSGWKGPECDVPISQCIDPQCGGHGTCTEGTCVCSLGYKGENCAEVDCLDPTCSNNGICV-NGECHCKPGWGGPSCELPRAQCPDQCHGHGAFIPDTG------VCSCDPNWMGPDCSVEVCSVDCGTHGVCMGGSCRCEEGWTGAACDQRVCNPLCVKHGTCKDGKCECEQGWNGEHCTIDGCPNRCNGNGQCLLGQN-SWHCECKTGWRGTGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQSPC----QNSPLCRGS---RDPLQVIQQGQHPEQKVRSFYDRVKMLVGRDSTHIIPADNPFNASLASLIRGQVVTTDGTPLVGVNVSFVKYPQYGYTLTRQDGTFDLIANGGASLTLRFERAP--FLSQERTVWLPWNIFYAMDTLMLK-------TEENTIPSCDLSGFVRPDPVVVASP--LSSFFSS-----KPGERSIIPETQVLHEQLEIPGTNLKLCHLSSRTSGYRSLLKITMTQAVVPLSLVKVHLMVAVEGHLFQKWFHASPNLAYTFIWDKTDAYGQHVYGLSDAVVSVGYEYESCPSLVLWEKRTAMLQGYELEPSSLGGWSLDKHHILNLRSGILHKGSGENVFVSQQPPIITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAAGIDGSLYVGDLNFVRRV---------YPNLNTTRILELRNKD----------FRHSNNP-THKYFLAVDPVSGALFISDTNSRRIYKVR-SLTGGRLLADNAEVVAGTGEQCLPFDERCGDGGKAVEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDSSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESATAIGISHTGVLYIAETDEKKINRVRQVSTNGEMSLLAGATSECDCKNDVNCNCFAGDDGYATDASLNSPMSLAVSPDGTLYIADLNNIRIRAVRTNRPGPSALGRYEVASPQEQELYVFNEEGLHLQTISLVTGLPLYNFSY---GPDGELATVVDNCNN-TVKVRRDAGLLRLVLQ-PENQVVTLGLDPAGSLRSISALNQEIVLLGYNGNTGLLAT-KADETGWTTFYEYDSEGRLTNVTYPTGMVT 1357          

HSP 2 Score: 129.798 bits (325), Expect = 5.077e-29
Identity = 155/661 (23.45%), Postives = 293/661 (44.33%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSS--MEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  + +G+N L + +D N+R E   +Y++ + K  ++  Y  D Q    I ++  ++LA + V Y+ +G L  +          +D   R  S  +     ++ Y Y       K   +   + ++Y   +++ ++  ++  P+    ++   +SIGY R  Y P   +++ IYDF S +G      +     ++ + Y    +L  ++Y +  I F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P                   + ++DE      I  K++     G I   +N   QI+T ++      +T+   +D   +  +    Y+I RS    M +            L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DG+L Q+ +    + F YN+ G L++ Y R+         V+Y YD   R +  ++ +   Q  Q+FY D  N  R+TH+++H+S ++SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++DS + ++    R YD
Sbjct: 1473 RKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRITY--DAQGRPAI-WQPSSSLAVVNVSYSSTGQLVGLHRGSMSERTEFDAQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYIFEFDASNRITAVTMPSVARHTMFTHVSIGYIRNTYNPPESNASIIYDF-SEDGRPQATYFLGTGRRVLYKYGKLAKLSEILYDSTAITFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPV---------------DLYRYDE------ISGKVEHFGKFGVIYYDIN---QIITTAV------MTLSKHFDAHGR--IKEVQYEIFRSLMYWMTVQYDNMGRVIKRELKIGPY-ANTTQYRYEYDGDGQLSGVKVNDWSTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYRLDEDGYLSQRGS----DVFDYNSKGQLVRAYSRVAGGWS----VQYRYDGLGRRVSTKNSL--GQHLQFFYADLNNPTRVTHVFNHSSSEISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYHDSNPEFQLVVGFHGGLYDSLTKLVHFTQRDYD 2068          
BLAST of Teneurin-2 vs. Ensembl Xenopus
Match: tenm2 (teneurin transmembrane protein 3 [Source:HGNC Symbol;Acc:HGNC:29944])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 575/2183 (26.34%), Postives = 959/2183 (43.93%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISG-----RAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSN-CSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESCK---ERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN--FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLK-VNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQL-KNVKLNPFLLNSYQF 7990
            W  +   +    + FN T+     +G++ R    P+  +Y   E + G     R  R +   +   R+ RS++        GF+ YL  G+W ++  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G+G C+ G C C  GY G+NC    C    CS +GVC  +G C C QGW   +C   KS   D+ S    +   +G       C C   ++G  C   +C   C      + G C C EG++G  C +R C  RC +HG C +G C C +GWNG+HC +DGCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+      +   +    F+++I FLT    T         N+   SV+RG+V+ +DG+P  G  +        G T T +DG+FDLV  GG+ + L   R P    T Y+ V++  N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L+YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    I+ I G  G+ R +  C  C+G+       +  A+     G + + D  +IR +  +GN     ++ +        +  +NL     +LA    +P V  DL   +    KIY  +SL G       EL K+  +V   GE C    E  C      +   L  PKG+ +     ++F DG+ I+ +   N  I T++G     +  +R   C + +  SE RL+WPT +  N +D+S+Y +DN N+V ++  +N  V   AG    C  P +E  S    A++        I ++  G L+I E        +  V +DG +  V G                   D   K     + +S+  +  G L +AD G  +I +V   +      NY Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S    ++ +   +GN   ++ RD      ++ +P         D +   + +             Q+L++            FTY+ +SG L +    +G TT F       +Y  S+ +L N  F  G   N                       + +++K              A  V L +  + + +S+  + S I+    F T       N  Q     + +II+    D   F++E  + +  P+      +N  +  D  + ++        +++  +++   ++   R  ++NG+N L V YD  +R E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      ++ YD   R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  Y     ++ F Y    ++  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I      +Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I V YD   +    V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L   NS   +   YD    + +  G V Y  ++DGFL Q+      E F Y++ GLL           ++    Y YD   R I  +  +   +  Q+FY D     R+TH+Y+H+S +++  YY+   GHLF++ V   + +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD      AG +W     ++ KN+  +P   N Y F
Sbjct:  492 WRSQLSIDQPQFLKFNITLQKDALIGVYGRKGLPPSHTQYDFVELLEGSRLISREKRNLPESDKATRLPRSISLH----EAGFIQYLNSGIWHIAFYNDGKNPEPVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCYSGWKGTECDVPSTQCVDPLCGGHGICIMGSCACNSGYKGENCEEADCLDTFCSYHGVCI-HGECHCHQGWGGSNCEILKSMCPDQCSGHGTYIQESGS------CTCDPNWTGPDCSTEICPVDCGTHGVCMGGACRCEEGWTGPSCNQRACHPRCLEHGTCKDGKCECNQGWNGEHCNIDGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGTGCDVAMETLCADSKDNEQDGLIDCMDPDCCLQSSC----QNQPYCRGR-PDPQDIISQSQQSPSQQAAKPFYDRISFLTGPDSTHVMPGDNPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYPNYGFTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIAWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPNPVIVSSPLSTFFRTSPEDS-PIIPETQVLHEETAIPGTDLKLSYLSSRAAGYKSVLKITMTHSTIPFNLMKVHLMVAVVGRLFQKWFPASPNLSYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVISCIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNFIRRIFPSGNVTSVLELRNKDF-----RHSSNL-AHRYYLA---TDP-VTGDLYVSDANTRKIYRPKSLLGM-----KELIKNAEVVAGTGEQCTPFDEARCGEGGKAVEATLTTPKGIAVDKNGIIYFVDGKVIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISEVRLEWPTDLAINPMDNSVYVLDN-NVVLQI-TENHQVRIAAGRPMYCQVPGVEY-SFGKYAVQAILESATAISVSYNGVLYITETDEKKVNRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQNGDGYAKDTKLSAPSSLAASPDGTLYIADLGNIRIRAVSKNRPFLNSMNY-YEVASPADQELYIFDVNGTHQYTMSLVTGDYLYNFSY---SNENDITAVTDSNGN-TLRIRRDPNRMPVRIVSP---------DNQVIWLTIGTNGCLKSMTAQGQELVL------------FTYHGNSGLLATKSDETGWTTFF-------DYD-SEGRLTNVTFPTGVVTN----------------------LHGEMDK--------------AITVDLESSSREEDVSITSNLSSID---SFYTMVQDQLKNSYQVGYDGSVRIIYGNGMD-SHFQTE-PHILAGPANPTVAKRNMTLPGDNGHNLVE-------WRFRKEQAQGKVNVFGRKLRVNGRNLLSVDYDRTTRTE--KIYDDHR-KFLLRIAYDSSGHPTLWLP---SSKLMAVNVTYSSTGQIGSIQRGTTSEKVEYDAQGRIVSRLFA-DGKTWSYTY-----LEKTMVLLLHSQRQYIFEYDLLDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPEGNASVIMDYNE-EGQLLQTAYLGTGRRVLFKYRRQTKVSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIELYQFDDIS--GKVDQFGKFGVIYYDINQIISTAVMTYTKHF-----DPHGRIKEIQYEILRSLMYWITVQYDSMGR----VTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLIPLRYDLRDRITR-LGDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKAGGWTVI----YRYDGLGRRISSKTSL--GKHLQFFYADLNYPSRITHVYNHSSSEITCLYYD-LQGHLFAMEVSSGEEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNPDFQLVIGFHGGLYDPLTKLIHFGQRDYDI----LAG-RWTTPDIEIWKNIGKDPAPFNLYMF 2482          
BLAST of Teneurin-2 vs. Ensembl Xenopus
Match: tenm2 (teneurin transmembrane protein 3 [Source:HGNC Symbol;Acc:HGNC:29944])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 575/2183 (26.34%), Postives = 959/2183 (43.93%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISG-----RAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSN-CSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESCK---ERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN--FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLK-VNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQL-KNVKLNPFLLNSYQF 7990
            W  +   +    + FN T+     +G++ R    P+  +Y   E + G     R  R +   +   R+ RS++        GF+ YL  G+W ++  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G+G C+ G C C  GY G+NC    C    CS +GVC  +G C C QGW   +C   KS   D+ S    +   +G       C C   ++G  C   +C   C      + G C C EG++G  C +R C  RC +HG C +G C C +GWNG+HC +DGCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+      +   +    F+++I FLT    T         N+   SV+RG+V+ +DG+P  G  +        G T T +DG+FDLV  GG+ + L   R P    T Y+ V++  N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L+YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    I+ I G  G+ R +  C  C+G+       +  A+     G + + D  +IR +  +GN     ++ +        +  +NL     +LA    +P V  DL   +    KIY  +SL G       EL K+  +V   GE C    E  C      +   L  PKG+ +     ++F DG+ I+ +   N  I T++G     +  +R   C + +  SE RL+WPT +  N +D+S+Y +DN N+V ++  +N  V   AG    C  P +E  S    A++        I ++  G L+I E        +  V +DG +  V G                   D   K     + +S+  +  G L +AD G  +I +V   +      NY Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S    ++ +   +GN   ++ RD      ++ +P         D +   + +             Q+L++            FTY+ +SG L +    +G TT F       +Y  S+ +L N  F  G   N                       + +++K              A  V L +  + + +S+  + S I+    F T       N  Q     + +II+    D   F++E  + +  P+      +N  +  D  + ++        +++  +++   ++   R  ++NG+N L V YD  +R E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      ++ YD   R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  Y     ++ F Y    ++  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I      +Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I V YD   +    V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L   NS   +   YD    + +  G V Y  ++DGFL Q+      E F Y++ GLL           ++    Y YD   R I  +  +   +  Q+FY D     R+TH+Y+H+S +++  YY+   GHLF++ V   + +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD      AG +W     ++ KN+  +P   N Y F
Sbjct:  175 WRSQLSIDQPQFLKFNITLQKDALIGVYGRKGLPPSHTQYDFVELLEGSRLISREKRNLPESDKATRLPRSISLH----EAGFIQYLNSGIWHIAFYNDGKNPEPVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCYSGWKGTECDVPSTQCVDPLCGGHGICIMGSCACNSGYKGENCEEADCLDTFCSYHGVCI-HGECHCHQGWGGSNCEILKSMCPDQCSGHGTYIQESGS------CTCDPNWTGPDCSTEICPVDCGTHGVCMGGACRCEEGWTGPSCNQRACHPRCLEHGTCKDGKCECNQGWNGEHCNIDGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGTGCDVAMETLCADSKDNEQDGLIDCMDPDCCLQSSC----QNQPYCRGR-PDPQDIISQSQQSPSQQAAKPFYDRISFLTGPDSTHVMPGDNPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYPNYGFTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIAWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPNPVIVSSPLSTFFRTSPEDS-PIIPETQVLHEETAIPGTDLKLSYLSSRAAGYKSVLKITMTHSTIPFNLMKVHLMVAVVGRLFQKWFPASPNLSYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVISCIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNFIRRIFPSGNVTSVLELRNKDF-----RHSSNL-AHRYYLA---TDP-VTGDLYVSDANTRKIYRPKSLLGM-----KELIKNAEVVAGTGEQCTPFDEARCGEGGKAVEATLTTPKGIAVDKNGIIYFVDGKVIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISEVRLEWPTDLAINPMDNSVYVLDN-NVVLQI-TENHQVRIAAGRPMYCQVPGVEY-SFGKYAVQAILESATAISVSYNGVLYITETDEKKVNRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQNGDGYAKDTKLSAPSSLAASPDGTLYIADLGNIRIRAVSKNRPFLNSMNY-YEVASPADQELYIFDVNGTHQYTMSLVTGDYLYNFSY---SNENDITAVTDSNGN-TLRIRRDPNRMPVRIVSP---------DNQVIWLTIGTNGCLKSMTAQGQELVL------------FTYHGNSGLLATKSDETGWTTFF-------DYD-SEGRLTNVTFPTGVVTN----------------------LHGEMDK--------------AITVDLESSSREEDVSITSNLSSID---SFYTMVQDQLKNSYQVGYDGSVRIIYGNGMD-SHFQTE-PHILAGPANPTVAKRNMTLPGDNGHNLVE-------WRFRKEQAQGKVNVFGRKLRVNGRNLLSVDYDRTTRTE--KIYDDHR-KFLLRIAYDSSGHPTLWLP---SSKLMAVNVTYSSTGQIGSIQRGTTSEKVEYDAQGRIVSRLFA-DGKTWSYTY-----LEKTMVLLLHSQRQYIFEYDLLDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPEGNASVIMDYNE-EGQLLQTAYLGTGRRVLFKYRRQTKVSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIELYQFDDIS--GKVDQFGKFGVIYYDINQIISTAVMTYTKHF-----DPHGRIKEIQYEILRSLMYWITVQYDSMGR----VTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLIPLRYDLRDRITR-LGDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKAGGWTVI----YRYDGLGRRISSKTSL--GKHLQFFYADLNYPSRITHVYNHSSSEITCLYYD-LQGHLFAMEVSSGEEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNPDFQLVIGFHGGLYDPLTKLIHFGQRDYDI----LAG-RWTTPDIEIWKNIGKDPAPFNLYMF 2165          
BLAST of Teneurin-2 vs. Ensembl Xenopus
Match: tenm2 (teneurin transmembrane protein 3 [Source:HGNC Symbol;Acc:HGNC:29944])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 575/2192 (26.23%), Postives = 959/2192 (43.75%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISG-----RAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSN-CSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESCK---ERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN--FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLK-VNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQL-KNVKLNPFLLNSYQF 7990
            W  +   +    + FN T+     +G++ R    P+  +Y   E + G     R  R +   +   R+ RS++        GF+ YL  G+W ++  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G+G C+ G C C  GY G+NC    C    CS +GVC  +G C C QGW   +C   KS   D+ S    +   +G       C C   ++G  C   +C   C      + G C C EG++G  C +R C  RC +HG C +G C C +GWNG+HC +         DGCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+      +   +    F+++I FLT    T         N+   SV+RG+V+ +DG+P  G  +        G T T +DG+FDLV  GG+ + L   R P    T Y+ V++  N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L+YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    I+ I G  G+ R +  C  C+G+       +  A+     G + + D  +IR +  +GN     ++ +        +  +NL     +LA    +P V  DL   +    KIY  +SL G       EL K+  +V   GE C    E  C      +   L  PKG+ +     ++F DG+ I+ +   N  I T++G     +  +R   C + +  SE RL+WPT +  N +D+S+Y +DN N+V ++  +N  V   AG    C  P +E  S    A++        I ++  G L+I E        +  V +DG +  V G                   D   K     + +S+  +  G L +AD G  +I +V   +      NY Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S    ++ +   +GN   ++ RD      ++ +P         D +   + +             Q+L++            FTY+ +SG L +    +G TT F       +Y  S+ +L N  F  G   N                       + +++K              A  V L +  + + +S+  + S I+    F T       N  Q     + +II+    D   F++E  + +  P+      +N  +  D  + ++        +++  +++   ++   R  ++NG+N L V YD  +R E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      ++ YD   R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  Y     ++ F Y    ++  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I      +Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I V YD   +    V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L   NS   +   YD    + +  G V Y  ++DGFL Q+      E F Y++ GLL           ++    Y YD   R I  +  +   +  Q+FY D     R+TH+Y+H+S +++  YY+   GHLF++ V   + +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD      AG +W     ++ KN+  +P   N Y F
Sbjct:  306 WRSQLSIDQPQFLKFNITLQKDALIGVYGRKGLPPSHTQYDFVELLEGSRLISREKRNLPESDKATRLPRSISLH----EAGFIQYLNSGIWHIAFYNDGKNPEPVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCYSGWKGTECDVPSTQCVDPLCGGHGICIMGSCACNSGYKGENCEEADCLDTFCSYHGVCI-HGECHCHQGWGGSNCEILKSMCPDQCSGHGTYIQESGS------CTCDPNWTGPDCSTEICPVDCGTHGVCMGGACRCEEGWTGPSCNQRACHPRCLEHGTCKDGKCECNQGWNGEHCNIAHYLDKIVKDGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGTGCDVAMETLCADSKDNEQDGLIDCMDPDCCLQSSC----QNQPYCRGR-PDPQDIISQSQQSPSQQAAKPFYDRISFLTGPDSTHVMPGDNPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYPNYGFTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIAWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPNPVIVSSPLSTFFRTSPEDS-PIIPETQVLHEETAIPGTDLKLSYLSSRAAGYKSVLKITMTHSTIPFNLMKVHLMVAVVGRLFQKWFPASPNLSYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVISCIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNFIRRIFPSGNVTSVLELRNKDF-----RHSSNL-AHRYYLA---TDP-VTGDLYVSDANTRKIYRPKSLLGM-----KELIKNAEVVAGTGEQCTPFDEARCGEGGKAVEATLTTPKGIAVDKNGIIYFVDGKVIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISEVRLEWPTDLAINPMDNSVYVLDN-NVVLQI-TENHQVRIAAGRPMYCQVPGVEY-SFGKYAVQAILESATAISVSYNGVLYITETDEKKVNRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQNGDGYAKDTKLSAPSSLAASPDGTLYIADLGNIRIRAVSKNRPFLNSMNY-YEVASPADQELYIFDVNGTHQYTMSLVTGDYLYNFSY---SNENDITAVTDSNGN-TLRIRRDPNRMPVRIVSP---------DNQVIWLTIGTNGCLKSMTAQGQELVL------------FTYHGNSGLLATKSDETGWTTFF-------DYD-SEGRLTNVTFPTGVVTN----------------------LHGEMDK--------------AITVDLESSSREEDVSITSNLSSID---SFYTMVQDQLKNSYQVGYDGSVRIIYGNGMD-SHFQTE-PHILAGPANPTVAKRNMTLPGDNGHNLVE-------WRFRKEQAQGKVNVFGRKLRVNGRNLLSVDYDRTTRTE--KIYDDHR-KFLLRIAYDSSGHPTLWLP---SSKLMAVNVTYSSTGQIGSIQRGTTSEKVEYDAQGRIVSRLFA-DGKTWSYTY-----LEKTMVLLLHSQRQYIFEYDLLDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPEGNASVIMDYNE-EGQLLQTAYLGTGRRVLFKYRRQTKVSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIELYQFDDIS--GKVDQFGKFGVIYYDINQIISTAVMTYTKHF-----DPHGRIKEIQYEILRSLMYWITVQYDSMGR----VTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLIPLRYDLRDRITR-LGDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKAGGWTVI----YRYDGLGRRISSKTSL--GKHLQFFYADLNYPSRITHVYNHSSSEITCLYYD-LQGHLFAMEVSSGEEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNPDFQLVIGFHGGLYDPLTKLIHFGQRDYDI----LAG-RWTTPDIEIWKNIGKDPAPFNLYMF 2305          
BLAST of Teneurin-2 vs. Ensembl Xenopus
Match: tenm2 (teneurin transmembrane protein 3 [Source:HGNC Symbol;Acc:HGNC:29944])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 575/2192 (26.23%), Postives = 959/2192 (43.75%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISG-----RAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSN-CSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESCK---ERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN--FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLK-VNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQL-KNVKLNPFLLNSYQF 7990
            W  +   +    + FN T+     +G++ R    P+  +Y   E + G     R  R +   +   R+ RS++        GF+ YL  G+W ++  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G+G C+ G C C  GY G+NC    C    CS +GVC  +G C C QGW   +C   KS   D+ S    +   +G       C C   ++G  C   +C   C      + G C C EG++G  C +R C  RC +HG C +G C C +GWNG+HC +         DGCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+      +   +    F+++I FLT    T         N+   SV+RG+V+ +DG+P  G  +        G T T +DG+FDLV  GG+ + L   R P    T Y+ V++  N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L+YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    I+ I G  G+ R +  C  C+G+       +  A+     G + + D  +IR +  +GN     ++ +        +  +NL     +LA    +P V  DL   +    KIY  +SL G       EL K+  +V   GE C    E  C      +   L  PKG+ +     ++F DG+ I+ +   N  I T++G     +  +R   C + +  SE RL+WPT +  N +D+S+Y +DN N+V ++  +N  V   AG    C  P +E  S    A++        I ++  G L+I E        +  V +DG +  V G                   D   K     + +S+  +  G L +AD G  +I +V   +      NY Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S    ++ +   +GN   ++ RD      ++ +P         D +   + +             Q+L++            FTY+ +SG L +    +G TT F       +Y  S+ +L N  F  G   N                       + +++K              A  V L +  + + +S+  + S I+    F T       N  Q     + +II+    D   F++E  + +  P+      +N  +  D  + ++        +++  +++   ++   R  ++NG+N L V YD  +R E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      ++ YD   R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  Y     ++ F Y    ++  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I      +Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I V YD   +    V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L   NS   +   YD    + +  G V Y  ++DGFL Q+      E F Y++ GLL           ++    Y YD   R I  +  +   +  Q+FY D     R+TH+Y+H+S +++  YY+   GHLF++ V   + +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD      AG +W     ++ KN+  +P   N Y F
Sbjct:  299 WRSQLSIDQPQFLKFNITLQKDALIGVYGRKGLPPSHTQYDFVELLEGSRLISREKRNLPESDKATRLPRSISLH----EAGFIQYLNSGIWHIAFYNDGKNPEPVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCYSGWKGTECDVPSTQCVDPLCGGHGICIMGSCACNSGYKGENCEEADCLDTFCSYHGVCI-HGECHCHQGWGGSNCEILKSMCPDQCSGHGTYIQESGS------CTCDPNWTGPDCSTEICPVDCGTHGVCMGGACRCEEGWTGPSCNQRACHPRCLEHGTCKDGKCECNQGWNGEHCNIAHYLDKIVKDGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGTGCDVAMETLCADSKDNEQDGLIDCMDPDCCLQSSC----QNQPYCRGR-PDPQDIISQSQQSPSQQAAKPFYDRISFLTGPDSTHVMPGDNPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYPNYGFTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIAWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPNPVIVSSPLSTFFRTSPEDS-PIIPETQVLHEETAIPGTDLKLSYLSSRAAGYKSVLKITMTHSTIPFNLMKVHLMVAVVGRLFQKWFPASPNLSYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVISCIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNFIRRIFPSGNVTSVLELRNKDF-----RHSSNL-AHRYYLA---TDP-VTGDLYVSDANTRKIYRPKSLLGM-----KELIKNAEVVAGTGEQCTPFDEARCGEGGKAVEATLTTPKGIAVDKNGIIYFVDGKVIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISEVRLEWPTDLAINPMDNSVYVLDN-NVVLQI-TENHQVRIAAGRPMYCQVPGVEY-SFGKYAVQAILESATAISVSYNGVLYITETDEKKVNRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQNGDGYAKDTKLSAPSSLAASPDGTLYIADLGNIRIRAVSKNRPFLNSMNY-YEVASPADQELYIFDVNGTHQYTMSLVTGDYLYNFSY---SNENDITAVTDSNGN-TLRIRRDPNRMPVRIVSP---------DNQVIWLTIGTNGCLKSMTAQGQELVL------------FTYHGNSGLLATKSDETGWTTFF-------DYD-SEGRLTNVTFPTGVVTN----------------------LHGEMDK--------------AITVDLESSSREEDVSITSNLSSID---SFYTMVQDQLKNSYQVGYDGSVRIIYGNGMD-SHFQTE-PHILAGPANPTVAKRNMTLPGDNGHNLVE-------WRFRKEQAQGKVNVFGRKLRVNGRNLLSVDYDRTTRTE--KIYDDHR-KFLLRIAYDSSGHPTLWLP---SSKLMAVNVTYSSTGQIGSIQRGTTSEKVEYDAQGRIVSRLFA-DGKTWSYTY-----LEKTMVLLLHSQRQYIFEYDLLDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPEGNASVIMDYNE-EGQLLQTAYLGTGRRVLFKYRRQTKVSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIELYQFDDIS--GKVDQFGKFGVIYYDINQIISTAVMTYTKHF-----DPHGRIKEIQYEILRSLMYWITVQYDSMGR----VTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLIPLRYDLRDRITR-LGDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKAGGWTVI----YRYDGLGRRISSKTSL--GKHLQFFYADLNYPSRITHVYNHSSSEITCLYYD-LQGHLFAMEVSSGEEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNPDFQLVIGFHGGLYDPLTKLIHFGQRDYDI----LAG-RWTTPDIEIWKNIGKDPAPFNLYMF 2298          
BLAST of Teneurin-2 vs. Ensembl Xenopus
Match: tenm2 (teneurin transmembrane protein 3 [Source:HGNC Symbol;Acc:HGNC:29944])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 575/2189 (26.27%), Postives = 959/2189 (43.81%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISG-----RAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSN-CSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCT------LDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESCK---ERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAI--KKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN--FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQF----TRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLK-VNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQL-KNVKLNPFLLNSYQF 7990
            W  +   +    + FN T+     +G++ R    P+  +Y   E + G     R  R +   +   R+ RS++        GF+ YL  G+W ++  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G+G C+ G C C  GY G+NC    C    CS +GVC  +G C C QGW   +C   KS   D+ S    +   +G       C C   ++G  C   +C   C      + G C C EG++G  C +R C  RC +HG C +G C C +GWNG+HC       L+GCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+      +   +    F+++I FLT    T         N+   SV+RG+V+ +DG+P  G  +        G T T +DG+FDLV  GG+ + L   R P    T Y+ V++  N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L+YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    I+ I G  G+ R +  C  C+G+       +  A+     G + + D  +IR +  +GN     ++ +        +  +NL     +LA    +P V  DL   +    KIY  +SL G       EL K+  +V   GE C    E  C      +   L  PKG+ +     ++F DG+ I+ +   N  I T++G     +  +R   C + +  SE RL+WPT +  N +D+S+Y +DN N+V ++  +N  V   AG    C  P +E  S    A++        I ++  G L+I E        +  V +DG +  V G                   D   K     + +S+  +  G L +AD G  +I +V   +      NY Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S    ++ +   +GN   ++ RD      ++ +P         D +   + +             Q+L++            FTY+ +SG L +    +G TT F       +Y  S+ +L N  F  G   N                       + +++K              A  V L +  + + +S+  + S I+    F T       N  Q     + +II+    D   F++E  + +  P+      +N  +  D  + ++        +++  +++   ++   R  ++NG+N L V YD  +R E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      ++ YD   R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  Y     ++ F Y    ++  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I      +Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I V YD   +    V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L   NS   +   YD    + +  G V Y  ++DGFL Q+      E F Y++ GLL           ++    Y YD   R I  +  +   +  Q+FY D     R+TH+Y+H+S +++  YY+   GHLF++ V   + +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD      AG +W     ++ KN+  +P   N Y F
Sbjct:  236 WRSQLSIDQPQFLKFNITLQKDALIGVYGRKGLPPSHTQYDFVELLEGSRLISREKRNLPESDKATRLPRSISLH----EAGFIQYLNSGIWHIAFYNDGKNPEPVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCYSGWKGTECDVPSTQCVDPLCGGHGICIMGSCACNSGYKGENCEEADCLDTFCSYHGVCI-HGECHCHQGWGGSNCEILKSMCPDQCSGHGTYIQESGS------CTCDPNWTGPDCSTEICPVDCGTHGVCMGGACRCEEGWTGPSCNQRACHPRCLEHGTCKDGKCECNQGWNGEHCNIGKRRLLNGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGTGCDVAMETLCADSKDNEQDGLIDCMDPDCCLQSSC----QNQPYCRGR-PDPQDIISQSQQSPSQQAAKPFYDRISFLTGPDSTHVMPGDNPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYPNYGFTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIAWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPNPVIVSSPLSTFFRTSPEDS-PIIPETQVLHEETAIPGTDLKLSYLSSRAAGYKSVLKITMTHSTIPFNLMKVHLMVAVVGRLFQKWFPASPNLSYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVISCIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNFIRRIFPSGNVTSVLELRNKDF-----RHSSNL-AHRYYLA---TDP-VTGDLYVSDANTRKIYRPKSLLGM-----KELIKNAEVVAGTGEQCTPFDEARCGEGGKAVEATLTTPKGIAVDKNGIIYFVDGKVIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISEVRLEWPTDLAINPMDNSVYVLDN-NVVLQI-TENHQVRIAAGRPMYCQVPGVEY-SFGKYAVQAILESATAISVSYNGVLYITETDEKKVNRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQNGDGYAKDTKLSAPSSLAASPDGTLYIADLGNIRIRAVSKNRPFLNSMNY-YEVASPADQELYIFDVNGTHQYTMSLVTGDYLYNFSY---SNENDITAVTDSNGN-TLRIRRDPNRMPVRIVSP---------DNQVIWLTIGTNGCLKSMTAQGQELVL------------FTYHGNSGLLATKSDETGWTTFF-------DYD-SEGRLTNVTFPTGVVTN----------------------LHGEMDK--------------AITVDLESSSREEDVSITSNLSSID---SFYTMVQDQLKNSYQVGYDGSVRIIYGNGMD-SHFQTE-PHILAGPANPTVAKRNMTLPGDNGHNLVE-------WRFRKEQAQGKVNVFGRKLRVNGRNLLSVDYDRTTRTE--KIYDDHR-KFLLRIAYDSSGHPTLWLP---SSKLMAVNVTYSSTGQIGSIQRGTTSEKVEYDAQGRIVSRLFA-DGKTWSYTY-----LEKTMVLLLHSQRQYIFEYDLLDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPEGNASVIMDYNE-EGQLLQTAYLGTGRRVLFKYRRQTKVSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIELYQFDDIS--GKVDQFGKFGVIYYDINQIISTAVMTYTKHF-----DPHGRIKEIQYEILRSLMYWITVQYDSMGR----VTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLIPLRYDLRDRITR-LGDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKAGGWTVI----YRYDGLGRRISSKTSLG--KHLQFFYADLNYPSRITHVYNHSSSEITCLYYD-LQGHLFAMEVSSGEEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNPDFQLVIGFHGGLYDPLTKLIHFGQRDYDI----LAG-RWTTPDIEIWKNIGKDPAPFNLYMF 2232          
BLAST of Teneurin-2 vs. Ensembl Mouse
Match: Tenm3 (teneurin transmembrane protein 3 [Source:MGI Symbol;Acc:MGI:1345183])

HSP 1 Score: 547.354 bits (1409), Expect = 1.409e-156
Identity = 393/1316 (29.86%), Postives = 612/1316 (46.50%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFE-----RISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKV-------------------EGDAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  + F +    + FN ++     +G++ R    P+  +Y   E     R+  R  R ++      R  RS++        GF+ YL+ G+W L+  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G G C+ G C C  GY G+NC    C    CS +GVC  +G C C  GW   +C   K   +D+ S    +   +G       C C   ++G  C   +CS  C +    + G+C C EG++G  C +R C  RC +HG C +G C C +GWNG+HCT++GCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+    L T   +   +F+++I FL     T         N+   SV+RG+V+ +DG+P  G  +        G+T T +DG+FDLV  GG+ + L   R P    T Y+ V++P N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    ++ I G  G+ R +  C  C+G+       +  A+     G + + D  Y+R +  +GN     ++ S     +             +LA    +P V  DL   +    +IY  +SL+G+      +L K+  +V   GE C    E  C      +   L+ PKGM I     ++F DG  I+ +   N  I T++G     +  +R   C + +  S+ RL+WPT +  N +D+SIY +DN N+V ++  +N  V   AG    C  P +E       A++        I ++  G L+I E     I     V +DG +  V                    GD   K A   + +S+  +  G L +AD G  +I +V   + +  +   Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S +  ++ +   +GN   ++ RD      ++ +P      +T+     + ++ A       F Y+    L++  +S E     F  Y   GRL +V  P+GV T
Sbjct:  404 WRSQLFIDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLVESERAGRQARSVSLH----EAGFIQYLDSGIWHLAFYNDGKNPEQVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCI-HGECHCNPGWGGSNCEILKTMCADQCSGHGTYLQESGS------CTCDPNWTGPDCSNEICSVDCGSHGVCMGGSCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSC----QNQPYC-RGLPDPQDIISQSLQTPSQQAAKSFYDRISFLIGSDSTHVLPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYSEYGYTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIPWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPSPIIVSSPLSTFFRSSPEDS-PIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQAVIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVSSIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVLELSSNPAHRY-------------YLA---TDP-VTGDLYVSDTNTRRIYRPKSLTGA-----KDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGLIYFVDGTMIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDN-NVVLQI-TENRQVRIAAGRPMHCQVPGVEYPVGK-HAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLNAPSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSY---SNDNDVTAVTDSNGN-TLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLAT-KSDETGWTTFFDYDSEGRLTNVTFPTGVVT 1649          

HSP 2 Score: 137.887 bits (346), Expect = 1.685e-31
Identity = 152/644 (23.60%), Postives = 287/644 (44.57%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  ++NG+N L V +D  ++ E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      +++YD+  R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  +     ++ F Y    +L  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I       Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I + YD    N   V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L  +S A   P+ Y + D  T L    G V Y  ++DGFL Q+      E F Y++ GLL       S   ++    Y YD   R +  +  +   Q  Q+FY D     R+TH+Y+H+S +++S YY+   GHLF++ +     +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD
Sbjct: 1765 RKLRVNGRNLLSVDFDRTTKTE--KIYDDHR-KFLLRIAYDTSGHPTLWLP---SSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDSQGRIVSRVFA-DGKTWSYTY-----LEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNE-EGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDIS--GKVEQFGKFGVIYYDINQIISTAVMTYTKHF-----DAHGRIKEIQYEIFRSLMYWITIQYD----NMGRVTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSSSARLTPLRYDLRDRITRL----GDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKGSGWTVI----YRYDGLGRRVSSKTSL--GQHLQFFYADLTYPTRITHVYNHSSSEITSLYYD-LQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNVDFQLVIGFHGGLYDPLTKLIHFGERDYD 2358          
BLAST of Teneurin-2 vs. Ensembl Mouse
Match: Tenm2 (teneurin transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:1345184])

HSP 1 Score: 545.814 bits (1405), Expect = 4.964e-156
Identity = 381/1303 (29.24%), Postives = 598/1303 (45.89%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            + FN ++      G+++R    P+  +Y   ER+ G+    V+      R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  ++G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C  +          C    D   ++   +   P   +F+++I+ L  +  T         N   +S++RG+V+  DG+P  G  +        G+T T +DG FDL+  GGS + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       +  S+ I+P           +  VL   ++L  T +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  H  +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR +  + N     ++ +         + +N  G   +LA       V   L   +    +IY  +SLSG+      +L  +  +V   GE C    E  C      +   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  479 LKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV---ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GLCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCAAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDSG------LCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNS--------LLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSSLVSLIRGQVVTMDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGSALTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSASPASNPIVP-----------ETQVLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHTLNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELRNKEF------KHSNSPGHKYYLAVDP----VTGSLYVSDTNSRRIYRVKSLSGA-----KDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---SADNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKAVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1712          

HSP 2 Score: 141.739 bits (356), Expect = 1.367e-32
Identity = 166/690 (24.06%), Postives = 292/690 (42.32%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   D    V K++   +  GF    ++   GPLV +  Y        + +I  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  +NV   P   N Y F
Sbjct: 1828 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGY-DETTGVLKMVNLQS-GGFSCTIRYRKVGPLVDKQIYRFS----EEGMI--NARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWRNVGKEPAPFNLYMF 2451          
BLAST of Teneurin-2 vs. Ensembl Mouse
Match: Tenm2 (teneurin transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:1345184])

HSP 1 Score: 541.576 bits (1394), Expect = 1.328e-154
Identity = 381/1303 (29.24%), Postives = 598/1303 (45.89%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            + FN ++      G+++R    P+  +Y   ER+ G+    V+      R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  ++G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C  +          C    D   ++   +   P   +F+++I+ L  +  T         N   +S++RG+V+  DG+P  G  +        G+T T +DG FDL+  GGS + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       +  S+ I+P           +  VL   ++L  T +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  H  +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR +  + N     ++ +         + +N  G   +LA       V   L   +    +IY  +SLSG+      +L  +  +V   GE C    E  C      +   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  479 LKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV---ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GLCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCAAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDSG------LCSCDPNWMGPDCSV-VCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNS--------LLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSSLVSLIRGQVVTMDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGSALTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSASPASNPIVP-----------ETQVLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHTLNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELRNKEF------KHSNSPGHKYYLAVDP----VTGSLYVSDTNSRRIYRVKSLSGA-----KDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---SADNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKAVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1711          

HSP 2 Score: 141.739 bits (356), Expect = 1.333e-32
Identity = 166/690 (24.06%), Postives = 292/690 (42.32%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   D    V K++   +  GF    ++   GPLV +  Y        + +I  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  +NV   P   N Y F
Sbjct: 1827 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGY-DETTGVLKMVNLQS-GGFSCTIRYRKVGPLVDKQIYRFS----EEGMI--NARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWRNVGKEPAPFNLYMF 2450          
BLAST of Teneurin-2 vs. Ensembl Mouse
Match: Tenm2 (teneurin transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:1345184])

HSP 1 Score: 541.576 bits (1394), Expect = 1.328e-154
Identity = 381/1303 (29.24%), Postives = 598/1303 (45.89%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            + FN ++      G+++R    P+  +Y   ER+ G+    V+      R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  ++G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C  +          C    D   ++   +   P   +F+++I+ L  +  T         N   +S++RG+V+  DG+P  G  +        G+T T +DG FDL+  GGS + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       +  S+ I+P           +  VL   ++L  T +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  H  +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR +  + N     ++ +         + +N  G   +LA       V   L   +    +IY  +SLSG+      +L  +  +V   GE C    E  C      +   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  479 LKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV---ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GLCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCAAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDSG------LCSCDPNWMGPDCSV-VCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNS--------LLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSSLVSLIRGQVVTMDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGSALTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSASPASNPIVP-----------ETQVLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHTLNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELRNKEF------KHSNSPGHKYYLAVDP----VTGSLYVSDTNSRRIYRVKSLSGA-----KDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---SADNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKAVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1711          

HSP 2 Score: 141.739 bits (356), Expect = 1.333e-32
Identity = 166/690 (24.06%), Postives = 292/690 (42.32%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   D    V K++   +  GF    ++   GPLV +  Y        + +I  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  +NV   P   N Y F
Sbjct: 1827 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGY-DETTGVLKMVNLQS-GGFSCTIRYRKVGPLVDKQIYRFS----EEGMI--NARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWRNVGKEPAPFNLYMF 2450          
BLAST of Teneurin-2 vs. Ensembl Mouse
Match: Tenm3 (teneurin transmembrane protein 3 [Source:MGI Symbol;Acc:MGI:1345183])

HSP 1 Score: 540.421 bits (1391), Expect = 2.065e-154
Identity = 393/1325 (29.66%), Postives = 614/1325 (46.34%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFE-----RISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKV-------------------EGDAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  + F +    + FN ++     +G++ R    P+  +Y   E     R+  R  R ++      R  RS++        GF+ YL+ G+W L+  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G G C+ G C C  GY G+NC    C    CS +GVC  +G C C  GW   +C   K   +D+ S    +   +G       C C   ++G  C   +CS  C +    + G+C C EG++G  C +R C  RC +HG C +G C C +GWNG+HCT+         +GCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+    L T   +   +F+++I FL     T         N+   SV+RG+V+ +DG+P  G  +        G+T T +DG+FDLV  GG+ + L   R P    T Y+ V++P N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    ++ I G  G+ R +  C  C+G+       +  A+     G + + D  Y+R +  +GN     ++ +         R ++      +LA    +P V  DL   +    +IY  +SL+G+      +L K+  +V   GE C    E  C      +   L+ PKGM I     ++F DG  I+ +   N  I T++G     +  +R   C + +  S+ RL+WPT +  N +D+SIY +DN N+V ++  +N  V   AG    C  P +E       A++        I ++  G L+I E     I     V +DG +  V                    GD   K A   + +S+  +  G L +AD G  +I +V   + +  +   Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S +  ++ +   +GN   ++ RD      ++ +P      +T+     + ++ A       F Y+    L++  +S E     F  Y   GRL +V  P+GV T
Sbjct:  404 WRSQLFIDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLVESERAGRQARSVSLH----EAGFIQYLDSGIWHLAFYNDGKNPEQVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCI-HGECHCNPGWGGSNCEILKTMCADQCSGHGTYLQESGS------CTCDPNWTGPDCSNEICSVDCGSHGVCMGGSCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIAHYLDKIVKEGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSC----QNQPYC-RGLPDPQDIISQSLQTPSQQAAKSFYDRISFLIGSDSTHVLPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYSEYGYTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIPWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPSPIIVSSPLSTFFRSSPEDS-PIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQAVIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVSSIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDF------RHSSNPAHRYYLA---TDP-VTGDLYVSDTNTRRIYRPKSLTGA-----KDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGLIYFVDGTMIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDN-NVVLQI-TENRQVRIAAGRPMHCQVPGVEYPVGK-HAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLNAPSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSY---SNDNDVTAVTDSNGN-TLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLAT-KSDETGWTTFFDYDSEGRLTNVTFPTGVVT 1665          

HSP 2 Score: 137.887 bits (346), Expect = 2.031e-31
Identity = 152/644 (23.60%), Postives = 287/644 (44.57%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  ++NG+N L V +D  ++ E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      +++YD+  R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  +     ++ F Y    +L  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I       Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I + YD    N   V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L  +S A   P+ Y + D  T L    G V Y  ++DGFL Q+      E F Y++ GLL       S   ++    Y YD   R +  +  +   Q  Q+FY D     R+TH+Y+H+S +++S YY+   GHLF++ +     +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD
Sbjct: 1781 RKLRVNGRNLLSVDFDRTTKTE--KIYDDHR-KFLLRIAYDTSGHPTLWLP---SSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDSQGRIVSRVFA-DGKTWSYTY-----LEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNE-EGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDIS--GKVEQFGKFGVIYYDINQIISTAVMTYTKHF-----DAHGRIKEIQYEIFRSLMYWITIQYD----NMGRVTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSSSARLTPLRYDLRDRITRL----GDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKGSGWTVI----YRYDGLGRRVSSKTSL--GQHLQFFYADLTYPTRITHVYNHSSSEITSLYYD-LQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNVDFQLVIGFHGGLYDPLTKLIHFGERDYD 2374          
BLAST of Teneurin-2 vs. UniProt/SwissProt
Match: sp|O61307|TENM_DROME (Teneurin-m OS=Drosophila melanogaster OX=7227 GN=Ten-m PE=1 SV=2)

HSP 1 Score: 605.52 bits (1560), Expect = 5.607e-174
Identity = 392/1292 (30.34%), Postives = 641/1292 (49.61%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNG--ELNTKDVCMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFL----TRRKYTT-KSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNP--NVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQ-KLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRT-----VWIVKSDGYL-------------------YKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYK-QAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSG 5425
            W+ +++Q+    + F++TI    S+G++ R N++PT  +Y   E +SG +              R+    + S +     Y+E G WF+S+ ND    + + F       M Q CP+ C+ +G C   G C C  GF G DCS+   P +CS HG Y  G C CNP WKGKEC     ECE  DCSG+G CVSG+C C  GY GK C  + CP  NCS +G C  +G C C +GW+  DC+    D      + C  +G  +L+T+  C C   +SG+ C K LC   C  +G C  +  C C+  + G+ C  R+CD RC +HG+C  G C+C  GWNGKHCT++GCP +C  +GQC+++   ++ C C   W G  C I+ E  C D  DND DGL DC+DP+CC +  C     K      S PK  D+ L      ++   ++F E+++FL    + + Y   ++ N+ + +V+RG+V+ S G    G R+      + G T T  DG FDL+V GG  V L+  R P    +    V VP NE V I D  +  +   K  +  T   CF      HD  ++  P +LA W          D  ++  ++ V+  S+ +  TGL L++ SSR  G+ S++ + L    +P +L  I+L+I + G    +  E DP + +T+ W+RLN Y + ++G+ +  V+VGY Y +C+ I W+ + T ++GHD+   ++G WNL+  H ++++ GI+ +GDGS+++L      I    G  G  R    C  CDG+  ++   +  A+ +   G + + D  YIR +   G+     K+ +  +        + L G +++++  E++    V +     +P++   E++ GS     P  E H       C +    +  KL +PKG+ I+    L+FADG  I+M+    + + T+IG+    +    +P C   L   E  L+WPT +  + +D++++ +D+ +M+ R+  D   V  ++G    C +  +  +T LA        + I   PLGEL++AE  +     V ++ +DG +                   ++ E    T   F +I ++ +T    + +AD    +I SV         +  Y++ +PD +E+Y FN  GQH  T + +TG   Y   Y +N+ NG LS +   +GN  F + RD  S+   +E   G    + +   K +  L+ P + +  ++Y+    L+  +  S    Y +  Y + GRL S + P+G
Sbjct:  411 WNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFS-----------ASTRTARAAHLSITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCL-LGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCA-DGTCICKKGWKGPDCATMDQDALQCLPD-CSGHGTFDLDTQ-TCTCEAKWSGDDCSKELCDLDCGQHGRCEGDA-CACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVC-----KTSQLCVSAPKPIDVLLRKQPPAIT---ASFFERMKFLIDESSLQNYAKLETFNESRSAVIRGRVVTSLGMGLVGVRVSTTTL-LEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRI--VQVPWNEVVII-DLVVMSMSEEKGLAVTTTHTCF-----AHDYDLM-KPVVLASWKHGFQGAC-PDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGD-GHQRPLE-CPDCDGQATKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDG-TLYVSDPESHQIIRVRDTNDYSQPELNW-EAVVGSGERCLPGDEAH-------CGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGI-VSTLIGNHMHKSHWKPIP-CEGTLKLEEMHLRWPTELAVSPMDNTLHIIDD-HMILRMTPDG-RVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLL-RDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYN-YDEFGRLTSAVTPTG 1650          

HSP 2 Score: 121.709 bits (304), Expect = 1.023e-25
Identity = 141/687 (20.52%), Postives = 286/687 (41.63%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAF-INKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILY------KPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQIL-----------TRSIDMDNSKITI-EVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFH 7993
            R  ++NG N L + YD  ++  +  V + +++ NV    Y+  ++ +   P  Q  + A++ +EY R G L   KW   +L+  Y + +R   +      D    +Y   ++   +   +       Y L Y+     +S+ TP     +     S+G+ +  Y       P+ +  N         G +   I+P +  ++ F + T  +L+ ++ G     +   D+  LV+ +       GF L ++F Y+    A I  +  L   S++ ++  ++  Y+YD   +++ I + + DK    +  +               + + + ++ +V  +K+  N  F RT + ++ +              +S+ M+   I +  +  D D +N +        RS++ + +N     Y     ++     ++ +Y + E+G  + + V+ G      YD    ++K   +    Y+  GF++++  G+Q  K+ YN  G L+  + R    S       Y+YD R R++   D  +     QY+Y +P     +TH++     +    +Y+     L ++  + + YYV +D  GSP      N  IV E     FG           VPI F G + D  + +++ + R YDP+   +    W  L T++     +P  +  Y++H
Sbjct: 1783 RKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNV---TYDRTSRPISFRP--QSGDYADVDLEYDRFGRLVSWKW--GVLQEAY-SFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYN-------DEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTTSLVKSVEVQEP--GFELRREFKYH----AGILKDEKLRFGSKNSLA-SARYKYAYDGNARLSGIEMAIDDKELPTTRYK---------------YSQNLGQLEVVQDLKITRN-AFNRTVIQDSAKQFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRSTAFDKIN-----YNADGHVVEVLGTNNWKYLFDENGNTVGV-VDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKR--GEQ--KYRYNNRGQLIHSFERERFQSW------YYYDDRSRLVAWHD--NKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDD-RDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMS----HPTDVFIYRYH 2408          
BLAST of Teneurin-2 vs. UniProt/SwissProt
Match: sp|Q9P273|TEN3_HUMAN (Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3)

HSP 1 Score: 544.658 bits (1402), Expect = 7.887e-155
Identity = 391/1316 (29.71%), Postives = 612/1316 (46.50%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFE-----RISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKV-------------------EGDAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  + F +    + FN ++     +G++ R    P+  +Y   E     R+  R  R +L      R  RS++        GF+ YL+ G+W L+  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G G C+ G C C  GY G++C    C    CS +GVC  +G C C  GW   +C   K+   D+ S    +   +G       C C   ++G  C   +CS  C +    + GTC C EG++G  C +R C  RC +HG C +G C C +GWNG+HCT++GCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+    L +   +   +F+++I FL     T         N+   SV+RG+V+ +DG+P  G  +        G+T T +DG+FDLV  GG+ + L   R P    T Y+ V++P N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  ++ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    ++ I G  G+ R +  C  C+G+       +  A+     G + + D  Y+R +  +GN     ++ S     +             +LA    +P V  DL   +    +IY  +SL+G+      +L K+  +V   GE C    E  C      +   L+ PKGM +     ++F DG  I+ +   N  I T++G     +  +R   C + +  S+ RL+WPT +  N +D+SIY +DN N+V ++  +N  V   AG    C  P +E       A++        I ++  G L+I E     I     V +DG +  V                    GD   K A   + +S+  +  G L +AD G  +I +V   + +  +   Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S +  ++ +   +GN   ++ RD      ++ +P      +T+     + ++ A       F Y+    L++  +S E     F  Y   GRL +V  P+GV T
Sbjct:  404 WRSQLFIDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRSLLETERAGRQARSVSLH----EAGFIQYLDSGIWHLAFYNDGKNAEQVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGESCEEADCIDPGCSNHGVCI-HGECHCSPGWGGSNCEILKTMCPDQCSGHGTYLQESGS------CTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSC----QNQPYC-RGLPDPQDIISQSLQSPSQQAAKSFYDRISFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGYTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIPWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPNPIIVSSPLSTFFRSSPEDS-PIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQSIIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVSSIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVLELSSNPAHRY-------------YLA---TDP-VTGDLYVSDTNTRRIYRPKSLTGA-----KDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAVDKNGLIYFVDGTMIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDN-NVVLQI-TENRQVRIAAGRPMHCQVPGVEYPVGK-HAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLSAPSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSY---SNDNDITAVTDSNGN-TLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLAT-KSDETGWTTFFDYDSEGRLTNVTFPTGVVT 1649          

HSP 2 Score: 136.346 bits (342), Expect = 3.819e-30
Identity = 151/644 (23.45%), Postives = 286/644 (44.41%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  ++NG+N L V +D  ++ E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      +++YD   R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  +     ++ F Y    +L  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I       Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I + YD    N   V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L  ++ A   P+ Y + D  T L    G V Y  ++DGFL Q+      E F Y++ GLL       S   ++    Y YD   R +  +  +   Q  Q+FY D     R+TH+Y+H+S +++S YY+   GHLF++ +     +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD
Sbjct: 1765 RKLRVNGRNLLSVDFDRTTKTE--KIYDDHR-KFLLRIAYDTSGHPTLWLP---SSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFA-DGKTWSYTY-----LEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNE-EGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDIS--GKVEQFGKFGVIYYDINQIISTAVMTYTKHF-----DAHGRIKEIQYEIFRSLMYWITIQYD----NMGRVTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTPLRYDLRDRITRL----GDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKGSGWTVI----YRYDGLGRRVSSKTSL--GQHLQFFYADLTYPTRITHVYNHSSSEITSLYYD-LQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNIDFQLVIGFHGGLYDPLTKLIHFGERDYD 2358          
BLAST of Teneurin-2 vs. UniProt/SwissProt
Match: sp|Q9WTS5|TEN2_MOUSE (Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 8.597e-154
Identity = 381/1303 (29.24%), Postives = 598/1303 (45.89%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            + FN ++      G+++R    P+  +Y   ER+ G+    V+      R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  ++G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C  +          C    D   ++   +   P   +F+++I+ L  +  T         N   +S++RG+V+  DG+P  G  +        G+T T +DG FDL+  GGS + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       +  S+ I+P           +  VL   ++L  T +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  H  +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR +  + N     ++ +         + +N  G   +LA       V   L   +    +IY  +SLSG+      +L  +  +V   GE C    E  C      +   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  479 LKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV---ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GLCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCAAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDSG------LCSCDPNWMGPDCSV-VCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNS--------LLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSSLVSLIRGQVVTMDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGSALTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSASPASNPIVP-----------ETQVLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHTLNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELRNKEF------KHSNSPGHKYYLAVDP----VTGSLYVSDTNSRRIYRVKSLSGA-----KDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---SADNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKAVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1711          

HSP 2 Score: 141.354 bits (355), Expect = 1.261e-31
Identity = 166/690 (24.06%), Postives = 292/690 (42.32%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   D    V K++   +  GF    ++   GPLV +  Y        + +I  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  +NV   P   N Y F
Sbjct: 1827 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGY-DETTGVLKMVNLQS-GGFSCTIRYRKVGPLVDKQIYRFS----EEGMI--NARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVYSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWRNVGKEPAPFNLYMF 2450          
BLAST of Teneurin-2 vs. UniProt/SwissProt
Match: sp|Q9WTS6|TEN3_MOUSE (Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 1.483e-153
Identity = 393/1325 (29.66%), Postives = 614/1325 (46.34%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFE-----RISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQI-FWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKV-------------------EGDAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  + F +    + FN ++     +G++ R    P+  +Y   E     R+  R  R ++      R  RS++        GF+ YL+ G+W L+  ND    E + F      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C  P C G G C+ G C C  GY G+NC    C    CS +GVC  +G C C  GW   +C   K   +D+ S    +   +G       C C   ++G  C   +CS  C +    + G+C C EG++G  C +R C  RC +HG C +G C C +GWNG+HCT+         +GCP  CN+NG+C L+    ++C C P W+G  C+++ E+ C D  DN+ DGL DC DPDCC    C    Q Q Y     P   D+    L T   +   +F+++I FL     T         N+   SV+RG+V+ +DG+P  G  +        G+T T +DG+FDLV  GG+ + L   R P    T Y+ V++P N F       + D L+ K       P C   D S     V   P I++   S        DS  +  +  VL     +  T LKL + SSR  G+KS L + +    +P NL +++L + V G+   +     P L YTF WD+ +AY + ++GL+   V VGY YE+C  +  WE +  V+ G++L A ++G W L+  H+ D  +GI+Y+G+G + F++Q    ++ I G  G+ R +  C  C+G+       +  A+     G + + D  Y+R +  +GN     ++ +         R ++      +LA    +P V  DL   +    +IY  +SL+G+      +L K+  +V   GE C    E  C      +   L+ PKGM I     ++F DG  I+ +   N  I T++G     +  +R   C + +  S+ RL+WPT +  N +D+SIY +DN N+V ++  +N  V   AG    C  P +E       A++        I ++  G L+I E     I     V +DG +  V                    GD   K A   + +S+  +  G L +AD G  +I +V   + +  +   Y+V SP  +ELY F+  G H+ T S +TG  LY+  Y   S +  ++ +   +GN   ++ RD      ++ +P      +T+     + ++ A       F Y+    L++  +S E     F  Y   GRL +V  P+GV T
Sbjct:  404 WRSQLFIDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLVESERAGRQARSVSLH----EAGFIQYLDSGIWHLAFYNDGKNPEQVSFNTIVIESVVE-CPRNCHGNGECVS-GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCI-HGECHCNPGWGGSNCEILKTMCADQCSGHGTYLQESGS------CTCDPNWTGPDCSNEICSVDCGSHGVCMGGSCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIAHYLDKIVKEGCPGLCNSNGRCTLDQN-GWHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSC----QNQPYC-RGLPDPQDIISQSLQTPSQQAAKSFYDRISFLIGSDSTHVLPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYSEYGYTITRQDGMFDLVANGGASLTLVFERSP--FLTQYHTVWIPWNVFY------VMDTLVMKKEENDI-PSC---DLS---GFVRPSPIIVSSPLSTFFRSSPEDS-PIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQAVIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVSSIMGN-GR-RRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDF------RHSSNPAHRYYLA---TDP-VTGDLYVSDTNTRRIYRPKSLTGA-----KDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGLIYFVDGTMIRKVD-QNGIISTLLGSNDLTS--ARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDN-NVVLQI-TENRQVRIAAGRPMHCQVPGVEYPVGK-HAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLNAPSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSY---SNDNDVTAVTDSNGN-TLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLAT-KSDETGWTTFFDYDSEGRLTNVTFPTGVVT 1665          

HSP 2 Score: 138.272 bits (347), Expect = 8.655e-31
Identity = 152/644 (23.60%), Postives = 287/644 (44.57%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVF--GFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYED--GRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  ++NG+N L V +D  ++ E   +Y++ + K +++  Y+        +P    + L  + V Y+ +G +  I+      +++YD+  R  S   A     + Y Y       K   +   + ++Y   Y+  D+  +I  P+    +++ + SIGY R +Y P   +++ I D++   G L +  +     ++ F Y    +L  ++Y + R+ F   ++      ++KT N+   GF    ++   GPL+    +       S+D +  +++  YSYD+  ++  +  ++ + P      + + I       Q  ++    ++IN I++   +   K F     + +G+I     ++  S +  I + YD    N   V   +I          + + Y  D  L    Y  + I ++Y  D  G L  L  +S A   P+ Y + D  T L    G V Y  ++DGFL Q+      E F Y++ GLL       S   ++    Y YD   R +  +  +   Q  Q+FY D     R+TH+Y+H+S +++S YY+   GHLF++ +     +Y+ SD  G+P  + SSN  ++ +  Y  +GE     +    + IGF G ++D  + +I    R YD
Sbjct: 1781 RKLRVNGRNLLSVDFDRTTKTE--KIYDDHR-KFLLRIAYDTSGHPTLWLP---SSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDSQGRIVSRVFA-DGKTWSYTY-----LEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNE-EGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDET----AGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-----SEDGM-VNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDIS--GKVEQFGKFGVIYYDINQIISTAVMTYTKHF-----DAHGRIKEIQYEIFRSLMYWITIQYD----NMGRVTKREIKIGPFANTTKYAYEYDVDGQL-QTVYLNEKIMWRYNYDLNGNLHLLNPSSSARLTPLRYDLRDRITRL----GDVQYRLDEDGFLRQRGT----EIFEYSSKGLLTRVYSKGSGWTVI----YRYDGLGRRVSSKTSL--GQHLQFFYADLTYPTRITHVYNHSSSEITSLYYD-LQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQTQYTAYGEIYFDSNVDFQLVIGFHGGLYDPLTKLIHFGERDYD 2374          
BLAST of Teneurin-2 vs. UniProt/SwissProt
Match: sp|Q9NT68|TEN2_HUMAN (Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 SV=3)

HSP 1 Score: 540.421 bits (1391), Expect = 1.971e-153
Identity = 382/1316 (29.03%), Postives = 599/1316 (45.52%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRK---SDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPR----ILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVI-----NPELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKVEGDAQ--------------------TKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNY-LYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            + FN ++      G+++R    P+  +Y   ER+ G+    V+      R +RS+     +E+  FV YL+ GLW L+  ND   +E + F     +   Q CP  C+ +G C   G C CF GF G DC+K   P +CSG+G Y +GTC C   WKG EC     +C  P C G+G C+ G CVC  GY G++C  + C    CS +GVC  NG C C  GW   +C   +    D+ S    +  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C  RC +HG C +G C CR+GWNG+HCT+         DGCP  CN NG+C L     + C C   W+G  CN++ E+ C D  DN+ DGL DC DPDCC    C    Q       S   +D +          +   +F+++I+ L  +  T         N   +S++RG+V+ +DG+P  G  +        G+T T +DG FDL+  GG+ + L   R P    +    V++P N F  +      D L+ K       P C        D  +I  P       A   + I+P           +  VL   ++L  + +KL + SSR  G+KS L + +    VP NL  ++L + V G    +  +  P L YTF WD+ +AY + ++GL+   V VG+ YE C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G + FLTQ    I  I G  G+ R +  C  C+G  +     +  A+     G + + D  YIR                    +F ++   ++  L     KH NNP  +   LA +P    +Y+S++ S  I+ +       +L  +  +V   GE C    E  C      I   L+ P+G+ +     ++F D   I+ +   N  I T++G     A   R   C S +  ++ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I I+  G L+I E     I     V ++G +  + G A                     T     S +S+ +   G + +AD G  +I +V   + +   +  Y+  SP  +ELY FN+ G H+ T S +TG  LY+  Y   S +  +++++  +GN   K+ RD+      L  P      +T+     +  ++  +        D +  +   +S E     F  Y   GRL +V RP+GV T
Sbjct:  479 LKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVV---ESPRERRSIQTLVQNEAV-FVQYLDVGLWHLAFYNDGKDKEMVSFN-TVVLDSVQDCPRNCHGNGECVS-GVCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCSAGYKGEHCEEVDCLDPTCSSHGVCV-NGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDTG------LCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIGRQTAGTETDGCPDLCNGNGRCTLGQN-SWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSAC----QNSLLCRGSRDPLDIIQQGQTDWPAVK---SFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGASLTLHFERAP--FMSQERTVWLPWNSFYAM------DTLVMKTEENSI-PSCDLSGFVRPDPIIISSPLSTFFSAAPGQNPIVP-----------ETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGN-GR-RRSISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIR-------------------RIFPSRNVTSILELRNKEFKHSNNP-AHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGTKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGSNDLTA--VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTY---STDNDVTELIDNNGN-SLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVT 1721          

HSP 2 Score: 141.739 bits (356), Expect = 9.178e-32
Identity = 165/690 (23.91%), Postives = 295/690 (42.75%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  +++G+N L + YD N R E   +Y++ + K  ++ IY+   Q+ +   +   + LA + V Y  +G L  ++        + D   R  S   A    ++ Y Y       K   +   + ++Y   Y+S D+  ++  P+    S+    SIGY R +Y P   +++ I+D+ S +G + +  +     Q+ + Y   ++L  ++Y +  + F   ++  ++ K++   +  GF    ++   GPLV +  Y       S++ +  +++  Y+Y D+  +I  I  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L L  Y+      Y Y  DG+L S+ VN      Y YD N  L                     +   G V Y  +DDG+L Q+ +    + F YN+ GLL       S       V+Y YD   R   ++  +      QYFY+D  N  R+TH+Y+H++ +++S YY+   GHLF++     + YYV SD  G+P  + S N  ++ +  Y  +GE     +    + IGF G ++D  + ++    R YD      AG      +T  KNV   P   N Y F
Sbjct: 1837 RKLRVHGRNLLSIDYDRNIRTE--KIYDDHR-KFTLRIIYD---QVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA-DGKVWSYSY-----LDKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY-SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVL-KMVNLQS-GGFSCTIRYRKIGPLVDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEMFRS----LMYWMTVQYDSMGRVIKR-------ELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS----DIFEYNSKGLLTRAYNKASGWS----VQYRYDGVGRRASYKTNL--GHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYD-LQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDV----LAGRWTSPDYTMWKNVGKEPAPFNLYMF 2460          
BLAST of Teneurin-2 vs. TrEMBL
Match: A0A1S3JR48 (teneurin-m-like isoform X8 OS=Lingula unguis OX=7574 GN=LOC106175388 PE=4 SV=1)

HSP 1 Score: 801.586 bits (2069), Expect = 0.000e+0
Identity = 666/2489 (26.76%), Postives = 1146/2489 (46.04%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCS--KRKSDKQSARSNFCLNNGELNTK-DVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTK-----SLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLS----PY-LLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESC---------KERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCP---------SLESNSETVLAIRHKFSDI--RDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG---------------DAQTKPAFKSI----TSITITMFGELIVADNGKKQIFSVHYKQAIKKNYL-YQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQY-NDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN---FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNI-RVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFH-YIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFG----FRLVQKFAY-YGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKI-TIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLI-LNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKL-NPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTT--------KPLEIYREITG---LPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPV---LNLS---TISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYR 8893
            + FNFT+     +G++ R+NS PT V+Y  F  + GR   Q           +  +E   ++ T F+ YLE GLW++ V ND      +    +    +  TCP  C   G CT  G+C CF G++G DCS+   P +C+G G Y +G C C   WKGKEC      CE P+CSGNG+C+ GEC+C  G+ GK+C  + C PSNCS NGVC + G C C +     DCS  + ++     R N C  +G  +   D C+C  G++GE CE   CS +C +G+CS    C+C+EG++G  C +  CD RC  HG C  G C+C  GWNGK+C+LDGCP++C+N+G+C++  +  + C+C   WKG  C++S+E +C D +DND DGL DCQDPDCC T  C  +          C    D   +LL  +     ++F +++ FL   +   K     S N+ ++SV+RG+V   DG+P  G R+    + + G T T + G+FD++V GG  V L+  R P    T    V VP N+ V +   E  +L++   N  +T   C     +V  ++    P +L+ W    +     +S ++  ++ VL  S+ +  T L L++ SS+  G+ SS+L+ L  + +P+ L  ++L++ V G  + +  E D  L Y F WDR NAY + ++G+ +  V+VGY Y+ CS IFWET+   ++G+DL + ++G WNL+  H +++  GI+++GDG++++L +    +  I G  G+ R    C  CDG+  +    +  A+ S   G + + D  Y+R L+       +   LS    PY   M ++  +  L         + ++P+          K  L     G +  ++  LE      GE C           +   + +L HPKG+ I     ++F DG  I+ I+ T   I TV+G      + + LP C      ++ +L WPT++  N +DD+++ +DN NMV R+  +  +V T AG+   CP          L S+    L++  + + I  ++I   P GEL+I E        V +V + G +  + G               D +   A  ++    T++T+T    L VAD G  ++ S+         Y  Y+V+SP T E+Y+FN  GQHR T + +T T +YS  Y +NS  G L+ +  P+ N Q ++ RD  + A ++ +P G    V ++   ++    +P + S  F Y +   LL S +  SE     F  Y D+GR+  VI+P+G  T  VE  V     + K             N N+LA                  Y +  L  N          I  +N   L   + P ++++      +E ATH       +T + +Q  RKI+     D    + EW + +     D    ++  + R+    +V      R+G ++ N      +    ++  +NG++ L + YD  +  E      +   K ++  IYN   Q      F    NL  + V     G  + +KW K  L   +D   R        +N     ++Y G +  ++IA     + K+Y   Y+       + TPN+   S  +L+S+G+ R LY+  G    ++ D+ S +G L R+ YPS + ++ ++Y+    L+ VI G   I  + ++ + L          FG    ++  ++FA  YG    +  Y                +  Y YD+  +I+ +   +       + L    +   N+  +++    F+F     NK+ + N    I    +E  ++       +N ++  + ++YD   +  L   S +I R        F +SY  D +++ +      S +Y Y  +G L +  V+    ++ +   N+  L + G  TY ++ DGFLIQ+      + F YN+ G L    RM +     +++ Y+YD+  R+I  +D        Q++Y + +N + +TH+Y+H+S + +  +Y+  S  L ++    ++YY+ +D +GSP  I  S   IV +  Y+ FG  +           GF G ++D E+ ++FM +R+YDP +  +    +  +F +++   L NP  + SY            E+ D         W+  +G + ++++ +        K  + +R       LP   + +  FE              +  +F T+S +  +D+     +P       +++         + +S+RE    + V  L +   P S + + L  N+ ++ +  ++    + Y VK    M   DLQ  G+  + + +   +N S   T    N +    L   Y ++ I Y +++ +Q S++ E  KS+     W  +R  L  N       S + K+++ + G    +  +   ++ +FP + DDP+  R
Sbjct:  151 VKFNFTLPDDAVIGVYGRLNSKPTYVQYDFFHMLDGRKISQQRRRRRDESSTKDSSEDQVTD-TAFIEYLEPGLWYMMVYNDVEIPNTVSVVSSKHDKVDSTCPKDCLGRGECTN-GQCTCFPGYEGWDCSQTVCPVLCNGRGIYVRGECECYSNWKGKECSVAVDRCEVPNCSGNGECIRGECICSPGFKGKDCREVDCIPSNCSGNGVCVQ-GQCYCNEDHTGSDCSLPRVQNIPNMCRKN-CTQHGVYDMHLDACVCEEGWAGEYCEIERCSLQCVHGHCS-GQRCVCDEGWAGAVCNQVSCDPRCLVHGFCDNGTCMCNPGWNGKYCSLDGCPRSCSNHGRCQV-FSGSWQCNCADGWKGEDCSLSREVQCGDNLDNDEDGLLDCQDPDCCLTVECKDSPH--------CVMSPDPLEILLRKQPPSSTASFFDKMRFLVEEQSVQKFAHTGSFNESQVSVIRGRVYAKDGTPLIGVRVSVVTQPLYGFTLTRELGLFDILVNGGGSVTLQFQRQPFK--TKMATVMVPWNQLVTM---ESINLVLEGDNEVETPHPC-----AVEYNTNTIKPLVLSTWQHTQLGSCPAES-AIIPESQVLQESIAIPGTNLHLVYHSSKTSGYMSSILIQLTPELIPQTLALVHLRVTVEGIVLEKLFEADRGLKYRFAWDRTNAYKQKVYGIVTASVKVGYQYQGCSHIFWETRTATMSGYDLTSSEVGGWNLDIHHTYNFQEGILHKGDGTNIYLKEKPKNLKTILGN-GRQRSVT-CTNCDGDAADSKLLAPVALASGRDGSLYVGDYNYVRKLSPDRQRIDRILELSSQTVPYKYFMTVSPLDGKL---------YISDPH---------SKKVLRVKTMGPVRDLDSNLEI-IAGTGEQCVPGDRDRCGDGKLASQARLTHPKGIAINKDGIVYFVDGVNIRSINKTG-HISTVLGSQLQPGDWNPLP-CQEPADIAQVKLHWPTALSINPLDDTLHILDN-NMVLRMTPERKIVVT-AGHPPHCPPEDIQKTGLGLLSDERLRLSVATRATLISPQNIAFGPWGELYIVESDKQYVNRVRVVSTSGLISHIVGGTPRCNCQDPECKCFDTKETLAASALLNTPTALTVTPDNVLHVADMGNLRVHSIVSSLPTANRYRHYEVMSPGTHEVYTFNRYGQHRSTKNLMTDTVVYSFTYSVNSYYGKLTTVTGPNNN-QLRIVRDYTTWAKEIVSPGGQRSKVKMNPLGQLETFTVPGNYSVSFTYLSSSGLLFSKRTDSEHT--YFYEYDDNGRVSHVIQPTGEVTN-VETDVTSTGAVVKVATDAADVVTMATNGNQLA------------------YLHGNLRAN----------ISYSNDGSLVVEY-PNNLAVT-----METATHPLL----DTEHRMQVKRKIL---GPDNLLHKLEWRFYL---RRDGKSRRSKKVERIGRRLRVGESHRTRHGNRHANQHEMIGV----KLLLVNGEHVLTIEYDREANTETIM---DVNWKELLTIIYNSAGQAEA---FVSSLNLKPVNVTLDPQG--RMVKWQKGDLTQRWDYDARGQLNKRVKSNGATQMWMYRGGDKPTEIAL---PSGKRYHFKYDLHGNLAKLTTPNSGTHSFDRLVSVGFHRYLYRLPGTQMPYLEDYTS-DGRLLRIQYPSNLRRVYYYYNEKALLEKVISGETTIRHLYNEKSKLRTGYDLQSGNFGCLLDYKPSEQFATSYGITFKDRRY-------------IQGRFEYDYDNNFRISTLKATI-----GSNELVPLKLSYNNTTGKLLTMRSFVFSYPQYNKVVIRNIHVEITKAFDEYSRLNEVQYKFNNEQVYHMAITYDSVGR--LQRWSREIGRGDEKA---FDYSYDIDDNIVDVLLQGQSSWKYTYDTNGNLAT--VSQFGRLKEVLVDNSDRLVSYGDHTYMFDGDGFLIQRNR----DVFVYNSQGQLT---RMTNGDG--RQIWYYYDAHSRLIARKD--SDGAFVQFYYGNVLNKNLVTHIYNHSSYETTVLFYDG-SNRLMAMEKGDRYYYIATDPMGSPVAIFDSVGMIVKQISYEPFGNVEIDSPPHFEFMFGFHGKLYDGEAGLVFMGDRLYDPMTGRYLTPSYRDIFHRVETELLHNPQSIQSYVLQNPTAVLQHYEELDMKDILS---WMNVLGYDMKSLIPSITFDGQIHKGTDWHRYTASRRLLPVTSVFQCAFE-------------RDSANFLTMSTVTPSDM-----MPPERAELQKVAPASGVFGDGLLLSVREG---KAVVTLSEQLQPSSNVMSLLLNNSLVVPLALTQEGKDVHYFVKQETAMAAADLQAAGIGAEFKTLSNGVNFSVEWTQEKTNRMAITKLENDYVMVYILYGTTVEKQYSVLLEQAKSKAITQAWAKERHLLLSNQSGSRNWSPEEKEQIEQRGKASGYSRNYIRDVNDFPEMADDPNNIR 2464          
BLAST of Teneurin-2 vs. TrEMBL
Match: A0A1S3JS29 (teneurin-m-like isoform X9 OS=Lingula unguis OX=7574 GN=LOC106175388 PE=4 SV=1)

HSP 1 Score: 801.586 bits (2069), Expect = 0.000e+0
Identity = 666/2489 (26.76%), Postives = 1146/2489 (46.04%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCS--KRKSDKQSARSNFCLNNGELNTK-DVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTK-----SLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLS----PY-LLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESC---------KERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCP---------SLESNSETVLAIRHKFSDI--RDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG---------------DAQTKPAFKSI----TSITITMFGELIVADNGKKQIFSVHYKQAIKKNYL-YQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQY-NDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN---FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNI-RVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFH-YIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFG----FRLVQKFAY-YGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKI-TIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLI-LNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKL-NPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTT--------KPLEIYREITG---LPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPV---LNLS---TISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYR 8893
            + FNFT+     +G++ R+NS PT V+Y  F  + GR   Q           +  +E   ++ T F+ YLE GLW++ V ND      +    +    +  TCP  C   G CT  G+C CF G++G DCS+   P +C+G G Y +G C C   WKGKEC      CE P+CSGNG+C+ GEC+C  G+ GK+C  + C PSNCS NGVC + G C C +     DCS  + ++     R N C  +G  +   D C+C  G++GE CE   CS +C +G+CS    C+C+EG++G  C +  CD RC  HG C  G C+C  GWNGK+C+LDGCP++C+N+G+C++  +  + C+C   WKG  C++S+E +C D +DND DGL DCQDPDCC T  C  +          C    D   +LL  +     ++F +++ FL   +   K     S N+ ++SV+RG+V   DG+P  G R+    + + G T T + G+FD++V GG  V L+  R P    T    V VP N+ V +   E  +L++   N  +T   C     +V  ++    P +L+ W    +     +S ++  ++ VL  S+ +  T L L++ SS+  G+ SS+L+ L  + +P+ L  ++L++ V G  + +  E D  L Y F WDR NAY + ++G+ +  V+VGY Y+ CS IFWET+   ++G+DL + ++G WNL+  H +++  GI+++GDG++++L +    +  I G  G+ R    C  CDG+  +    +  A+ S   G + + D  Y+R L+       +   LS    PY   M ++  +  L         + ++P+          K  L     G +  ++  LE      GE C           +   + +L HPKG+ I     ++F DG  I+ I+ T   I TV+G      + + LP C      ++ +L WPT++  N +DD+++ +DN NMV R+  +  +V T AG+   CP          L S+    L++  + + I  ++I   P GEL+I E        V +V + G +  + G               D +   A  ++    T++T+T    L VAD G  ++ S+         Y  Y+V+SP T E+Y+FN  GQHR T + +T T +YS  Y +NS  G L+ +  P+ N Q ++ RD  + A ++ +P G    V ++   ++    +P + S  F Y +   LL S +  SE     F  Y D+GR+  VI+P+G  T  VE  V     + K             N N+LA                  Y +  L  N          I  +N   L   + P ++++      +E ATH       +T + +Q  RKI+     D    + EW + +     D    ++  + R+    +V      R+G ++ N      +    ++  +NG++ L + YD  +  E      +   K ++  IYN   Q      F    NL  + V     G  + +KW K  L   +D   R        +N     ++Y G +  ++IA     + K+Y   Y+       + TPN+   S  +L+S+G+ R LY+  G    ++ D+ S +G L R+ YPS + ++ ++Y+    L+ VI G   I  + ++ + L          FG    ++  ++FA  YG    +  Y                +  Y YD+  +I+ +   +       + L    +   N+  +++    F+F     NK+ + N    I    +E  ++       +N ++  + ++YD   +  L   S +I R        F +SY  D +++ +      S +Y Y  +G L +  V+    ++ +   N+  L + G  TY ++ DGFLIQ+      + F YN+ G L    RM +     +++ Y+YD+  R+I  +D        Q++Y + +N + +TH+Y+H+S + +  +Y+  S  L ++    ++YY+ +D +GSP  I  S   IV +  Y+ FG  +           GF G ++D E+ ++FM +R+YDP +  +    +  +F +++   L NP  + SY            E+ D         W+  +G + ++++ +        K  + +R       LP   + +  FE              +  +F T+S +  +D+     +P       +++         + +S+RE    + V  L +   P S + + L  N+ ++ +  ++    + Y VK    M   DLQ  G+  + + +   +N S   T    N +    L   Y ++ I Y +++ +Q S++ E  KS+     W  +R  L  N       S + K+++ + G    +  +   ++ +FP + DDP+  R
Sbjct:  113 VKFNFTLPDDAVIGVYGRLNSKPTYVQYDFFHMLDGRKISQQRRRRRDESSTKDSSEDQVTD-TAFIEYLEPGLWYMMVYNDVEIPNTVSVVSSKHDKVDSTCPKDCLGRGECTN-GQCTCFPGYEGWDCSQTVCPVLCNGRGIYVRGECECYSNWKGKECSVAVDRCEVPNCSGNGECIRGECICSPGFKGKDCREVDCIPSNCSGNGVCVQ-GQCYCNEDHTGSDCSLPRVQNIPNMCRKN-CTQHGVYDMHLDACVCEEGWAGEYCEIERCSLQCVHGHCS-GQRCVCDEGWAGAVCNQVSCDPRCLVHGFCDNGTCMCNPGWNGKYCSLDGCPRSCSNHGRCQV-FSGSWQCNCADGWKGEDCSLSREVQCGDNLDNDEDGLLDCQDPDCCLTVECKDSPH--------CVMSPDPLEILLRKQPPSSTASFFDKMRFLVEEQSVQKFAHTGSFNESQVSVIRGRVYAKDGTPLIGVRVSVVTQPLYGFTLTRELGLFDILVNGGGSVTLQFQRQPFK--TKMATVMVPWNQLVTM---ESINLVLEGDNEVETPHPC-----AVEYNTNTIKPLVLSTWQHTQLGSCPAES-AIIPESQVLQESIAIPGTNLHLVYHSSKTSGYMSSILIQLTPELIPQTLALVHLRVTVEGIVLEKLFEADRGLKYRFAWDRTNAYKQKVYGIVTASVKVGYQYQGCSHIFWETRTATMSGYDLTSSEVGGWNLDIHHTYNFQEGILHKGDGTNIYLKEKPKNLKTILGN-GRQRSVT-CTNCDGDAADSKLLAPVALASGRDGSLYVGDYNYVRKLSPDRQRIDRILELSSQTVPYKYFMTVSPLDGKL---------YISDPH---------SKKVLRVKTMGPVRDLDSNLEI-IAGTGEQCVPGDRDRCGDGKLASQARLTHPKGIAINKDGIVYFVDGVNIRSINKTG-HISTVLGSQLQPGDWNPLP-CQEPADIAQVKLHWPTALSINPLDDTLHILDN-NMVLRMTPERKIVVT-AGHPPHCPPEDIQKTGLGLLSDERLRLSVATRATLISPQNIAFGPWGELYIVESDKQYVNRVRVVSTSGLISHIVGGTPRCNCQDPECKCFDTKETLAASALLNTPTALTVTPDNVLHVADMGNLRVHSIVSSLPTANRYRHYEVMSPGTHEVYTFNRYGQHRSTKNLMTDTVVYSFTYSVNSYYGKLTTVTGPNNN-QLRIVRDYTTWAKEIVSPGGQRSKVKMNPLGQLETFTVPGNYSVSFTYLSSSGLLFSKRTDSEHT--YFYEYDDNGRVSHVIQPTGEVTN-VETDVTSTGAVVKVATDAADVVTMATNGNQLA------------------YLHGNLRAN----------ISYSNDGSLVVEY-PNNLAVT-----METATHPLL----DTEHRMQVKRKIL---GPDNLLHKLEWRFYL---RRDGKSRRSKKVERIGRRLRVGESHRTRHGNRHANQHEMIGV----KLLLVNGEHVLTIEYDREANTETIM---DVNWKELLTIIYNSAGQAEA---FVSSLNLKPVNVTLDPQG--RMVKWQKGDLTQRWDYDARGQLNKRVKSNGATQMWMYRGGDKPTEIAL---PSGKRYHFKYDLHGNLAKLTTPNSGTHSFDRLVSVGFHRYLYRLPGTQMPYLEDYTS-DGRLLRIQYPSNLRRVYYYYNEKALLEKVISGETTIRHLYNEKSKLRTGYDLQSGNFGCLLDYKPSEQFATSYGITFKDRRY-------------IQGRFEYDYDNNFRISTLKATI-----GSNELVPLKLSYNNTTGKLLTMRSFVFSYPQYNKVVIRNIHVEITKAFDEYSRLNEVQYKFNNEQVYHMAITYDSVGR--LQRWSREIGRGDEKA---FDYSYDIDDNIVDVLLQGQSSWKYTYDTNGNLAT--VSQFGRLKEVLVDNSDRLVSYGDHTYMFDGDGFLIQRNR----DVFVYNSQGQLT---RMTNGDG--RQIWYYYDAHSRLIARKD--SDGAFVQFYYGNVLNKNLVTHIYNHSSYETTVLFYDG-SNRLMAMEKGDRYYYIATDPMGSPVAIFDSVGMIVKQISYEPFGNVEIDSPPHFEFMFGFHGKLYDGEAGLVFMGDRLYDPMTGRYLTPSYRDIFHRVETELLHNPQSIQSYVLQNPTAVLQHYEELDMKDILS---WMNVLGYDMKSLIPSITFDGQIHKGTDWHRYTASRRLLPVTSVFQCAFE-------------RDSANFLTMSTVTPSDM-----MPPERAELQKVAPASGVFGDGLLLSVREG---KAVVTLSEQLQPSSNVMSLLLNNSLVVPLALTQEGKDVHYFVKQETAMAAADLQAAGIGAEFKTLSNGVNFSVEWTQEKTNRMAITKLENDYVMVYILYGTTVEKQYSVLLEQAKSKAITQAWAKERHLLLSNQSGSRNWSPEEKEQIEQRGKASGYSRNYIRDVNDFPEMADDPNNIR 2426          
BLAST of Teneurin-2 vs. TrEMBL
Match: A0A1S3JR43 (teneurin-m-like isoform X7 OS=Lingula unguis OX=7574 GN=LOC106175388 PE=4 SV=1)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 666/2489 (26.76%), Postives = 1146/2489 (46.04%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCS--KRKSDKQSARSNFCLNNGELNTK-DVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTK-----SLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLS----PY-LLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESC---------KERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCP---------SLESNSETVLAIRHKFSDI--RDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG---------------DAQTKPAFKSI----TSITITMFGELIVADNGKKQIFSVHYKQAIKKNYL-YQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQY-NDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN---FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNI-RVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFH-YIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFG----FRLVQKFAY-YGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKI-TIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLI-LNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKL-NPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTT--------KPLEIYREITG---LPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPV---LNLS---TISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYR 8893
            + FNFT+     +G++ R+NS PT V+Y  F  + GR   Q           +  +E   ++ T F+ YLE GLW++ V ND      +    +    +  TCP  C   G CT  G+C CF G++G DCS+   P +C+G G Y +G C C   WKGKEC      CE P+CSGNG+C+ GEC+C  G+ GK+C  + C PSNCS NGVC + G C C +     DCS  + ++     R N C  +G  +   D C+C  G++GE CE   CS +C +G+CS    C+C+EG++G  C +  CD RC  HG C  G C+C  GWNGK+C+LDGCP++C+N+G+C++  +  + C+C   WKG  C++S+E +C D +DND DGL DCQDPDCC T  C  +          C    D   +LL  +     ++F +++ FL   +   K     S N+ ++SV+RG+V   DG+P  G R+    + + G T T + G+FD++V GG  V L+  R P    T    V VP N+ V +   E  +L++   N  +T   C     +V  ++    P +L+ W    +     +S ++  ++ VL  S+ +  T L L++ SS+  G+ SS+L+ L  + +P+ L  ++L++ V G  + +  E D  L Y F WDR NAY + ++G+ +  V+VGY Y+ CS IFWET+   ++G+DL + ++G WNL+  H +++  GI+++GDG++++L +    +  I G  G+ R    C  CDG+  +    +  A+ S   G + + D  Y+R L+       +   LS    PY   M ++  +  L         + ++P+          K  L     G +  ++  LE      GE C           +   + +L HPKG+ I     ++F DG  I+ I+ T   I TV+G      + + LP C      ++ +L WPT++  N +DD+++ +DN NMV R+  +  +V T AG+   CP          L S+    L++  + + I  ++I   P GEL+I E        V +V + G +  + G               D +   A  ++    T++T+T    L VAD G  ++ S+         Y  Y+V+SP T E+Y+FN  GQHR T + +T T +YS  Y +NS  G L+ +  P+ N Q ++ RD  + A ++ +P G    V ++   ++    +P + S  F Y +   LL S +  SE     F  Y D+GR+  VI+P+G  T  VE  V     + K             N N+LA                  Y +  L  N          I  +N   L   + P ++++      +E ATH       +T + +Q  RKI+     D    + EW + +     D    ++  + R+    +V      R+G ++ N      +    ++  +NG++ L + YD  +  E      +   K ++  IYN   Q      F    NL  + V     G  + +KW K  L   +D   R        +N     ++Y G +  ++IA     + K+Y   Y+       + TPN+   S  +L+S+G+ R LY+  G    ++ D+ S +G L R+ YPS + ++ ++Y+    L+ VI G   I  + ++ + L          FG    ++  ++FA  YG    +  Y                +  Y YD+  +I+ +   +       + L    +   N+  +++    F+F     NK+ + N    I    +E  ++       +N ++  + ++YD   +  L   S +I R        F +SY  D +++ +      S +Y Y  +G L +  V+    ++ +   N+  L + G  TY ++ DGFLIQ+      + F YN+ G L    RM +     +++ Y+YD+  R+I  +D        Q++Y + +N + +TH+Y+H+S + +  +Y+  S  L ++    ++YY+ +D +GSP  I  S   IV +  Y+ FG  +           GF G ++D E+ ++FM +R+YDP +  +    +  +F +++   L NP  + SY            E+ D         W+  +G + ++++ +        K  + +R       LP   + +  FE              +  +F T+S +  +D+     +P       +++         + +S+RE    + V  L +   P S + + L  N+ ++ +  ++    + Y VK    M   DLQ  G+  + + +   +N S   T    N +    L   Y ++ I Y +++ +Q S++ E  KS+     W  +R  L  N       S + K+++ + G    +  +   ++ +FP + DDP+  R
Sbjct:  222 VKFNFTLPDDAVIGVYGRLNSKPTYVQYDFFHMLDGRKISQQRRRRRDESSTKDSSEDQVTD-TAFIEYLEPGLWYMMVYNDVEIPNTVSVVSSKHDKVDSTCPKDCLGRGECTN-GQCTCFPGYEGWDCSQTVCPVLCNGRGIYVRGECECYSNWKGKECSVAVDRCEVPNCSGNGECIRGECICSPGFKGKDCREVDCIPSNCSGNGVCVQ-GQCYCNEDHTGSDCSLPRVQNIPNMCRKN-CTQHGVYDMHLDACVCEEGWAGEYCEIERCSLQCVHGHCS-GQRCVCDEGWAGAVCNQVSCDPRCLVHGFCDNGTCMCNPGWNGKYCSLDGCPRSCSNHGRCQV-FSGSWQCNCADGWKGEDCSLSREVQCGDNLDNDEDGLLDCQDPDCCLTVECKDSPH--------CVMSPDPLEILLRKQPPSSTASFFDKMRFLVEEQSVQKFAHTGSFNESQVSVIRGRVYAKDGTPLIGVRVSVVTQPLYGFTLTRELGLFDILVNGGGSVTLQFQRQPFK--TKMATVMVPWNQLVTM---ESINLVLEGDNEVETPHPC-----AVEYNTNTIKPLVLSTWQHTQLGSCPAES-AIIPESQVLQESIAIPGTNLHLVYHSSKTSGYMSSILIQLTPELIPQTLALVHLRVTVEGIVLEKLFEADRGLKYRFAWDRTNAYKQKVYGIVTASVKVGYQYQGCSHIFWETRTATMSGYDLTSSEVGGWNLDIHHTYNFQEGILHKGDGTNIYLKEKPKNLKTILGN-GRQRSVT-CTNCDGDAADSKLLAPVALASGRDGSLYVGDYNYVRKLSPDRQRIDRILELSSQTVPYKYFMTVSPLDGKL---------YISDPH---------SKKVLRVKTMGPVRDLDSNLEI-IAGTGEQCVPGDRDRCGDGKLASQARLTHPKGIAINKDGIVYFVDGVNIRSINKTG-HISTVLGSQLQPGDWNPLP-CQEPADIAQVKLHWPTALSINPLDDTLHILDN-NMVLRMTPERKIVVT-AGHPPHCPPEDIQKTGLGLLSDERLRLSVATRATLISPQNIAFGPWGELYIVESDKQYVNRVRVVSTSGLISHIVGGTPRCNCQDPECKCFDTKETLAASALLNTPTALTVTPDNVLHVADMGNLRVHSIVSSLPTANRYRHYEVMSPGTHEVYTFNRYGQHRSTKNLMTDTVVYSFTYSVNSYYGKLTTVTGPNNN-QLRIVRDYTTWAKEIVSPGGQRSKVKMNPLGQLETFTVPGNYSVSFTYLSSSGLLFSKRTDSEHT--YFYEYDDNGRVSHVIQPTGEVTN-VETDVTSTGAVVKVATDAADVVTMATNGNQLA------------------YLHGNLRAN----------ISYSNDGSLVVEY-PNNLAVT-----METATHPLL----DTEHRMQVKRKIL---GPDNLLHKLEWRFYL---RRDGKSRRSKKVERIGRRLRVGESHRTRHGNRHANQHEMIGV----KLLLVNGEHVLTIEYDREANTETIM---DVNWKELLTIIYNSAGQAEA---FVSSLNLKPVNVTLDPQG--RMVKWQKGDLTQRWDYDARGQLNKRVKSNGATQMWMYRGGDKPTEIAL---PSGKRYHFKYDLHGNLAKLTTPNSGTHSFDRLVSVGFHRYLYRLPGTQMPYLEDYTS-DGRLLRIQYPSNLRRVYYYYNEKALLEKVISGETTIRHLYNEKSKLRTGYDLQSGNFGCLLDYKPSEQFATSYGITFKDRRY-------------IQGRFEYDYDNNFRISTLKATI-----GSNELVPLKLSYNNTTGKLLTMRSFVFSYPQYNKVVIRNIHVEITKAFDEYSRLNEVQYKFNNEQVYHMAITYDSVGR--LQRWSREIGRGDEKA---FDYSYDIDDNIVDVLLQGQSSWKYTYDTNGNLAT--VSQFGRLKEVLVDNSDRLVSYGDHTYMFDGDGFLIQRNR----DVFVYNSQGQLT---RMTNGDG--RQIWYYYDAHSRLIARKD--SDGAFVQFYYGNVLNKNLVTHIYNHSSYETTVLFYDG-SNRLMAMEKGDRYYYIATDPMGSPVAIFDSVGMIVKQISYEPFGNVEIDSPPHFEFMFGFHGKLYDGEAGLVFMGDRLYDPMTGRYLTPSYRDIFHRVETELLHNPQSIQSYVLQNPTAVLQHYEELDMKDILS---WMNVLGYDMKSLIPSITFDGQIHKGTDWHRYTASRRLLPVTSVFQCAFE-------------RDSANFLTMSTVTPSDM-----MPPERAELQKVAPASGVFGDGLLLSVREG---KAVVTLSEQLQPSSNVMSLLLNNSLVVPLALTQEGKDVHYFVKQETAMAAADLQAAGIGAEFKTLSNGVNFSVEWTQEKTNRMAITKLENDYVMVYILYGTTVEKQYSVLLEQAKSKAITQAWAKERHLLLSNQSGSRNWSPEEKEQIEQRGKASGYSRNYIRDVNDFPEMADDPNNIR 2535          
BLAST of Teneurin-2 vs. TrEMBL
Match: A0A2R2MLA0 (teneurin-m-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106175388 PE=4 SV=1)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 666/2486 (26.79%), Postives = 1144/2486 (46.02%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCS--KRKSDKQSARSNFCLNNGELNTK-DVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTK-----SLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP--KIYLSESLSGSIWVINPELEKHKLLVGESC---------KERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCP---------SLESNSETVLAIRHKFSDI--RDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG---------------DAQTKPAFKSI----TSITITMFGELIVADNGKKQIFSVHYKQAIKKNYL-YQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQY-NDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN---FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNI-RVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFH-YIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFG----FRLVQKFAY-YGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKI-TIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLI-LNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKL-NPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTT--------KPLEIYREITG---LPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPV---LNLS---TISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYR 8893
            + FNFT+     +G++ R+NS PT V+Y  F  + GR   Q           +  +E   ++ T F+ YLE GLW++ V ND      +    +    +  TCP  C   G CT  G+C CF G++G DCS+   P +C+G G Y +G C C   WKGKEC      CE P+CSGNG+C+ GEC+C  G+ GK+C  + C PSNCS NGVC + G C C +     DCS  + ++     R N C  +G  +   D C+C  G++GE CE   CS +C +G+CS    C+C+EG++G  C +  CD RC  HG C  G C+C  GWNGK+C+LDGCP++C+N+G+C++  +  + C+C   WKG  C++S+E +C D +DND DGL DCQDPDCC T  C  +          C    D   +LL  +     ++F +++ FL   +   K     S N+ ++SV+RG+V   DG+P  G R+    + + G T T + G+FD++V GG  V L+  R P    T    V VP N+ V +   E  +L++   N  +T   C       +D++ I  P +L+ W    +     +S ++  ++ VL  S+ +  T L L++ SS+  G+ SS+L+ L  + +P+ L  ++L++ V G  + +  E D  L Y F WDR NAY + ++G+ +  V+VGY Y+ CS IFWET+   ++G+DL + ++G WNL+  H +++  GI+++GDG++++L +    +  I G  G+ R    C  CDG+  +    +  A+ S   G + + D  Y+R L+       +   LS   + +             F+        ++  L   +P  K  L     G +  ++  LE      GE C           +   + +L HPKG+ I     ++F DG  I+ I+ T   I TV+G      + + LP C      ++ +L WPT++  N +DD+++ +DN NMV R+  +  +V T AG+   CP          L S+    L++  + + I  ++I   P GEL+I E        V +V + G +  + G               D +   A  ++    T++T+T    L VAD G  ++ S+         Y  Y+V+SP T E+Y+FN  GQHR T + +T T +YS  Y +NS  G L+ +  P+ N Q ++ RD  + A ++ +P G    V ++   ++    +P + S  F Y +   LL S +  SE     F  Y D+GR+  VI+P+G  T  VE  V     + K             N N+LA                  Y +  L  N          I  +N   L   + P ++++      +E ATH       +T + +Q  RKI+     D    + EW + +     D    ++  + R+    +V      R+G ++ N      +    ++  +NG++ L + YD   RE       +   K ++  IYN   Q      F    NL  + V     G  + +KW K  L   +D   R        +N     ++Y G +  ++IA     + K+Y   Y+       + TPN+   S  +L+S+G+ R LY+  G    ++ D+ S +G L R+ YPS + ++ ++Y+    L+ VI G   I  + ++ + L          FG    ++  ++FA  YG    +  Y                +  Y YD+  +I+ +   +       + L    +   N+  +++    F+F     NK+ + N    I    +E  ++       +N ++  + ++YD   +  L   S +I R        F +SY  D +++ +      S +Y Y  +G L +  V+    ++ +   N+  L + G  TY ++ DGFLIQ+      + F YN+ G L    RM +     +++ Y+YD+  R+I  +D        Q++Y + +N + +TH+Y+H+S + +  +Y+  S  L ++    ++YY+ +D +GSP  I  S   IV +  Y+ FG  +           GF G ++D E+ ++FM +R+YDP +  +    +  +F +++   L NP  + SY            E+ D         W+  +G + ++++ +        K  + +R       LP   + +  FE              +  +F T+S +  +D+     +P       +++         + +S+RE    + V  L +   P S + + L  N+ ++ +  ++    + Y VK    M   DLQ  G+  + + +   +N S   T    N +    L   Y ++ I Y +++ +Q S++ E  KS+     W  +R  L  N       S + K+++ + G    +  +   ++ +FP + DDP+  R
Sbjct:  443 VKFNFTLPDDAVIGVYGRLNSKPTYVQYDFFHMLDGRKISQQRRRRRDESSTKDSSEDQVTD-TAFIEYLEPGLWYMMVYNDVEIPNTVSVVSSKHDKVDSTCPKDCLGRGECTN-GQCTCFPGYEGWDCSQTVCPVLCNGRGIYVRGECECYSNWKGKECSVAVDRCEVPNCSGNGECIRGECICSPGFKGKDCREVDCIPSNCSGNGVCVQ-GQCYCNEDHTGSDCSLPRVQNIPNMCRKN-CTQHGVYDMHLDACVCEEGWAGEYCEIERCSLQCVHGHCS-GQRCVCDEGWAGAVCNQVSCDPRCLVHGFCDNGTCMCNPGWNGKYCSLDGCPRSCSNHGRCQV-FSGSWQCNCADGWKGEDCSLSREVQCGDNLDNDEDGLLDCQDPDCCLTVECKDSPH--------CVMSPDPLEILLRKQPPSSTASFFDKMRFLVEEQSVQKFAHTGSFNESQVSVIRGRVYAKDGTPLIGVRVSVVTQPLYGFTLTRELGLFDILVNGGGSVTLQFQRQPFK--TKMATVMVPWNQLVTM---ESINLVLEGDNEVETPHPC----AVEYDTNTIK-PLVLSTWQHTQLGSCPAES-AIIPESQVLQESIAIPGTNLHLVYHSSKTSGYMSSILIQLTPELIPQTLALVHLRVTVEGIVLEKLFEADRGLKYRFAWDRTNAYKQKVYGIVTASVKVGYQYQGCSHIFWETRTATMSGYDLTSSEVGGWNLDIHHTYNFQEGILHKGDGTNIYLKEKPKNLKTILGN-GRQRSVT-CTNCDGDAADSKLLAPVALASGRDGSLYVGDYNYVRKLSPDRQRIDRILELSSQTVPY-----------KYFMTVSP----LDGKLYISDPHSKKVLRVKTMGPVRDLDSNLEI-IAGTGEQCVPGDRDRCGDGKLASQARLTHPKGIAINKDGIVYFVDGVNIRSINKTG-HISTVLGSQLQPGDWNPLP-CQEPADIAQVKLHWPTALSINPLDDTLHILDN-NMVLRMTPERKIVVT-AGHPPHCPPEDIQKTGLGLLSDERLRLSVATRATLISPQNIAFGPWGELYIVESDKQYVNRVRVVSTSGLISHIVGGTPRCNCQDPECKCFDTKETLAASALLNTPTALTVTPDNVLHVADMGNLRVHSIVSSLPTANRYRHYEVMSPGTHEVYTFNRYGQHRSTKNLMTDTVVYSFTYSVNSYYGKLTTVTGPNNN-QLRIVRDYTTWAKEIVSPGGQRSKVKMNPLGQLETFTVPGNYSVSFTYLSSSGLLFSKRTDSEHT--YFYEYDDNGRVSHVIQPTGEVTN-VETDVTSTGAVVKVATDAADVVTMATNGNQLA------------------YLHGNLRAN----------ISYSNDGSLVVEY-PNNLAVT-----METATHPLL----DTEHRMQVKRKIL---GPDNLLHKLEWRFYL---RRDGKSRRSKKVERIGRRLRVGESHRTRHGNRHANQHEMIGV----KLLLVNGEHVLTIEYD---REANTETIMDVNWKELLTIIYNSAGQAEA---FVSSLNLKPVNVTLDPQG--RMVKWQKGDLTQRWDYDARGQLNKRVKSNGATQMWMYRGGDKPTEIAL---PSGKRYHFKYDLHGNLAKLTTPNSGTHSFDRLVSVGFHRYLYRLPGTQMPYLEDYTS-DGRLLRIQYPSNLRRVYYYYNEKALLEKVISGETTIRHLYNEKSKLRTGYDLQSGNFGCLLDYKPSEQFATSYGITFKDRRY-------------IQGRFEYDYDNNFRISTLKATI-----GSNELVPLKLSYNNTTGKLLTMRSFVFSYPQYNKVVIRNIHVEITKAFDEYSRLNEVQYKFNNEQVYHMAITYDSVGR--LQRWSREIGRGDEKA---FDYSYDIDDNIVDVLLQGQSSWKYTYDTNGNLAT--VSQFGRLKEVLVDNSDRLVSYGDHTYMFDGDGFLIQRNR----DVFVYNSQGQLT---RMTNGDG--RQIWYYYDAHSRLIARKD--SDGAFVQFYYGNVLNKNLVTHIYNHSSYETTVLFYD-GSNRLMAMEKGDRYYYIATDPMGSPVAIFDSVGMIVKQISYEPFGNVEIDSPPHFEFMFGFHGKLYDGEAGLVFMGDRLYDPMTGRYLTPSYRDIFHRVETELLHNPQSIQSYVLQNPTAVLQHYEELDMKDILS---WMNVLGYDMKSLIPSITFDGQIHKGTDWHRYTASRRLLPVTSVFQCAFE-------------RDSANFLTMSTVTPSDM-----MPPERAELQKVAPASGVFGDGLLLSVREG---KAVVTLSEQLQPSSNVMSLLLNNSLVVPLALTQEGKDVHYFVKQETAMAAADLQAAGIGAEFKTLSNGVNFSVEWTQEKTNRMAITKLENDYVMVYILYGTTVEKQYSVLLEQAKSKAITQAWAKERHLLLSNQSGSRNWSPEEKEQIEQRGKASGYSRNYIRDVNDFPEMADDPNNIR 2756          
BLAST of Teneurin-2 vs. TrEMBL
Match: A0A2R2MLA5 (teneurin-m-like isoform X6 OS=Lingula unguis OX=7574 GN=LOC106175388 PE=4 SV=1)

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 666/2489 (26.76%), Postives = 1146/2489 (46.04%), Query Frame = 2
Query: 1700 IHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCS--KRKSDKQSARSNFCLNNGELNTK-DVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTK-----SLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLS----PY-LLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESC---------KERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCP---------SLESNSETVLAIRHKFSDI--RDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG---------------DAQTKPAFKSI----TSITITMFGELIVADNGKKQIFSVHYKQAIKKNYL-YQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSS-SWKFQY-NDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKN---FIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNI-RVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFH-YIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFG----FRLVQKFAY-YGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKI-TIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLI-LNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKL-NPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTT--------KPLEIYREITG---LPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPV---LNLS---TISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYR 8893
            + FNFT+     +G++ R+NS PT V+Y  F  + GR   Q           +  +E   ++ T F+ YLE GLW++ V ND      +    +    +  TCP  C   G CT  G+C CF G++G DCS+   P +C+G G Y +G C C   WKGKEC      CE P+CSGNG+C+ GEC+C  G+ GK+C  + C PSNCS NGVC + G C C +     DCS  + ++     R N C  +G  +   D C+C  G++GE CE   CS +C +G+CS    C+C+EG++G  C +  CD RC  HG C  G C+C  GWNGK+C+LDGCP++C+N+G+C++  +  + C+C   WKG  C++S+E +C D +DND DGL DCQDPDCC T  C  +          C    D   +LL  +     ++F +++ FL   +   K     S N+ ++SV+RG+V   DG+P  G R+    + + G T T + G+FD++V GG  V L+  R P    T    V VP N+ V +   E  +L++   N  +T   C     +V  ++    P +L+ W    +     +S ++  ++ VL  S+ +  T L L++ SS+  G+ SS+L+ L  + +P+ L  ++L++ V G  + +  E D  L Y F WDR NAY + ++G+ +  V+VGY Y+ CS IFWET+   ++G+DL + ++G WNL+  H +++  GI+++GDG++++L +    +  I G  G+ R    C  CDG+  +    +  A+ S   G + + D  Y+R L+       +   LS    PY   M ++  +  L         + ++P+          K  L     G +  ++  LE      GE C           +   + +L HPKG+ I     ++F DG  I+ I+ T   I TV+G      + + LP C      ++ +L WPT++  N +DD+++ +DN NMV R+  +  +V T AG+   CP          L S+    L++  + + I  ++I   P GEL+I E        V +V + G +  + G               D +   A  ++    T++T+T    L VAD G  ++ S+         Y  Y+V+SP T E+Y+FN  GQHR T + +T T +YS  Y +NS  G L+ +  P+ N Q ++ RD  + A ++ +P G    V ++   ++    +P + S  F Y +   LL S +  SE     F  Y D+GR+  VI+P+G  T  VE  V     + K             N N+LA                  Y +  L  N          I  +N   L   + P ++++      +E ATH       +T + +Q  RKI+     D    + EW + +     D    ++  + R+    +V      R+G ++ N      +    ++  +NG++ L + YD  +  E      +   K ++  IYN   Q      F    NL  + V     G  + +KW K  L   +D   R        +N     ++Y G +  ++IA     + K+Y   Y+       + TPN+   S  +L+S+G+ R LY+  G    ++ D+ S +G L R+ YPS + ++ ++Y+    L+ VI G   I  + ++ + L          FG    ++  ++FA  YG    +  Y                +  Y YD+  +I+ +   +       + L    +   N+  +++    F+F     NK+ + N    I    +E  ++       +N ++  + ++YD   +  L   S +I R        F +SY  D +++ +      S +Y Y  +G L +  V+    ++ +   N+  L + G  TY ++ DGFLIQ+      + F YN+ G L    RM +     +++ Y+YD+  R+I  +D        Q++Y + +N + +TH+Y+H+S + +  +Y+  S  L ++    ++YY+ +D +GSP  I  S   IV +  Y+ FG  +           GF G ++D E+ ++FM +R+YDP +  +    +  +F +++   L NP  + SY            E+ D         W+  +G + ++++ +        K  + +R       LP   + +  FE              +  +F T+S +  +D+     +P       +++         + +S+RE    + V  L +   P S + + L  N+ ++ +  ++    + Y VK    M   DLQ  G+  + + +   +N S   T    N +    L   Y ++ I Y +++ +Q S++ E  KS+     W  +R  L  N       S + K+++ + G    +  +   ++ +FP + DDP+  R
Sbjct:  223 VKFNFTLPDDAVIGVYGRLNSKPTYVQYDFFHMLDGRKISQQRRRRRDESSTKDSSEDQVTD-TAFIEYLEPGLWYMMVYNDVEIPNTVSVVSSKHDKVDSTCPKDCLGRGECTN-GQCTCFPGYEGWDCSQTVCPVLCNGRGIYVRGECECYSNWKGKECSVAVDRCEVPNCSGNGECIRGECICSPGFKGKDCREVDCIPSNCSGNGVCVQ-GQCYCNEDHTGSDCSLPRVQNIPNMCRKN-CTQHGVYDMHLDACVCEEGWAGEYCEIERCSLQCVHGHCS-GQRCVCDEGWAGAVCNQVSCDPRCLVHGFCDNGTCMCNPGWNGKYCSLDGCPRSCSNHGRCQV-FSGSWQCNCADGWKGEDCSLSREVQCGDNLDNDEDGLLDCQDPDCCLTVECKDSPH--------CVMSPDPLEILLRKQPPSSTASFFDKMRFLVEEQSVQKFAHTGSFNESQVSVIRGRVYAKDGTPLIGVRVSVVTQPLYGFTLTRELGLFDILVNGGGSVTLQFQRQPFK--TKMATVMVPWNQLVTM---ESINLVLEGDNEVETPHPC-----AVEYNTNTIKPLVLSTWQHTQLGSCPAES-AIIPESQVLQESIAIPGTNLHLVYHSSKTSGYMSSILIQLTPELIPQTLALVHLRVTVEGIVLEKLFEADRGLKYRFAWDRTNAYKQKVYGIVTASVKVGYQYQGCSHIFWETRTATMSGYDLTSSEVGGWNLDIHHTYNFQEGILHKGDGTNIYLKEKPKNLKTILGN-GRQRSVT-CTNCDGDAADSKLLAPVALASGRDGSLYVGDYNYVRKLSPDRQRIDRILELSSQTVPYKYFMTVSPLDGKL---------YISDPH---------SKKVLRVKTMGPVRDLDSNLEI-IAGTGEQCVPGDRDRCGDGKLASQARLTHPKGIAINKDGIVYFVDGVNIRSINKTG-HISTVLGSQLQPGDWNPLP-CQEPADIAQVKLHWPTALSINPLDDTLHILDN-NMVLRMTPERKIVVT-AGHPPHCPPEDIQKTGLGLLSDERLRLSVATRATLISPQNIAFGPWGELYIVESDKQYVNRVRVVSTSGLISHIVGGTPRCNCQDPECKCFDTKETLAASALLNTPTALTVTPDNVLHVADMGNLRVHSIVSSLPTANRYRHYEVMSPGTHEVYTFNRYGQHRSTKNLMTDTVVYSFTYSVNSYYGKLTTVTGPNNN-QLRIVRDYTTWAKEIVSPGGQRSKVKMNPLGQLETFTVPGNYSVSFTYLSSSGLLFSKRTDSEHT--YFYEYDDNGRVSHVIQPTGEVTN-VETDVTSTGAVVKVATDAADVVTMATNGNQLA------------------YLHGNLRAN----------ISYSNDGSLVVEY-PNNLAVT-----METATHPLL----DTEHRMQVKRKIL---GPDNLLHKLEWRFYL---RRDGKSRRSKKVERIGRRLRVGESHRTRHGNRHANQHEMIGV----KLLLVNGEHVLTIEYDREANTETIM---DVNWKELLTIIYNSAGQAEA---FVSSLNLKPVNVTLDPQG--RMVKWQKGDLTQRWDYDARGQLNKRVKSNGATQMWMYRGGDKPTEIAL---PSGKRYHFKYDLHGNLAKLTTPNSGTHSFDRLVSVGFHRYLYRLPGTQMPYLEDYTS-DGRLLRIQYPSNLRRVYYYYNEKALLEKVISGETTIRHLYNEKSKLRTGYDLQSGNFGCLLDYKPSEQFATSYGITFKDRRY-------------IQGRFEYDYDNNFRISTLKATI-----GSNELVPLKLSYNNTTGKLLTMRSFVFSYPQYNKVVIRNIHVEITKAFDEYSRLNEVQYKFNNEQVYHMAITYDSVGR--LQRWSREIGRGDEKA---FDYSYDIDDNIVDVLLQGQSSWKYTYDTNGNLAT--VSQFGRLKEVLVDNSDRLVSYGDHTYMFDGDGFLIQRNR----DVFVYNSQGQLT---RMTNGDG--RQIWYYYDAHSRLIARKD--SDGAFVQFYYGNVLNKNLVTHIYNHSSYETTVLFYDG-SNRLMAMEKGDRYYYIATDPMGSPVAIFDSVGMIVKQISYEPFGNVEIDSPPHFEFMFGFHGKLYDGEAGLVFMGDRLYDPMTGRYLTPSYRDIFHRVETELLHNPQSIQSYVLQNPTAVLQHYEELDMKDILS---WMNVLGYDMKSLIPSITFDGQIHKGTDWHRYTASRRLLPVTSVFQCAFE-------------RDSANFLTMSTVTPSDM-----MPPERAELQKVAPASGVFGDGLLLSVREG---KAVVTLSEQLQPSSNVMSLLLNNSLVVPLALTQEGKDVHYFVKQETAMAAADLQAAGIGAEFKTLSNGVNFSVEWTQEKTNRMAITKLENDYVMVYILYGTTVEKQYSVLLEQAKSKAITQAWAKERHLLLSNQSGSRNWSPEEKEQIEQRGKASGYSRNYIRDVNDFPEMADDPNNIR 2536          
BLAST of Teneurin-2 vs. Ensembl Cavefish
Match: tenm4 (teneurin transmembrane protein 4 [Source:NCBI gene;Acc:103031446])

HSP 1 Score: 618.616 bits (1594), Expect = 6.994e-179
Identity = 575/2196 (26.18%), Postives = 970/2196 (44.17%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWR----QVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGS---AFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMD-LKE------TGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQ-IFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINP-----ELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHY-KQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISK-NSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNR-TSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSI-QYQYYEDGRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILK-RVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQW----FGLFTQLKNVKLNPFLLNSYQF 7990
            W  + F +H   + FN +++    +GI+ R    P+  ++   E + GR       Q L         RSL     S  TGF+ Y++ G+W L+V ND    E + F L T +     CP  C  +G C   G C CF GF+G DC +   P +CSG+G Y +G C C+  WKG EC     +C    CSG+G C+ G C+C  GY G+NC  + C    CS  GVC R G C CF GW    C   ++   D+ S    F  + G       C C   ++G  C   LC+  C      V G C C EG++G  C +R C SRC +HG C +G C C  GWNG+HCT++GCP  CN NG+C L +   +YC C   W+G  C+ S E+ C D  DND DGL DC DPDCC    C  T+         C    D   ++  T++S   S    F++++ FL  R  T               V+RG+V+ SDG+P  G  I        G+T T +DG FDLV  GG  + L   R P    T  + +++P + F       + D ++ +       P C        D S    P  L      ++P   T       + G +V  +  L+E      T ++L + SSR  G+KS L V L    +P NL +++L + V G+   +     P L+Y F WD+ + Y++ + GL+   V VG+ YE+C   I WE +  ++ G++  A ++G W+++  H  +   GI+++G+G ++F++Q    I  I G  G+ R +  C  C+G        +  A+     G + + D  YIR +   GN     ++           R  +         +H N+P  +   LA  P    +YLS++ S  ++ +       ++ K+  LV   G+ C    E  C      +   L +P+G+T+     +FF DG  I+ I   N  I T++G     +  +R   C S +  S+ RL+WPT +  + +D+S+Y +DN N+V ++  +N  V  VAG    C  P L+    + +AI         +  +  G L+IAE        V  V ++G +  V G                   D   K A   S +S+ ++  GEL +AD G  +I  V   K  +    +Y+V SP   ELY F++ G H  T S  TG  LY+L Y   +  G LS I   + N +  + RDT      + +P G  +  T+     + ++A                    Q  E+A    TY+  SG L +     G TT F E+  Y        +L N    +   R++S      N++      SN  +  +  N         L+    Q ++ N +       +D   ++ LA            NG++    +   TE            +++S +++ T+SK N  + +D    ++        ++   +++   ++   R  +++ +N L + +D  +R E   VY++ + K  ++  Y+   +     P    + L  + V Y+  G +  I+     + + YD   R TS I+    +  + Y+    E S  +   ++   ++Y   ++  D+  S+  PN    +++   SIGY R  Y+P   ++  + D+ + +G L + ++     +I + Y   ++L  ++Y   R+ F   ++  +++ +  +    GF    ++   GPL+    +       S++ +  +++  Y+YD+  ++  +  ++ + P      R +   V     Q  ++    ++IN I+    + + K F     +  G++     ++  S +  + V YD    N   V + ++          + + Y  D  L + + +   + +Y Y  +G L  L   + A   P+ Y I D  T L    G V Y  +DDGFL Q+ N    + F YN+ GLL     + + SK+    ++Y YD   R +  R         Q+FY D  +  R+THMY+H+S +++S YY+   GHLF++ +     YYV  D +G+P  + S +  ++ +  +  FGE     + S  + +G+ G +++  + ++ M  R YD      AG +W      ++ QL +  + PF  N Y F
Sbjct:  546 WRSQVFIDHPMYLKFNVSLSKDALVGIYGRRGLPPSHTQFDFVELLDGRRLLAQGVQSLEGPPALTQPRSLMP-LSSHDTGFIQYMDSGIWHLAVYNDGKETEQVAF-LTTAIDSIDDCPSNCFGNGDCIA-GTCHCFLGFRGPDCGRASCPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDVTCSGHGTCIVGTCICNPGYKGENCEEVDCLDPTCSGRGVCVR-GECHCFVGWGGPGCESPRASCMDQCSGHGAFLADTG------TCSCDPNWTGHDCSTELCAADCGGHGVCVAGGCRCEEGWTGAGCDQRACHSRCSEHGTCKDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLGNN-GWYCVCQLGWRGTGCDTSMETACSDAKDNDGDGLLDCMDPDCCLQASCHTTSL--------CVGSPDPLDIIQETQISSSPSNLQTFYQRVRFLVGRDSTHVIPGVNPFEGSHACVIRGQVVTSDGTPLVGVNISFINNPAYGYTITRQDGSFDLVSNGGVAIALRFERAP--FITQEHTLWLPWSRFF------VMDTIVMRHEVNDI-PSC--------DLSSFTRPSPL------VLPAPLTAFAGNCPERGGIVPEIQALQEEVRIPGTDVRLGYLSSRTAGYKSLLRVTLTHAIIPFNLMKVHLMVAVEGRLFRKWFSAAPNLSYDFVWDKTDVYSQKVHGLSEAFVSVGFEYESCPDLILWEKRTAILQGYETTASNLGGWSIDQHHALNIQSGILHKGNGENVFISQQPPVIGSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALACGSDGSLFVGDFNYIRRIFTTGNVTSVLEL-----------RNKDF--------RHSNSP-AHKYYLATSPVSGALYLSDTSSRKVFKVKSLNTVKDVAKNLELVAGTGDQCLPYDETRCGDGGKAVEATLTNPRGITVDKYGMIFFVDGTMIRRID-QNGIISTLLGFNDLTS--ARPLSCDSVMDISQVRLEWPTDLAVSPMDNSLYVLDN-NVVLQIS-ENHQVRIVAGRPMHCQVPGLDHFLVSKVAIHATLESATALAASHNGILYIAESDDKKINRVRQVSTNGEISLVAGAPSGCDCKNDANCDCYSGDDGYAKDAKLNSPSSLAVSPNGELFIADLGNIRIRYVRRNKPYLNPLNMYEVSSPIDDELYLFDANGSHIYTQSLTTGDYLYNLTY---TGEGDLSTITDKNKN-KVTLRRDTTGLPLWIMSPDGQTFWFTIGTNNALKSVAA-------------------QGQELA--MMTYHGSSGLLATKSNEDGWTT-FYEYDSYG-------RLTNVT--YPTGRVSSYRTDADNAVRVQAEGSNKEDIIVTTNLSASGTFYTLM----QEQVKNSYYIG----LDGSLRLVLA------------NGME----VSLHTEP-----------HLLSGTVNPTVSKRNVTLPIDNGLNLVE-------WRQRKEQARGQVTVYGRRLRVHNRNLLSMDFDRITRTE--KVYDDHR-KFTLRIHYDLAGRPTLWAP---SSRLNGVNVTYSPGGHVAGIQRGTMSVRMEYDQNGRITSQIFADGKSWSYTYL----EKSMVLLLYSQ---RQYIFEFDKNDRLSSVTMPNVARQTLETTRSIGYYRNTYRPPEGNATVLQDY-TEDGLLLQTMHQGTGRRIIYKYGKLSRLLEILYDTTRVAFSYDEAAGMLKTV--SLQSEGFTCTIRYRQIGPLIDRQIFRF-----SEEGM-VNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDD--VSGKTEQFGKFGVIYYDINQIITTAVMTHTKHF-----DAYGRVKEVQYEIFRSLMYWMMVQYD----NMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRL----GDVQYRLDDDGFLRQRGN----DFFEYNSAGLL-----IRAYSKVGGWSIKYRYDGLSRRVSSRSSQ--GHHLQFFYADLSSPTRVTHMYNHSSSEITSLYYD-LQGHLFAMELSSGDEYYVACDNIGTPLAVFSGSGLMIKQILHTAFGEVYLDSNPSFQLVVGYQGGLYEPLTKLVHMGRRDYDV----LAG-RWTTPDHDIWKQLNDNNIVPF--NLYMF 2539          
BLAST of Teneurin-2 vs. Ensembl Cavefish
Match: tenm4 (teneurin transmembrane protein 4 [Source:NCBI gene;Acc:103031446])

HSP 1 Score: 613.994 bits (1582), Expect = 9.764e-178
Identity = 575/2196 (26.18%), Postives = 965/2196 (43.94%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWR----QVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDC-SKRKS--DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGS---AFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMD-LKE------TGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQ-IFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINP-----ELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHY-KQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISK-NSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNR-TSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSI-QYQYYEDGRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILK-RVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQW----FGLFTQLKNVKLNPFLLNSYQF 7990
            W  + F +H   + FN +++    +GI+ R    P+  ++   E + GR       Q L         RSL     S  TGF+ Y++ G+W L+V ND    E + F L T +     CP  C  +G C   G C CF GF+G DC +   P +CSG+G Y +G C C+  WKG EC     +C    CSG+G C+ G C+C  GY G+NC  + C    CS  GVC R G C CF GW    C S R S  D+ S    F  + G       C C   ++G  C   LC+  C      V G C C EG++G  C +R C SRC +HG C +G C C  GWNG+HCT++GCP  CN NG+C L +   +YC C   W+G  C+ S E+ C D  DND DGL DC DPDCC    C  T+         C    D   ++  T++S   S    F++++ FL  R  T               V+RG+V+ SDG+P  G  I        G+T T +DG FDLV  GG  + L   R P    T  + +++P + F       + D ++ +       P C        D S    P  L      ++P   T       + G +V  +  L+E      T ++L + SSR  G+KS L V L    +P NL +++L + V G+   +     P L+Y F WD+ + Y++ + GL+   V VG+ YE+C   I WE +  ++ G++  A ++G W+++  H  +   GI+++G+G ++F++Q    I  I G  G+ R +  C  C+G        +  A+     G + + D  YIR +   GN     ++                           +N   +   LA  P    +YLS++ S  ++ +       ++ K+  LV   G+ C    E  C      +   L +P+G+T+     +FF DG  I+ I   N  I T++G     +  +R   C S +  S+ RL+WPT +  + +D+S+Y +DN N+V ++  +N  V  VAG    C  P L+    + +AI         +  +  G L+IAE        V  V ++G +  V G                   D   K A   S +S+ ++  GEL +AD G  +I  V   K  +    +Y+V SP   ELY F++ G H  T S  TG  LY+L Y   +  G LS I   + N +  + RDT      + +P G  +  T+     + ++A                    Q  E+A    TY+  SG L +     G TT F E+  Y        +L N    +   R++S      N++      SN  +  +  N         L+    Q ++ N +       +D   ++ LA            NG++    +   TE            +++S +++ T+SK N  + +D    ++        ++   +++   ++   R  +++ +N L + +D  +R E   VY++ + K  ++  Y+   +     P    + L  + V Y+  G +  I+     + + YD   R TS I+    +  + Y+    E S  +   ++   ++Y   ++  D+  S+  PN    +++   SIGY R  Y+P   ++  + D+   +G L + ++     +I + Y   ++L  ++Y   R+ F   ++  +++ +  +    GF    ++   GPL+    +       S++ +  +++  Y+YD+  ++  +  ++ + P      R +   V     Q  ++    ++IN I+    + + K F     +  G++     ++  S +  + V YD    N   V + ++          + + Y  D  L + + +   + +Y Y  +G L  L   + A   P+ Y I D  T L    G V Y  +DDGFL Q+ N    + F YN+ GLL     + + SK+    ++Y YD   R +  R         Q+FY D  +  R+THMY+H+S +++S YY+   GHLF++ +     YYV  D +G+P  + S +  ++ +  +  FGE     + S  + +G+ G +++  + ++ M  R YD      AG +W      ++ QL +  + PF  N Y F
Sbjct:  422 WRSQVFIDHPMYLKFNVSLSKDALVGIYGRRGLPPSHTQFDFVELLDGRRLLAQGVQSLEGPPALTQPRSLMP-LSSHDTGFIQYMDSGIWHLAVYNDGKETEQVAF-LTTAIDSIDDCPSNCFGNGDCIA-GTCHCFLGFRGPDCGRASCPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDVTCSGHGTCIVGTCICNPGYKGENCEEVDCLDPTCSGRGVCVR-GECHCFVGWGGPGCESPRASCMDQCSGHGAFLADTG------TCSCDPNWTGHDCSTELCAADCGGHGVCVAGGCRCEEGWTGAGCDQRACHSRCSEHGTCKDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLGNN-GWYCVCQLGWRGTGCDTSMETACSDAKDNDGDGLLDCMDPDCCLQASCHTTSL--------CVGSPDPLDIIQETQISSSPSNLQTFYQRVRFLVGRDSTHVIPGVNPFEGSHACVIRGQVVTSDGTPLVGVNISFINNPAYGYTITRQDGSFDLVSNGGVAIALRFERAP--FITQEHTLWLPWSRFF------VMDTIVMRHEVNDI-PSC--------DLSSFTRPSPL------VLPAPLTAFAGNCPERGGIVPEIQALQEEVRIPGTDVRLGYLSSRTAGYKSLLRVTLTHAIIPFNLMKVHLMVAVEGRLFRKWFSAAPNLSYDFVWDKTDVYSQKVHGLSEAFVSVGFEYESCPDLILWEKRTAILQGYETTASNLGGWSIDQHHALNIQSGILHKGNGENVFISQQPPVIGSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALACGSDGSLFVGDFNYIRRIFTTGNVTSVLEL---------------------------SNSPAHKYYLATSPVSGALYLSDTSSRKVFKVKSLNTVKDVAKNLELVAGTGDQCLPYDETRCGDGGKAVEATLTNPRGITVDKYGMIFFVDGTMIRRID-QNGIISTLLGFNDLTS--ARPLSCDSVMDISQVRLEWPTDLAVSPMDNSLYVLDN-NVVLQIS-ENHQVRIVAGRPMHCQVPGLDHFLVSKVAIHATLESATALAASHNGILYIAESDDKKINRVRQVSTNGEISLVAGAPSGCDCKNDANCDCYSGDDGYAKDAKLNSPSSLAVSPNGELFIADLGNIRIRYVRRNKPYLNPLNMYEVSSPIDDELYLFDANGSHIYTQSLTTGDYLYNLTY---TGEGDLSTITDKNKN-KVTLRRDTTGLPLWIMSPDGQTFWFTIGTNNALKSVAA-------------------QGQELA--MMTYHGSSGLLATKSNEDGWTT-FYEYDSYG-------RLTNVT--YPTGRVSSYRTDADNAVRVQAEGSNKEDIIVTTNLSASGTFYTLM----QEQVKNSYYIG----LDGSLRLVLA------------NGME----VSLHTEP-----------HLLSGTVNPTVSKRNVTLPIDNGLNLVE-------WRQRKEQARGQVTVYGRRLRVHNRNLLSMDFDRITRTE--KVYDDHR-KFTLRIHYDLAGRPTLWAP---SSRLNGVNVTYSPGGHVAGIQRGTMSVRMEYDQNGRITSQIFADGKSWSYTYL----EKSMVLLLYSQ---RQYIFEFDKNDRLSSVTMPNVARQTLETTRSIGYYRNTYRPPEGNATVLQDYTE-DGLLLQTMHQGTGRRIIYKYGKLSRLLEILYDTTRVAFSYDEAAGMLKTV--SLQSEGFTCTIRYRQIGPLIDRQIFRF-----SEEGM-VNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDD--VSGKTEQFGKFGVIYYDINQIITTAVMTHTKHF-----DAYGRVKEVQYEIFRSLMYWMMVQYD----NMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRL----GDVQYRLDDDGFLRQRGN----DFFEYNSAGLL-----IRAYSKVGGWSIKYRYDGLSRRVSSRSSQ--GHHLQFFYADLSSPTRVTHMYNHSSSEITSLYYD-LQGHLFAMELSSGDEYYVACDNIGTPLAVFSGSGLMIKQILHTAFGEVYLDSNPSFQLVVGYQGGLYEPLTKLVHMGRRDYDV----LAG-RWTTPDHDIWKQLNDNNIVPF--NLYMF 2408          
BLAST of Teneurin-2 vs. Ensembl Cavefish
Match: tenm4 (teneurin transmembrane protein 4 [Source:NCBI gene;Acc:103031446])

HSP 1 Score: 613.609 bits (1581), Expect = 1.684e-177
Identity = 575/2196 (26.18%), Postives = 965/2196 (43.94%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWR----QVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDC-SKRKS--DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGS---AFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMD-LKE------TGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQ-IFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINP-----ELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHY-KQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISK-NSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNR-TSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSI-QYQYYEDGRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILK-RVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQW----FGLFTQLKNVKLNPFLLNSYQF 7990
            W  + F +H   + FN +++    +GI+ R    P+  ++   E + GR       Q L         RSL     S  TGF+ Y++ G+W L+V ND    E + F L T +     CP  C  +G C   G C CF GF+G DC +   P +CSG+G Y +G C C+  WKG EC     +C    CSG+G C+ G C+C  GY G+NC  + C    CS  GVC R G C CF GW    C S R S  D+ S    F  + G       C C   ++G  C   LC+  C      V G C C EG++G  C +R C SRC +HG C +G C C  GWNG+HCT++GCP  CN NG+C L +   +YC C   W+G  C+ S E+ C D  DND DGL DC DPDCC    C  T+         C    D   ++  T++S   S    F++++ FL  R  T               V+RG+V+ SDG+P  G  I        G+T T +DG FDLV  GG  + L   R P    T  + +++P + F       + D ++ +       P C        D S    P  L      ++P   T       + G +V  +  L+E      T ++L + SSR  G+KS L V L    +P NL +++L + V G+   +     P L+Y F WD+ + Y++ + GL+   V VG+ YE+C   I WE +  ++ G++  A ++G W+++  H  +   GI+++G+G ++F++Q    I  I G  G+ R +  C  C+G        +  A+     G + + D  YIR +   GN     ++                           +N   +   LA  P    +YLS++ S  ++ +       ++ K+  LV   G+ C    E  C      +   L +P+G+T+     +FF DG  I+ I   N  I T++G     +  +R   C S +  S+ RL+WPT +  + +D+S+Y +DN N+V ++  +N  V  VAG    C  P L+    + +AI         +  +  G L+IAE        V  V ++G +  V G                   D   K A   S +S+ ++  GEL +AD G  +I  V   K  +    +Y+V SP   ELY F++ G H  T S  TG  LY+L Y   +  G LS I   + N +  + RDT      + +P G  +  T+     + ++A                    Q  E+A    TY+  SG L +     G TT F E+  Y        +L N    +   R++S      N++      SN  +  +  N         L+    Q ++ N +       +D   ++ LA            NG++    +   TE            +++S +++ T+SK N  + +D    ++        ++   +++   ++   R  +++ +N L + +D  +R E   VY++ + K  ++  Y+   +     P    + L  + V Y+  G +  I+     + + YD   R TS I+    +  + Y+    E S  +   ++   ++Y   ++  D+  S+  PN    +++   SIGY R  Y+P   ++  + D+   +G L + ++     +I + Y   ++L  ++Y   R+ F   ++  +++ +  +    GF    ++   GPL+    +       S++ +  +++  Y+YD+  ++  +  ++ + P      R +   V     Q  ++    ++IN I+    + + K F     +  G++     ++  S +  + V YD    N   V + ++          + + Y  D  L + + +   + +Y Y  +G L  L   + A   P+ Y I D  T L    G V Y  +DDGFL Q+ N    + F YN+ GLL     + + SK+    ++Y YD   R +  R         Q+FY D  +  R+THMY+H+S +++S YY+   GHLF++ +     YYV  D +G+P  + S +  ++ +  +  FGE     + S  + +G+ G +++  + ++ M  R YD      AG +W      ++ QL +  + PF  N Y F
Sbjct:  455 WRSQVFIDHPMYLKFNVSLSKDALVGIYGRRGLPPSHTQFDFVELLDGRRLLAQGVQSLEGPPALTQPRSLMP-LSSHDTGFIQYMDSGIWHLAVYNDGKETEQVAF-LTTAIDSIDDCPSNCFGNGDCIA-GTCHCFLGFRGPDCGRASCPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDVTCSGHGTCIVGTCICNPGYKGENCEEVDCLDPTCSGRGVCVR-GECHCFVGWGGPGCESPRASCMDQCSGHGAFLADTG------TCSCDPNWTGHDCSTELCAADCGGHGVCVAGGCRCEEGWTGAGCDQRACHSRCSEHGTCKDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLGNN-GWYCVCQLGWRGTGCDTSMETACSDAKDNDGDGLLDCMDPDCCLQASCHTTSL--------CVGSPDPLDIIQETQISSSPSNLQTFYQRVRFLVGRDSTHVIPGVNPFEGSHACVIRGQVVTSDGTPLVGVNISFINNPAYGYTITRQDGSFDLVSNGGVAIALRFERAP--FITQEHTLWLPWSRFF------VMDTIVMRHEVNDI-PSC--------DLSSFTRPSPL------VLPAPLTAFAGNCPERGGIVPEIQALQEEVRIPGTDVRLGYLSSRTAGYKSLLRVTLTHAIIPFNLMKVHLMVAVEGRLFRKWFSAAPNLSYDFVWDKTDVYSQKVHGLSEAFVSVGFEYESCPDLILWEKRTAILQGYETTASNLGGWSIDQHHALNIQSGILHKGNGENVFISQQPPVIGSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALACGSDGSLFVGDFNYIRRIFTTGNVTSVLEL---------------------------SNSPAHKYYLATSPVSGALYLSDTSSRKVFKVKSLNTVKDVAKNLELVAGTGDQCLPYDETRCGDGGKAVEATLTNPRGITVDKYGMIFFVDGTMIRRID-QNGIISTLLGFNDLTS--ARPLSCDSVMDISQVRLEWPTDLAVSPMDNSLYVLDN-NVVLQIS-ENHQVRIVAGRPMHCQVPGLDHFLVSKVAIHATLESATALAASHNGILYIAESDDKKINRVRQVSTNGEISLVAGAPSGCDCKNDANCDCYSGDDGYAKDAKLNSPSSLAVSPNGELFIADLGNIRIRYVRRNKPYLNPLNMYEVSSPIDDELYLFDANGSHIYTQSLTTGDYLYNLTY---TGEGDLSTITDKNKN-KVTLRRDTTGLPLWIMSPDGQTFWFTIGTNNALKSVAA-------------------QGQELA--MMTYHGSSGLLATKSNEDGWTT-FYEYDSYG-------RLTNVT--YPTGRVSSYRTDADNAVRVQAEGSNKEDIIVTTNLSASGTFYTLM----QEQVKNSYYIG----LDGSLRLVLA------------NGME----VSLHTEP-----------HLLSGTVNPTVSKRNVTLPIDNGLNLVE-------WRQRKEQARGQVTVYGRRLRVHNRNLLSMDFDRITRTE--KVYDDHR-KFTLRIHYDLAGRPTLWAP---SSRLNGVNVTYSPGGHVAGIQRGTMSVRMEYDQNGRITSQIFADGKSWSYTYL----EKSMVLLLYSQ---RQYIFEFDKNDRLSSVTMPNVARQTLETTRSIGYYRNTYRPPEGNATVLQDYTE-DGLLLQTMHQGTGRRIIYKYGKLSRLLEILYDTTRVAFSYDEAAGMLKTV--SLQSEGFTCTIRYRQIGPLIDRQIFRF-----SEEGM-VNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDD--VSGKTEQFGKFGVIYYDINQIITTAVMTHTKHF-----DAYGRVKEVQYEIFRSLMYWMMVQYD----NMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRL----GDVQYRLDDDGFLRQRGN----DFFEYNSAGLL-----IRAYSKVGGWSIKYRYDGLSRRVSSRSSQ--GHHLQFFYADLSSPTRVTHMYNHSSSEITSLYYD-LQGHLFAMELSSGDEYYVACDNIGTPLAVFSGSGLMIKQILHTAFGEVYLDSNPSFQLVVGYQGGLYEPLTKLVHMGRRDYDV----LAG-RWTTPDHDIWKQLNDNNIVPF--NLYMF 2441          
BLAST of Teneurin-2 vs. Ensembl Cavefish
Match: tenm4 (teneurin transmembrane protein 4 [Source:NCBI gene;Acc:103031446])

HSP 1 Score: 612.838 bits (1579), Expect = 4.085e-177
Identity = 572/2196 (26.05%), Postives = 964/2196 (43.90%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWR----QVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGS---AFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMD-LKE------TGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQ-IFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINP-----ELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHY-KQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISK-NSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNR-TSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSI-QYQYYEDGRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILK-RVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQW----FGLFTQLKNVKLNPFLLNSYQF 7990
            W  + F +H   + FN +++    +GI+ R    P+  ++   E + GR       Q L         RSL     S  TGF+ Y++ G+W L+V ND    E + F L T +     CP  C  +G C   G C CF GF+G DC +   P +CSG+G Y +G C C+  WKG EC     +C    CSG+G C+ G C+C  GY G+NC  + C    CS  GVC R G C CF GW    C   ++   D+ S    F  + G       C C   ++G  C   LC+  C      V G C C EG++G  C +R C SRC +HG C +G C C  GWNG+HCT++GCP  CN NG+C L +   +YC C   W+G  C+ S E+ C D  DND DGL DC DPDCC    C  T+         C    D   ++  T++S   S    F++++ FL  R  T               V+RG+V+ SDG+P  G  I        G+T T +DG FDLV  GG  + L   R P    T  + +++P + F       + D ++ +       P C        D S    P  L      ++P   T       + G +V  +  L+E      T ++L + SSR  G+KS L V L    +P NL +++L + V G+   +     P L+Y F WD+ + Y++ + GL+   V VG+ YE+C   I WE +  ++ G++  A ++G W+++  H  +   GI+++G+G ++F++Q    I  I G  G+ R +  C  C+G        +  A+     G + + D  YIR +   GN     ++                           +N   +   LA  P    +YLS++ S  ++ +       ++ K+  LV   G+ C    E  C      +   L +P+G+T+     +FF DG  I+ I   N  I T++G     +  +R   C S +  S+ RL+WPT +  + +D+S+Y +DN N+V ++  +N  V  VAG    C  P L+    + +AI         +  +  G L+IAE        V  V ++G +  V G                   D   K A   S +S+ ++  GEL +AD G  +I  V   K  +    +Y+V SP   ELY F++ G H  T S  TG  LY+L Y   +  G LS I   + N +  + RDT      + +P G  +  T+     + ++A                    Q  E+A    TY+  SG L +     G TT F E+  Y        +L N    +   R++S      N++      SN  +  +  N         L+    Q ++ N +       +D   ++ LA            NG++    +   TE            +++S +++ T+SK N  + +D    ++        ++   +++   ++   R  +++ +N L + +D  +R E   VY++ + K  ++  Y+   +     P    + L  + V Y+  G +  I+     + + YD   R TS I+    +  + Y+    E S  +   ++   ++Y   ++  D+  S+  PN    +++   SIGY R  Y+P   ++  + D+   +G L + ++     +I + Y   ++L  ++Y   R+ F   ++  +++ +  +    GF    ++   GPL+    +       S++ +  +++  Y+YD+  ++  +  ++ + P      R +   V     Q  ++    ++IN I+    + + K F     +  G++     ++  S +  + V YD    N   V + ++          + + Y  D  L + + +   + +Y Y  +G L  L   + A   P+ Y I D  T L    G V Y  +DDGFL Q+ N    + F YN+ GLL     + + SK+    ++Y YD   R +  R         Q+FY D  +  R+THMY+H+S +++S YY+   GHLF++ +     YYV  D +G+P  + S +  ++ +  +  FGE     + S  + +G+ G +++  + ++ M  R YD      AG +W      ++ QL +  + PF  N Y F
Sbjct:  488 WRSQVFIDHPMYLKFNVSLSKDALVGIYGRRGLPPSHTQFDFVELLDGRRLLAQGVQSLEGPPALTQPRSLMP-LSSHDTGFIQYMDSGIWHLAVYNDGKETEQVAF-LTTAIDSIDDCPSNCFGNGDCIA-GTCHCFLGFRGPDCGRASCPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDVTCSGHGTCIVGTCICNPGYKGENCEEVDCLDPTCSGRGVCVR-GECHCFVGWGGPGCESPRASCMDQCSGHGAFLADTG------TCSCDPNWTGHDCSTELCAADCGGHGVCVAGGCRCEEGWTGAGCDQRACHSRCSEHGTCKDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLGNN-GWYCVCQLGWRGTGCDTSMETACSDAKDNDGDGLLDCMDPDCCLQASCHTTSL--------CVGSPDPLDIIQETQISSSPSNLQTFYQRVRFLVGRDSTHVIPGVNPFEGSHACVIRGQVVTSDGTPLVGVNISFINNPAYGYTITRQDGSFDLVSNGGVAIALRFERAP--FITQEHTLWLPWSRFF------VMDTIVMRHEVNDI-PSC--------DLSSFTRPSPL------VLPAPLTAFAGNCPERGGIVPEIQALQEEVRIPGTDVRLGYLSSRTAGYKSLLRVTLTHAIIPFNLMKVHLMVAVEGRLFRKWFSAAPNLSYDFVWDKTDVYSQKVHGLSEAFVSVGFEYESCPDLILWEKRTAILQGYETTASNLGGWSIDQHHALNIQSGILHKGNGENVFISQQPPVIGSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALACGSDGSLFVGDFNYIRRIFTTGNVTSVLEL---------------------------SNSPAHKYYLATSPVSGALYLSDTSSRKVFKVKSLNTVKDVAKNLELVAGTGDQCLPYDETRCGDGGKAVEATLTNPRGITVDKYGMIFFVDGTMIRRID-QNGIISTLLGFNDLTS--ARPLSCDSVMDISQVRLEWPTDLAVSPMDNSLYVLDN-NVVLQIS-ENHQVRIVAGRPMHCQVPGLDHFLVSKVAIHATLESATALAASHNGILYIAESDDKKINRVRQVSTNGEISLVAGAPSGCDCKNDANCDCYSGDDGYAKDAKLNSPSSLAVSPNGELFIADLGNIRIRYVRRNKPYLNPLNMYEVSSPIDDELYLFDANGSHIYTQSLTTGDYLYNLTY---TGEGDLSTITDKNKN-KVTLRRDTTGLPLWIMSPDGQTFWFTIGTNNALKSVAA-------------------QGQELA--MMTYHGSSGLLATKSNEDGWTT-FYEYDSYG-------RLTNVT--YPTGRVSSYRTDADNAVRVQAEGSNKEDIIVTTNLSASGTFYTLM----QEQVKNSYYIG----LDGSLRLVLA------------NGME----VSLHTEP-----------HLLSGTVNPTVSKRNVTLPIDNGLNLVE-------WRQRKEQARGQVTVYGRRLRVHNRNLLSMDFDRITRTE--KVYDDHR-KFTLRIHYDLAGRPTLWAP---SSRLNGVNVTYSPGGHVAGIQRGTMSVRMEYDQNGRITSQIFADGKSWSYTYL----EKSMVLLLYSQ---RQYIFEFDKNDRLSSVTMPNVARQTLETTRSIGYYRNTYRPPEGNATVLQDYTE-DGLLLQTMHQGTGRRIIYKYGKLSRLLEILYDTTRVAFSYDEAAGMLKTV--SLQSEGFTCTIRYRQIGPLIDRQIFRF-----SEEGM-VNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDD--VSGKTEQFGKFGVIYYDINQIITTAVMTHTKHF-----DAYGRVKEVQYEIFRSLMYWMMVQYD----NMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRL----GDVQYRLDDDGFLRQRGN----DFFEYNSAGLL-----IRAYSKVGGWSIKYRYDGLSRRVSSRSSQ--GHHLQFFYADLSSPTRVTHMYNHSSSEITSLYYD-LQGHLFAMELSSGDEYYVACDNIGTPLAVFSGSGLMIKQILHTAFGEVYLDSNPSFQLVVGYQGGLYEPLTKLVHMGRRDYDV----LAG-RWTTPDHDIWKQLNDNNIVPF--NLYMF 2474          
BLAST of Teneurin-2 vs. Ensembl Cavefish
Match: tenm4 (teneurin transmembrane protein 4 [Source:NCBI gene;Acc:103031446])

HSP 1 Score: 610.912 bits (1574), Expect = 1.344e-176
Identity = 575/2205 (26.08%), Postives = 969/2205 (43.95%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWR----QVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL---------DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGS---AFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMD-LKE------TGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQ-IFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINP-----ELEKHKLLV---GESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHY-KQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISK-NSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNR-TSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEIN-IVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKIT-IEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSI-QYQYYEDGRLMSLKVNSGA---PVEY-IYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILK-RVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQW----FGLFTQLKNVKLNPFLLNSYQF 7990
            W  + F +H   + FN +++    +GI+ R    P+  ++   E + GR       Q L         RSL     S  TGF+ Y++ G+W L+V ND    E + F L T +     CP  C  +G C   G C CF GF+G DC +   P +CSG+G Y +G C C+  WKG EC     +C    CSG+G C+ G C+C  GY G+NC  + C    CS  GVC R G C CF GW    C   ++   D+ S    F  + G       C C   ++G  C   LC+  C      V G C C EG++G  C +R C SRC +HG C +G C C  GWNG+HCT+         +GCP  CN NG+C L +   +YC C   W+G  C+ S E+ C D  DND DGL DC DPDCC    C  T+         C    D   ++  T++S   S    F++++ FL  R  T               V+RG+V+ SDG+P  G  I        G+T T +DG FDLV  GG  + L   R P    T  + +++P + F       + D ++ +       P C        D S    P  L      ++P   T       + G +V  +  L+E      T ++L + SSR  G+KS L V L    +P NL +++L + V G+   +     P L+Y F WD+ + Y++ + GL+   V VG+ YE+C   I WE +  ++ G++  A ++G W+++  H  +   GI+++G+G ++F++Q    I  I G  G+ R +  C  C+G        +  A+     G + + D  YIR +   GN     ++           R  +         +H N+P  +   LA  P    +YLS++ S  ++ +       ++ K+  LV   G+ C    E  C      +   L +P+G+T+     +FF DG  I+ I   N  I T++G     +  +R   C S +  S+ RL+WPT +  + +D+S+Y +DN N+V ++  +N  V  VAG    C  P L+    + +AI         +  +  G L+IAE        V  V ++G +  V G                   D   K A   S +S+ ++  GEL +AD G  +I  V   K  +    +Y+V SP   ELY F++ G H  T S  TG  LY+L Y   +  G LS I   + N +  + RDT      + +P G  +  T+     + ++A                    Q  E+A    TY+  SG L +     G TT F E+  Y        +L N    +   R++S      N++      SN  +  +  N         L+    Q ++ N +       +D   ++ LA            NG++    +   TE            +++S +++ T+SK N  + +D    ++        ++   +++   ++   R  +++ +N L + +D  +R E   VY++ + K  ++  Y+   +     P    + L  + V Y+  G +  I+     + + YD   R TS I+    +  + Y+    E S  +   ++   ++Y   ++  D+  S+  PN    +++   SIGY R  Y+P   ++  + D+   +G L + ++     +I + Y   ++L  ++Y   R+ F   ++  +++ +  +    GF    ++   GPL+    +       S++ +  +++  Y+YD+  ++  +  ++ + P      R +   V     Q  ++    ++IN I+    + + K F     +  G++     ++  S +  + V YD    N   V + ++          + + Y  D  L + + +   + +Y Y  +G L  L   + A   P+ Y I D  T L    G V Y  +DDGFL Q+ N    + F YN+ GLL     + + SK+    ++Y YD   R +  R         Q+FY D  +  R+THMY+H+S +++S YY+   GHLF++ +     YYV  D +G+P  + S +  ++ +  +  FGE     + S  + +G+ G +++  + ++ M  R YD      AG +W      ++ QL +  + PF  N Y F
Sbjct:  473 WRSQVFIDHPMYLKFNVSLSKDALVGIYGRRGLPPSHTQFDFVELLDGRRLLAQGVQSLEGPPALTQPRSLMP-LSSHDTGFIQYMDSGIWHLAVYNDGKETEQVAF-LTTAIDSIDDCPSNCFGNGDCIA-GTCHCFLGFRGPDCGRASCPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDVTCSGHGTCIVGTCICNPGYKGENCEEVDCLDPTCSGRGVCVR-GECHCFVGWGGPGCESPRASCMDQCSGHGAFLADTG------TCSCDPNWTGHDCSTELCAADCGGHGVCVAGGCRCEEGWTGAGCDQRACHSRCSEHGTCKDGKCECSPGWNGEHCTIAHYLDKVVKEGCPGLCNGNGRCTLGNN-GWYCVCQLGWRGTGCDTSMETACSDAKDNDGDGLLDCMDPDCCLQASCHTTSL--------CVGSPDPLDIIQETQISSSPSNLQTFYQRVRFLVGRDSTHVIPGVNPFEGSHACVIRGQVVTSDGTPLVGVNISFINNPAYGYTITRQDGSFDLVSNGGVAIALRFERAP--FITQEHTLWLPWSRFF------VMDTIVMRHEVNDI-PSC--------DLSSFTRPSPL------VLPAPLTAFAGNCPERGGIVPEIQALQEEVRIPGTDVRLGYLSSRTAGYKSLLRVTLTHAIIPFNLMKVHLMVAVEGRLFRKWFSAAPNLSYDFVWDKTDVYSQKVHGLSEAFVSVGFEYESCPDLILWEKRTAILQGYETTASNLGGWSIDQHHALNIQSGILHKGNGENVFISQQPPVIGSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALACGSDGSLFVGDFNYIRRIFTTGNVTSVLEL-----------RNKDF--------RHSNSP-AHKYYLATSPVSGALYLSDTSSRKVFKVKSLNTVKDVAKNLELVAGTGDQCLPYDETRCGDGGKAVEATLTNPRGITVDKYGMIFFVDGTMIRRID-QNGIISTLLGFNDLTS--ARPLSCDSVMDISQVRLEWPTDLAVSPMDNSLYVLDN-NVVLQIS-ENHQVRIVAGRPMHCQVPGLDHFLVSKVAIHATLESATALAASHNGILYIAESDDKKINRVRQVSTNGEISLVAGAPSGCDCKNDANCDCYSGDDGYAKDAKLNSPSSLAVSPNGELFIADLGNIRIRYVRRNKPYLNPLNMYEVSSPIDDELYLFDANGSHIYTQSLTTGDYLYNLTY---TGEGDLSTITDKNKN-KVTLRRDTTGLPLWIMSPDGQTFWFTIGTNNALKSVAA-------------------QGQELA--MMTYHGSSGLLATKSNEDGWTT-FYEYDSYG-------RLTNVT--YPTGRVSSYRTDADNAVRVQAEGSNKEDIIVTTNLSASGTFYTLM----QEQVKNSYYIG----LDGSLRLVLA------------NGME----VSLHTEP-----------HLLSGTVNPTVSKRNVTLPIDNGLNLVE-------WRQRKEQARGQVTVYGRRLRVHNRNLLSMDFDRITRTE--KVYDDHR-KFTLRIHYDLAGRPTLWAP---SSRLNGVNVTYSPGGHVAGIQRGTMSVRMEYDQNGRITSQIFADGKSWSYTYL----EKSMVLLLYSQ---RQYIFEFDKNDRLSSVTMPNVARQTLETTRSIGYYRNTYRPPEGNATVLQDYTE-DGLLLQTMHQGTGRRIIYKYGKLSRLLEILYDTTRVAFSYDEAAGMLKTV--SLQSEGFTCTIRYRQIGPLIDRQIFRF-----SEEGM-VNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDD--VSGKTEQFGKFGVIYYDINQIITTAVMTHTKHF-----DAYGRVKEVQYEIFRSLMYWMMVQYD----NMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRL----GDVQYRLDDDGFLRQRGN----DFFEYNSAGLL-----IRAYSKVGGWSIKYRYDGLSRRVSSRSSQ--GHHLQFFYADLSSPTRVTHMYNHSSSEITSLYYD-LQGHLFAMELSSGDEYYVACDNIGTPLAVFSGSGLMIKQILHTAFGEVYLDSNPSFQLVVGYQGGLYEPLTKLVHMGRRDYDV----LAG-RWTTPDHDIWKQLNDNNIVPF--NLYMF 2475          
BLAST of Teneurin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001302.1 (pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 gene:ENSPMAG00000001162.1 transcript:ENSPMAT00000001302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 488.034 bits (1255), Expect = 2.046e-139
Identity = 378/1319 (28.66%), Postives = 588/1319 (44.58%), Query Frame = 2
Query: 1706 FNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCP-SNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLD---------GCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTKSLNQ---KKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELK---------DLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINP-ISGQLGKPRMAN-GCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPK---IYLSESLSGSIWVI--------NPELEKHKLL-VGESC---KERTC------IRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSE-TVLAIRHK-FSDIRDIEINPLGELFIA---EKRT--VWIVKSDGYLYKVEG-------------------DAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHY-KQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKF-QYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            FN +I+   +LG + R   +PT  +   F  +            +G R+ R+          GF  +L+ G+W L++ ND   +E++    N        CP  C+ +GVC   G C C  GF    CS+   P +CSGHG Y +G C C+  WKG EC    ++C  P C G+G C++G CVC  GY+G++C  ++CP   CS  GVC  +G C C  GW    C  RK       S   L   ELNT   C C   ++G  C   LC   C  +G C + G+C C EG+ G+ C ++ C   C +HG C +G C C +GWNG+HC++          GCP  C+ NG+C+L     + C C+P W+G  C+ S E+ C DG DND DGL DC DPDCC    C   +  Q   +     + +  +  L+     P + F+E++ FL    +     N    +   VVRG V  S+G P  G  I       +G+T T +DG FDL+  GG    L   R P    T    +++P + FV +    ++         D+      S    P          + S    P I A    DII +  +D                     L+L++ SSR  G+KS L ++L    +P NL +++L + V G+         P L +TF WD  +AY + + G A   V VGY YE C + + WE +  V+    + +  +G W L+N H+FD +   V++G G  + +    WQ+ P IS  +G  R  +  C  C+G  +     +   +     G + + D  ++R +  +GN    +++           R  +         +H  NP  +   LA +P    +YLS++ S  I+ +        +P L    +   GE C    E  C      +   L +P+G+ +     +FF DG  I+ I   N  I TV+G     A  S    C S +  S+ RL+WPT++  + +D+S+Y +DN N+V ++  D+  V    G    CP   +     + A RH        + ++  G L+I+   EKR   VW V SDG +  + G                   +   K A   S T++ +     L +AD G  +I +V   + A   +  Y++ SP  +E+Y F+  G H RT S ++G  LYS  Y   S    L  + S SG    ++ RD+     ++     +   +TL+    +  +A P +   F  Y+    L++  +S E     F  Y  +GRL +V  P+GV +
Sbjct:   47 FNISIDLDAALGFYGRKGLLPTHTQQYDFVEVL-----------DGKRLGRARRSATSGPHAGFTQFLQAGVWHLALYNDGADKEHVALAANVAADAVGGCPGGCHGNGVCLA-GICHCNQGFLPPHCSRASCPVLCSGHGQYVRGRCLCHSGWKGAECDIPAWQCTNPACGGHGSCITGVCVCNSGYTGESCEEVMCPHPTCSGKGVCV-HGTCICLSGWGGPSCETRKPMCAEQCSGHGLYLSELNT---CSCDARFTGADCSTELCPVDCGAHGVC-IGGSCHCQEGWGGETCDQKACHRHCAEHGACRDGKCECSQGWNGEHCSVGKVTANCCQKGCPAMCSGNGECRLAQG-SWLCVCVPGWRGPGCDTSMETNCGDGEDNDGDGLADCVDPDCCGLPACQAHSLCQGSPDPRA-LLPEPPMASLSRPPPGPAATFYERMRFLLGTTHLIPGGNPFLGRSAVVVRGVVQTSEGFPLVGVNITFLNAPQHGYTLTRQDGSFDLMASGGVASTLRFERPPFP--TQLRTLWLPWDHFVVMETVVMRREENEIPTCDVSGLPRPSPLLLPSLLPSGPGACEPSGTIVPEIQA--VQDIIALPGSD---------------------LQLVYLSSRAVGYKSLLTIILTPASIPFNLLKVHLTVAVEGRLFHTWFPATPGLRHTFQWDSTDAYGQPVTGHAQALVSVGYEYEPCPALVIWERRSAVLLALTVDSARLGGWTLSNHHVFDVHSSTVHKGSGESVLV----WQLPPVISSVMGNGRRRSISCPSCNGVAEGNKLLAPMGLACAPDGSLYVGDFNFVRRILPSGNVTSVFEL-----------RNKDF--------RHSTNPT-HRYYLAVDPVSGWLYLSDTSSRKIYRVRSAAGDGADPVLGGEVVAGTGEQCLPLDETRCGDGGRALNASLANPRGIAVDKHGYIFFVDGSMIRKID-ENEIISTVMGFNDLQAGLSL--SCDSTMEMSKIRLEWPTALTISPLDNSLYILDN-NVVLQVTEDH-QVRVAVGRPVHCPFHSTEQPWPIRAARHATLQAPTALAVSHAGVLYISETDEKRIHQVWQVSSDGEMSLLAGATVDCDCNGDLSCDCFAGEEGYAKDARLNSPTALAVCPDATLYIADLGNIRIRAVRQNRPATVADGKYEIASPADQEVYVFSEEGLHLRTQSLVSGDVLYSFSY---SAERELLGVSSSSGRTA-RIRRDSGGAPLRIVLDDSLYLTLTLNVNGALKGVAAPGAELAFLTYHGSSGLLAT-RSDENGWTTFYTYDGTGRLTNVTSPTGVVS 1287          

HSP 2 Score: 151.754 bits (382), Expect = 1.652e-36
Identity = 166/742 (22.37%), Postives = 314/742 (42.32%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISF------DSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFI---FEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSM-EILNF-RFSYYKDSSLILNAYS-ADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQL-KNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKP-EFWLEKIGINTETMVTTKP 8110
            R  ++NG+N L + +D  +R E   +Y++ + K  ++ +Y         +P  ++T    L V Y+  G +  ++W   +   +YD+L R  +   A     + Y Y       K   +   + ++Y   +++ D+  S+  P+    ++  + SIGY R +Y P   +++   DF S +G L +  +     ++ + Y+  ++L  V+Y    + F   D+  +++ +    + F   +  +F   GPL+            ++ I+ F      +++  YS+DS  +I  + +++ + P      + + I     + ++ Q+ +F    F+I+                      QI+T       + +T+   +D   +  L    Y++ RS     +LN+          L +  Y+    + Y+Y  DG+L S+ +N+    +Y YD N  L                     +   G + Y  +DDGFL Q+ +    E F YN+ GLL +     S       V+Y YD   R +  +   + +Q  QYFY D  N  R+THMY+H + ++ + YY+   GHLFS+ ++    YYV +D +G+P  +  +   +V    Y  +GE  S  +    +PIGF G ++D  + ++    + YD  +      +W     +L K V   P   N Y F        V+   D  ++      WL+  G     +V   P
Sbjct: 1404 RKLRVNGRNILSIDFDRETRTE--KIYDDHR-KFQLRVVYGLLGLPSLWLPGDKLT---ALNVTYSERGRVAGLQWGSMVEHDHYDSLGRVVTRVFA-DGKTWSYTY-----LEKSMVLLLQSQRQYIFEFDAADRLVSVTMPSVARHTLGTVRSIGYYRNVYLPPESNASVFQDF-SEDGLLLQTAFMGTGRRVLYKYAKQSRLSEVLYDGTHVTFSHDDATGMLKLVNLQDSTFTSAI--RFRLVGPLL------------NRQIVRFGEEGMVNARFDYSFDSVFRIASMQVVINETPLPIDLYQYDDI-----SGKVEQFGKFAVIYFDIH----------------------QIIT------TAAMTLTKHFDSFGR--LKEVQYEVYRSLMFWMVLNYDAMGRVAKCELKIGPYANTTKLAYEYDTDGQLHSVSINNRQSWKYSYDLNGNLHLLNPGNSARLTPLRYDLRDRVSRLGDMRYVVDDDGFLRQRGS----ELFEYNSNGLLMQVYSKASGWS----VQYRYDGLGRRVSRK--TNFRQHLQYFYADLANPGRVTHMYNHTNSEIITLYYD-LQGHLFSVELNSGDEYYVATDGMGTPLAVFDNAGQVVRYLQYTAYGEIYSDSNPDFQLPIGFHGGLYDPLTMLVHFGWKDYDVLTG-----RWTSPEIELWKEVSAQPKPFNLYMFQ---NNNPVSVGRDAHRYVTDVNSWLQTFGFQLHNVVAGYP 2064          
BLAST of Teneurin-2 vs. Ensembl Sea Lamprey
Match: VWDE (von Willebrand factor D and EGF domains [Source:HGNC Symbol;Acc:HGNC:21897])

HSP 1 Score: 133.65 bits (335), Expect = 3.998e-31
Identity = 94/312 (30.13%), Postives = 136/312 (43.59%), Query Frame = 2
Query: 1877 FSESTGFVHYLEKGLWFLSVINDQ---PREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQG-TCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGE-CVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYN-GYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGN-CICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCN 2791
             + ST  VH L      +SV++     PR  +       +      C   C K+  C+    C C  G+ G +C        C   G   +   C C   +KG  C+ +  EC  P C   G C++   C C +GY G  C T++C  +C   G C     CRC  GW+   C        +  S  CLN G      VC+CP G+ G +C   +CS  C N G+C  N  C   EG++G++C K +C+  C   G+C+  N C C  G+ GK C    C + C N G+C   ++    C C   W+G+ C 
Sbjct: 1263 LTASTQIVHTLTSPP-LVSVLSPSVLDPRRNSRNLYDRVRAVATALCRYACGKNMECSAPNTCRCKPGYTGYNCLIAVCRPDCKNQGKCVRPDVCECPLGYKGPICEEV--ECT-PTCQNAGACIARNLCSCPYGYLGPRCETMVCNRHCENGGECVSPDVCRCSPGWDGPTCGS------AVCSPVCLNGGACVRPGVCLCPHGFFGAQCHNAICSPPCKNGGHCMRNNICSKGEGYTGRRCQKSVCEPTCMNSGKCVGPNVCSCPSGFKGKRCNRPVCLQKCKNGGECIGPNS----CHCPEGWEGMHCQ 1560          

HSP 2 Score: 90.5077 bits (223), Expect = 4.997e-18
Identity = 65/237 (27.43%), Postives = 90/237 (37.97%), Query Frame = 2
Query: 2006 CPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGN-YFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCV-SGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNG---------------------------------YCSVNGTCICNEGFSGKQCGKRICDSR 2611
            C   C   G C     C C  G+ G  C  +   + C   G       C C+P W G  C +       P C   G CV  G C+C HG+ G  C   +C   C   G C RN  C   +G+  + C K   +        C+N+G+    +VC CP G+ G++C + +C  KC NG                                  C+    C C  GFSG  CG+R+ + R
Sbjct: 1372 CTPTCQNAGACIARNLCSCPYGYLGPRCETMVCNRHCENGGECVSPDVCRCSPGWDGPTCGSAVCS---PVCLNGGACVRPGVCLCPHGFFGAQCHNAICSPPCKNGGHCMRNNICSKGEGYTGRRCQKSVCEPT------CMNSGKCVGPNVCSCPSGFKGKRCNRPVCLQKCKNGGECIGPNSCHCPEGWEGMHCQNPVCQQTCKFGGRCTAPNACSCRPGFSGFACGRRVRERR 1599          

HSP 3 Score: 80.8777 bits (198), Expect = 4.793e-15
Identity = 73/266 (27.44%), Postives = 95/266 (35.71%), Query Frame = 2
Query: 2051 KCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSG----ECVCKHGYSG-----------------------------------KNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYN-GYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGN-CICRKGWNGKHCTLDGCPKNCNNNGQC 2725
             C+C  G  G   + V  P    G G Y    C C   + G  C  +   C    C G G CV+G     C+C  G +                                    +  +T LC   C +N  C     CRC  G+   +C              C N G+    DVC CPLGY G  CE+  C+  C N G C     C C  G+ G +C   +C+  C   G C+  + C C  GW+G  C    C   C N G C
Sbjct: 1196 PCECVNG--GTCVTNVGRPP---GSGEYL---CVCGAGYTGPRCAGLVDGCAAAPC-GPGTCVAGVRNFSCLCPAGLTASTQIVHTLTSPPLVSVLSPSVLDPRRNSRNLYDRVRAVATALCRYACGKNMECSAPNTCRCKPGYTGYNCLIAVCRPD------CKNQGKCVRPDVCECPLGYKGPICEEVECTPTCQNAGACIARNLCSCPYGYLGPRCETMVCNRHCENGGECVSPDVCRCSPGWDGPTCGSAVCSPVCLNGGAC 1446          
BLAST of Teneurin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009276.1 (pep scaffold:Pmarinus_7.0:GL476916:212692:218299:-1 gene:ENSPMAG00000008391.1 transcript:ENSPMAT00000009276.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.237e-16
Identity = 56/157 (35.67%), Postives = 73/157 (46.50%), Query Frame = 2
Query: 2405 SARSNFCLNNGELNTKDVCMCPLGYSGEKCE--KRLCSGKCYNG-YCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGN-CICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISC-NISKESKCDDGVDNDNDGLTDCQD 2860
            +A    CLN G      VC CP G+ G  C+    +CS  C NG +C  N  C C EG+ GK+C + +CD  C   G+C+  N C C  GW GK C    C + C N G+C         C C P W+G  C N +  +KC  G       L  C+ 
Sbjct:    2 AACHPVCLNGGTCVRPHVCACPQGFFGPYCQNATAICSPACKNGGHCMRNNVCSCPEGYMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQKCKNGGEC----IRPNTCLCPPGWEGAQCQNPTCHTKCQFGSKCVQPNLCACRP 154          

HSP 2 Score: 72.0182 bits (175), Expect = 2.578e-14
Identity = 53/163 (32.52%), Postives = 72/163 (44.17%), Query Frame = 2
Query: 2309 CSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYN-GYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGN-CICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCN 2791
            C   G C R   C C QG+    C     +  +  S  C N G     +VC CP GY G++C++ +C   C N G C     C C  G+ GK+C K +C  +C   G CI  N C+C  GW G  C    C   C    +C         C+C P + G+ C+
Sbjct:    8 CLNGGTCVRPHVCACPQGFFGPYC----QNATAICSPACKNGGHCMRNNVCSCPEGYMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQKCKNGGECIRPNTCLCPPGWEGAQCQNPTCHTKCQFGSKC----VQPNLCACRPGFAGLVCH 162          

HSP 3 Score: 65.4698 bits (158), Expect = 5.020e-12
Identity = 48/154 (31.17%), Postives = 65/154 (42.21%), Query Frame = 2
Query: 2144 TCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGE-CVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKC-YNGYCSVNGTCICNEGFSGKQCGKRI 2599
             C C   + G  CQ     C  P C   G C+    C C  GY GK C   +C   C   G C     C C  GW+ K C+K    ++      C N GE    + C+CP G+ G +C+   C  KC +   C     C C  GF+G  C +++
Sbjct:   19 VCACPQGFFGPYCQNATAICS-PACKNGGHCMRNNVCSCPEGYMGKRCQESVCDPTCLNGGKCVGPNICSCPSGWKGKKCNKPMCLQK------CKNGGECIRPNTCLCPPGWEGAQCQNPTCHTKCQFGSKCVQPNLCACRPGFAGLVCHRKV 165          
BLAST of Teneurin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009665.1 (pep scaffold:Pmarinus_7.0:GL480729:2444:4403:-1 gene:ENSPMAG00000008736.1 transcript:ENSPMAT00000009665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 6.771e-16
Identity = 44/127 (34.65%), Postives = 63/127 (49.61%), Query Frame = 2
Query: 2345 CRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQC 2725
            C C +GW  K CS+            C++        VC C  G+SG  C +  C   C N    V+G C+C  GF+G  C +  C + C   GRC++G C+C +G++G+ C    CP NCN  G+C
Sbjct:  133 CVCDKGWTGKACSQPACPSDCGGRGTCVDG-------VCDCEDGFSGPDCGQAACLNDCSNRGVCVSGGCVCERGFAGTDCSQPGCPNDCNGRGRCVDGKCLCARGFSGEDCRESRCPNNCNGRGRC 252          

HSP 2 Score: 77.411 bits (189), Expect = 2.888e-15
Identity = 49/132 (37.12%), Postives = 64/132 (48.48%), Query Frame = 2
Query: 1985 KMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDC 2380
            K   +  CP  C   G C + G CDC  GF G DC +      CS  G    G C C   + G +C          DC+G G CV G+C+C  G+SG++C    CP+NC+  G C  NG C C +G+   DC
Sbjct:  142 KACSQPACPSDCGGRGTCVD-GVCDCEDGFSGPDCGQAACLNDCSNRGVCVSGGCVCERGFAGTDCSQPGCP---NDCNGRGRCVDGKCLCARGFSGEDCRESRCPNNCNGRGRCV-NGRCVCQRGYGGSDC 268          

HSP 3 Score: 77.0258 bits (188), Expect = 3.682e-15
Identity = 55/160 (34.38%), Postives = 75/160 (46.88%), Query Frame = 2
Query: 2018 CNKHGV-CTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKC 2494
            CN HG   TE   C C  G+ G+ CS+   P  C G G    G C C   + G +C          DCS  G CVSG CVC+ G++G +CS   CP++C+  G C  +G C C +G+  +DC + +          C+N         C+C  GY G  C
Sbjct:  120 CNGHGTFSTESCGCVCDKGWTGKACSQPACPSDCGGRGTCVDGVCDCEDGFSGPDCGQAAC---LNDCSNRGVCVSGGCVCERGFAGTDCSQPGCPNDCNGRGRCV-DGKCLCARGFSGEDCRESRCPNNCNGRGRCVNG-------RCVCQRGYGGSDC 268          
BLAST of Teneurin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000962.1 (pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 gene:ENSPMAG00000000874.1 transcript:ENSPMAT00000000962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 1.184e-14
Identity = 80/255 (31.37%), Postives = 118/255 (46.27%), Query Frame = 2
Query: 2147 CTCNPEWKGKECQTIWYECEYPDCSGNGDCV----SGECVCKHGYSGKNCSTLL--CPSNCSENGV----CQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKR-LCSGKC-YNGYCSVNG----TCICNEGFSGKQCGKRICD---SRCYKHGRCIEG----NCICRKGWNGKHCTLDG---CPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDND 2833
            CTC P + G+ CQ    EC    C  NG C     S  C+C  G+SG  C   +  C  N  +NG        + FC C + +E K+CS+ +   +++              D C   +  +  +   R + SG C  +G C   G    TC C+EGF+G  C + I D   + C   G CI+G     CIC +GW G  C +D     P  C N G+C+ +   ++YC C   WKG +C+ S+E +CD+   N+
Sbjct:  232 CTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTS-------TWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCR-DLVNDFYCECRNGWKGKTCH-SRERQCDEATCNN 477          

HSP 2 Score: 65.0846 bits (157), Expect = 2.213e-10
Identity = 65/226 (28.76%), Postives = 90/226 (39.82%), Query Frame = 2
Query: 2111 VCSGHGNYF-QG----TCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSG----ECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCR---------CFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCE----KRLCSGKCYNGYCSVNG----TCICNEGFSGKQCGKRICDSR---CYKHGRCIEGN----CICRKGWNGKHCTLD 2689
            VC  HG    QG    TC+C+  + G  C     +C    C   G C+ G    +C+C  G+ G  C      ++CS N +CQ  G CR         C  GW+ K C  R+     A  N      +      C+CP+G+ G  C         S  C N    V      TC+C EG+ G  C +   D     CY  G C++G     C C  G+ G  C ++
Sbjct:  359 VCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDT--NDCSPN-LCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRIN 581          
BLAST of Teneurin-2 vs. Ensembl Nematostella
Match: EDO48042 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKS8])

HSP 1 Score: 88.9669 bits (219), Expect = 3.130e-19
Identity = 78/236 (33.05%), Postives = 110/236 (46.61%), Query Frame = 2
Query: 2006 CPDFCNKHGVC-TEFGKCDCFTGFKGQDCSKVDF-PKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGE--CVCKHGYSGKNCSTL-LCPSNCSENGVCQRNGFCRC--FQGWESKDCSKRKSDKQSARSNFCLNNGELNTKD-VCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCI-CRKGWNGKHCTL 2686
            CP+ C+ HGVC +    C C  G++G DCS++D     CSGHG    G C C   W+G  C          DCSG+G+C S    CVC++G++G  C     C   CS +G C  NG C C    GW    C          +   C  +G  ++ +  C+C  G+ G  C      G+       V G+C+C+  ++G  C    C+  C  HG+C +G C  C  GW GK C +
Sbjct:    2 CPNDCSGHGVCNSALRTCYCDPGWRGLDCSQLDCCDSECSGHGKVSVGICKCFRGWRGTYCDNPGCPGHRTDCSGHGECNSATHVCVCENGWTGDGCEIPDCCNVECSGHGQC-VNGACACDTLAGWRGSLCEVPGCAGVDGKD--CSGHGTCDSANHKCICDPGWMGPACNDPCVHGR------EVAGSCVCDPCYTGSGCQSDGCNEECSGHGKCEDGKCCQCSPGWTGKACDI 228          

HSP 2 Score: 72.0182 bits (175), Expect = 1.622e-13
Identity = 78/245 (31.84%), Postives = 111/245 (45.31%), Query Frame = 2
Query: 2099 DFPKVCSGHG--NYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCP---SNCSENGVC-QRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGE-LNTKDVCMCPLGYSGEKCEKRLCSG----KCY-NGYC-SVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNI 2794
            + P  CSGHG  N    TC C+P W+G +C  +  +C   +CSG+G    G C C  G+ G  C    CP   ++CS +G C      C C  GW    C     +     +  C  +G+ +N    C    G+ G  CE   C+G     C  +G C S N  CIC+ G+ G  C           HGR + G+C+C   + G  C  DGC + C+ +G+C+        C C P W G +C+I
Sbjct:    1 ECPNDCSGHGVCNSALRTCYCDPGWRGLDCSQL--DCCDSECSGHGKVSVGICKCFRGWRGTYCDNPGCPGHRTDCSGHGECNSATHVCVCENGWTGDGC-----EIPDCCNVECSGHGQCVNGACACDTLAGWRGSLCEVPGCAGVDGKDCSGHGTCDSANHKCICDPGWMGPACNDPC------VHGREVAGSCVCDPCYTGSGCQSDGCNEECSGHGKCEDGKC----CQCSPGWTGKACDI 228          

HSP 3 Score: 61.2326 bits (147), Expect = 7.548e-10
Identity = 72/248 (29.03%), Postives = 99/248 (39.92%), Query Frame = 2
Query: 2213 DCSGNGDCVSG--ECVCKHGYSGKNCSTL-LCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTK-DVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICR--KGWNGKHCTLDGCP----KNCNNNGQCKLNHAMEYYCSCLPIWKGISCN--------ISKESKCD----------DGVDNDNDGLTDCQDPDCC 2872
            DCSG+G C S    C C  G+ G +CS L  C S CS +G     G C+CF+GW    C              C  +GE N+   VC+C  G++G+ CE   C                              C+  C  HG+C+ G C C    GW G  C + GC     K+C+ +G C    +  + C C P W G +CN        ++    CD          DG + +  G   C+D  CC
Sbjct:    5 DCSGHGVCNSALRTCYCDPGWRGLDCSQLDCCDSECSGHGK-VSVGICKCFRGWRGTYCDNPGC---PGHRTDCSGHGECNSATHVCVCENGWTGDGCEIPDC------------------------------CNVECSGHGQCVNGACACDTLAGWRGSLCEVPGCAGVDGKDCSGHGTCD---SANHKCICDPGWMGPACNDPCVHGREVAGSCVCDPCYTGSGCQSDGCNEECSGHGKCEDGKCC 215          
BLAST of Teneurin-2 vs. Ensembl Nematostella
Match: EDO41382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F4])

HSP 1 Score: 79.337 bits (194), Expect = 2.491e-15
Identity = 91/303 (30.03%), Postives = 126/303 (41.58%), Query Frame = 2
Query: 2012 DFCNKHGVCTEFG---KCDCFTGFKGQDCSK---------VDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEY-PDCSGNGDCVSG----ECVCKHGYSGKNCSTLL--CPSN-CSENGVCQRNGF---CRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKD---VCMCPLGYSGEKCEKRL---CSGKCYNGYCSVNG----TCICNEGFSGKQCGKRI---CDSRCYKHGRCI----EGNCICRKGWNGKHCT--LDGCPKN-CNNNGQCKLNHAMEYYCSCLPIWKGISCN 2791
            D C   G CT +     C C TG+KG  CS+           +   C      +Q  C C  +W+G  C T   EC   P C   G C +      C C  G+ GKNC   L  C +N C   G C        C C QGW  K+C +   D     +N C N G     D    C C  G++G  C++ +    +  C NG    N     TC C   ++G  C + +    ++ C   G C     + +C C +GW GK C   L+ C  N C + G C  N A +Y C+C+  W G +C+
Sbjct:   15 DLCAHGGTCTNYPGSYSCACVTGWKGTHCSQDADECALKPCAYGGSCVNTMGSYQ--CLCTAQWQGPTCTTDVNECAASPPCVNGGSCTNTAGDYHCACVQGWMGKNCGQDLNECLNNPCVHGGTCTNTAGDYRCACVQGWTGKNCDQ---DVDECVANPCANQGTCYNNDGSYTCACVAGWTGLNCDQDVNECATDPCDNGGTCANTDGSYTCTCTAAWTGPTCKQDVNECLNNPCVYGGTCTNTVGDYSCACVQGWTGKDCDQDLNECLNNPCAHGGTCN-NTAGDYRCACVQGWTGKNCD 311          
BLAST of Teneurin-2 vs. Ensembl Nematostella
Match: EDO34441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPB2])

HSP 1 Score: 73.9442 bits (180), Expect = 3.674e-13
Identity = 93/307 (30.29%), Postives = 130/307 (42.35%), Query Frame = 2
Query: 2054 CDCFTGFKGQDC-SKVD--FPKVCSGHGNYFQG----TCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSG----ECVCKHGYSGKNCSTLL--CPSNCSENGVCQRNG----FCRCFQGWESKDCSKRKSDKQSA---RSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCY-------------NGYCSVNGTCI----------CNEGFSGKQCGKRICD---SRCYKHGRCIEG----NCICRKGWNGKHC--TLDGCPKN-CNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCD 2815
            C C   F G +C S V+      C+ +G   QG     C+C   + G  C+    ECE   C  +G CV G    +C C  G++GK C T L  C  +   NG    NG     C C  G+    C    ++  S        C++  E+N    C+CP G  G  CE+ + S K                G C  +GTCI          C+EG++G  C   I D     C     C++G     CICR GW G  C   ++ C  + CNN G C  +   ++ C+C P WKG +C  S  S+C+
Sbjct:  114 CSCRPEFTGVECESPVNKCSSNPCTNNGTCIQGLGIFMCSCPAGFTGPRCEADINECESDPCLNSGTCVDGVASFQCKCPVGFTGKRCETKLNHCIGHVCANGATCMNGKDKAVCICESGFVGTHCDVNVNECNSMPCQHGGTCID--EVNNFR-CLCPTGTRGHFCEQVIDSCKIAVSFNGTSATKIVDTGVCGAHGTCINIQGGDFRCACDEGYTGNHCHIDIDDCIGHECGNGATCVDGISSYQCICRDGWEGPFCKTNINECKSSPCNNGGNCT-DLVNDFVCTCAPPWKGKAC-TSVASQCE 415          

HSP 2 Score: 57.7658 bits (138), Expect = 4.719e-8
Identity = 62/217 (28.57%), Postives = 91/217 (41.94%), Query Frame = 2
Query: 2138 QGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSG----ECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKR--------KSDKQSARSNFCLNNGELNTKD---VCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCI---------CNEGFSGKQCGKRICDSRCYKH-----GRCIEGN----CICRKGWNGKHCTLD 2689
            Q  C C+P + G  C+T   +C    C  +  C+      EC C  GY+G NC   +  ++C     CQ  G   C        CS R        +S      SN C NNG         +C CP G++G +CE  +   +C +  C  +GTC+         C  GF+GK+C  ++  + C  H       C+ G     CIC  G+ G HC ++
Sbjct:   34 QHRCQCHPGYTGINCETRKDDCASSPCENSATCIDRVDDYECRCAPGYTGVNCDHNI--NDCGRLNPCQNGG--SCIDKLNGYVCSCRPEFTGVECESPVNKCSSNPCTNNGTCIQGLGIFMCSCPAGFTGPRCEADI--NECESDPCLNSGTCVDGVASFQCKCPVGFTGKRCETKL--NHCIGHVCANGATCMNGKDKAVCICESGFVGTHCDVN 242          
BLAST of Teneurin-2 vs. Ensembl Nematostella
Match: EDO28379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6M6])

HSP 1 Score: 72.7886 bits (177), Expect = 3.813e-13
Identity = 81/269 (30.11%), Postives = 113/269 (42.01%), Query Frame = 2
Query: 2081 QDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSG---NGDCVSGECVCKHGY--SGKNCSTLLCPSNCSENGV---CQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNG---ELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTC-----------ICNEGFSGKQC-GKRICDSRCYKHGRCIEG------NCICRKGWNGKHCTLDGC-PKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNIS 2797
             +C K D   +C        G C C   + G       YECE  +C G   N  C+ G CVC   Y  +G NC   L P  C + G+        FC C + +  KDC +R        S  CLN G   E+     C CP G+ G  CE+R     C+   C   GTC           +C EGF+G+ C G   CD    K+G   +        C+C   + G  C +  C P  C++ G+C++  +  + C C P++KG  C I 
Sbjct:    1 MECEKCDINAIC------VHGRCKCRAGYIGN-----GYECEKEECDGCNPNAHCLKGVCVCFDHYIGNGYNCQHHLNP--CQDGGIYVSMAHGYFCICPKDYRGKDCQER----NYCSSMPCLNGGSCVEIPGAFKCGCPFGFLGTVCEER---DACHPNPCKNGGTCTRSDTESGFVCVCKEGFTGEHCEGFNRCDPNPCKNGATCQQIKDDKYECLCPPPYKGTLCAVHVCHPNPCHHGGRCEVE-SGHFKCVCPPLYKGYQCEIP 248          
BLAST of Teneurin-2 vs. Ensembl Nematostella
Match: EDO46243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW9])

HSP 1 Score: 73.9442 bits (180), Expect = 6.797e-13
Identity = 94/283 (33.22%), Postives = 128/283 (45.23%), Query Frame = 2
Query: 2054 CDCFTGFKGQDC-SKVDF--------PKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDC---VSG-ECVCKHGYSGKNCSTLL--CPSNCSENGVC---QRNGF-CRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKD---VCMCPLGYSGEKCEKRL---CSGKCYNGY-CS--VNG-TCICNEGFSGKQCGKRI--CDSRCYKHGRC----IEG-NCICRKGWNGKHC--TLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISC 2788
            C C  GF G+DC +++D            C+   N F  TCTC P + GK+C T   EC    C     C   ++G  C CK G++GK+C T +  C SN  +NG     + NGF C C  G+  KDC    ++     SN C N      +     C C  G++G+ C   +    S  C NG  C+  +NG  C C  GF+GK CG  I  C S   K+G      I G  C C+ G+ GK C   +D C  N   NG    +    + C+C P + G  C
Sbjct:   28 CTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGF--TCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCG---TEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDC 305          

HSP 2 Score: 73.1738 bits (178), Expect = 1.133e-12
Identity = 93/283 (32.86%), Postives = 127/283 (44.88%), Query Frame = 2
Query: 2054 CDCFTGFKGQDC-SKVDF--------PKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDC---VSG-ECVCKHGYSGKNCSTLL--CPSNCSENGVC---QRNGF-CRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKD---VCMCPLGYSGEKCEKRL---CSGKCYNGY-CS--VNG-TCICNEGFSGKQCGKRI--CDSRCYKHGRC----IEG-NCICRKGWNGKHC--TLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISC 2788
            C C  GF G+DC +++D            C+   N F   CTC P + GK+C T   EC    C     C   ++G  C CK G++GK+C T +  C SN  +NG     + NGF C C  G+  KDC    ++     SN C N      +     C C  G++G+ C   +    S  C NG  C+  +NG  C C  GF+GK CG  I  C S   K+G      I G  C C+ G+ GK C   +D C  N   NG    +    + C+C P + G  C
Sbjct:  294 CTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFA--CTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCG---TEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDC 571          

HSP 3 Score: 69.707 bits (169), Expect = 1.643e-11
Identity = 93/290 (32.07%), Postives = 127/290 (43.79%), Query Frame = 2
Query: 2054 CDCFTGFKGQDC-SKVDF--------PKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDC---VSG-ECVCKHGYSGKNCSTLL--CPSNCSENGVC---QRNGF-CRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKD---VCMCPLGYSGEKCEKRL---CSGKCYNGY-CS------VNGT-CICNEGFSGKQCGKRI---CDSRCYKHGRCIEG----NCICRKGWNGKHCTLD--GCPKN-CNNNGQCKLNHAMEYYCSCLPIWKGISCNI 2794
            C C  GF G+DC +++D            C+   N F   CTC P + GK+C T   EC    C     C   ++G  C CK G++GK+C T +  C SN  +NG     + NGF C C  G+  KDC    ++     SN C N      +     C C  G++G+ C   +    S  C NG  C+      +NG  C C  GFSG  C   I     S C   G C +      C C  G+ G  C +D   C  + C N G C  +    + CSC P + GI+C+I
Sbjct:  408 CTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFA--CTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCG---TEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINDLINGYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFC-TDMINAFTCSCPPGYTGITCDI 691          
BLAST of Teneurin-2 vs. Ensembl Medaka
Match: si:dkey-34l15.2 (teneurin transmembrane protein 2 [Source:NCBI gene;Acc:101165320])

HSP 1 Score: 532.332 bits (1370), Expect = 4.793e-152
Identity = 387/1338 (28.92%), Postives = 613/1338 (45.81%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSD------IIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLL---------VGESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDG---YLYKVEGDAQTK-----------------PAFKSITSITITMFGELIVADNGKKQIFSVHYKQ--------AIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRD------TQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W    + +    + FN ++      G+++R    P+  +Y + ER+ G+    V+      R +RS+     +E+  FV YL+ G W L+  ND    E++ F+ N  M   Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P CSG+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+DGCP  CN NGQC +     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C  +          C    D   ++  + +S+P   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG+FDL+  GG+ + L   R P    +    V++P ++F  +      D L+ K     T PGC        D  VI  P  L+ + S       IIP           +  VL   +++  T LKL + SSR +G++S L V +    V   L +++L + V G    +     P L +T+ WD+ +AY + ++GL+   V VGY YE+C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G ++F+T+    I  I G  G+ R +  C  C+G        +  A+     G + + D  ++R +  + N  G  ++           R  +         +H NNP  +   +A +P    +++S++ S  I+ +   L   +LL          GE C    ER           L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C + +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I ++  G L+IAE        V  V ++G    L  V  D   K                     S TS+ ++  G L +AD    +I +V   +            +  Y+V SP  +ELY FN  G H +T S +TG  L++  Y     +G L+ +V    N   KV RD             +  P      + LD    + ++ AM        Y+    L++  ++ E     F  Y   GRL ++  P+G+ T
Sbjct:  330 WRALLYLSQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV---ESPRERRSIQTVVLNEAV-FVQYLDAGAWHLAFYNDGRERESVSFSTNI-MDSVQECPRNCHGNGECNS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCVCYSGWKGPECDVPVTQCIDPLCSGHGTCTDGNCVCSIGYKGQNCAEVDCLDPTCSNNGICV-NGECHCKPGWGGLHCELPRAQCPDQCHGHGAFIPDTG------LCSCDPNWMGPDCSMEVCSVDCGTHGVCMGGACRCEEGWTGAACDQRVCNPLCIKHGTCKDGKCQCHQGWNGEHCTIDGCPNLCNGNGQCTMGQ-QSWHCECQTGWRGPGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQTPCQNS--------PLCRGSRDPLQVIQQSPMSQPRVRSFYDRVKMLVGRDGTHIIPGENPFNSSLASLIRGQVLTTDGTPLVGVNVSFVNYPHYGYTLTRQDGMFDLIANGGASLTLRFERAP--FLSQERTVWLPWSQFYAM------DTLVLKTEE-NTIPGCDLSGFVRPDPVVIASP--LSSFFSSKPGEKPIIP-----------ETQVLHEQIEVPGTSLKLNYLSSRTQGYRSLLKVTMTPAVVSMGLLKVHLMVAVEGHLFQKWFHASPNLAFTYIWDKTDAYGQRVYGLSEAVVSVGYEYESCASLILWEKRTAILQGFELDPTNLGGWSLDKHHILNTRSGILHKGSGENIFVTEQPPVITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAMGTDGSLYVGDLNFVRRVYPSMNTTGILEL-----------RNKDF--------RHSNNP-THKYFMAVDPVSGALFISDTNSRRIYRVR-SLTGGRLLSDNADVVAGTGEQCLPFDERCGDGGKATEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDTSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHAALESATAIALSNTGILYIAETDEKKINRVRQVSTNGEISLLAGVASDCDCKNDVNCNCFYGDDGYAPDAGLNSPTSLAVSPDGTLFIADLNNIRIRAVRANRPGPAVSSVGFAGSAQYEVASPREQELYVFNGEGLHIQTVSLVTGEPLFNFTY---GPDGELAMLVDNCNN-TVKVRRDGLGQGGGAGLLRLVLLPENQVVTLGLDPSGGLRSVSAMGQEVALMGYSGNTGLLAT-KADETGWTTFYQYDSEGRLTNMTYPTGMVT 1587          

HSP 2 Score: 131.724 bits (330), Expect = 9.221e-30
Identity = 150/659 (22.76%), Postives = 292/659 (44.31%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  + +G+N L + +D N+R E   +Y++ + K  ++ +Y+   +    +P    ++LA + V Y+ +G L  ++         +D+  R  S  +     ++ Y Y       K   +   + ++Y   +++  +  ++  P+    ++   +S+GY R  Y P   +++ I+DF S +G      Y     ++ + Y    +L  ++Y +  + F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DGFL Q+ +    + F YN+ G L++ Y R      ++    Y YD   R +  R+ +   Q  Q+FY D  +  R+TH+++H+S  +SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++D+ + ++    R YD
Sbjct: 1703 RKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRIMYDVQGRPAMWLP---SSSLAVVNVSYSSTGQLVGLQRGSMSERTEFDSQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYVFEFDTSGRVTAVTMPSVARHTMFTHVSVGYIRNTYNPPESNASIIHDF-SEDGRPQATQYLGTGRRVLYKYGKLAKLSEIVYDSTAVTFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEIFRS----LMYWMTVQYDSMGRVVKR-------ELKIGPY-ANTTQYRYDYDGDGQLTGVKVNDWSTWRYSYDLNGNLHLLNPGNSARILPLRYDLRDRITRLGDVQYRVDEDGFLSQRGS----DVFDYNSKGQLMRAYNRGSGGWSVV----YHYDGLGRRVSTRNSL--GQHLQFFYADLNHPARVTHIFNHSSSDISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYLDSNPEFQLVVGFHGGLYDALTKLVHFTQRDYD 2298          
BLAST of Teneurin-2 vs. Ensembl Medaka
Match: si:dkey-34l15.2 (teneurin transmembrane protein 2 [Source:NCBI gene;Acc:101165320])

HSP 1 Score: 531.946 bits (1369), Expect = 9.145e-152
Identity = 387/1338 (28.92%), Postives = 613/1338 (45.81%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSD------IIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLL---------VGESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDG---YLYKVEGDAQTK-----------------PAFKSITSITITMFGELIVADNGKKQIFSVHYKQ--------AIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRD------TQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W    + +    + FN ++      G+++R    P+  +Y + ER+ G+    V+      R +RS+     +E+  FV YL+ G W L+  ND    E++ F+ N  M   Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P CSG+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+DGCP  CN NGQC +     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C  +          C    D   ++  + +S+P   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG+FDL+  GG+ + L   R P    +    V++P ++F  +      D L+ K     T PGC        D  VI  P  L+ + S       IIP           +  VL   +++  T LKL + SSR +G++S L V +    V   L +++L + V G    +     P L +T+ WD+ +AY + ++GL+   V VGY YE+C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G ++F+T+    I  I G  G+ R +  C  C+G        +  A+     G + + D  ++R +  + N  G  ++           R  +         +H NNP  +   +A +P    +++S++ S  I+ +   L   +LL          GE C    ER           L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C + +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I ++  G L+IAE        V  V ++G    L  V  D   K                     S TS+ ++  G L +AD    +I +V   +            +  Y+V SP  +ELY FN  G H +T S +TG  L++  Y     +G L+ +V    N   KV RD             +  P      + LD    + ++ AM        Y+    L++  ++ E     F  Y   GRL ++  P+G+ T
Sbjct:  507 WRALLYLSQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV---ESPRERRSIQTVVLNEAV-FVQYLDAGAWHLAFYNDGRERESVSFSTNI-MDSVQECPRNCHGNGECNS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCVCYSGWKGPECDVPVTQCIDPLCSGHGTCTDGNCVCSIGYKGQNCAEVDCLDPTCSNNGICV-NGECHCKPGWGGLHCELPRAQCPDQCHGHGAFIPDTG------LCSCDPNWMGPDCSMEVCSVDCGTHGVCMGGACRCEEGWTGAACDQRVCNPLCIKHGTCKDGKCQCHQGWNGEHCTIDGCPNLCNGNGQCTMGQ-QSWHCECQTGWRGPGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQTPCQNS--------PLCRGSRDPLQVIQQSPMSQPRVRSFYDRVKMLVGRDGTHIIPGENPFNSSLASLIRGQVLTTDGTPLVGVNVSFVNYPHYGYTLTRQDGMFDLIANGGASLTLRFERAP--FLSQERTVWLPWSQFYAM------DTLVLKTEE-NTIPGCDLSGFVRPDPVVIASP--LSSFFSSKPGEKPIIP-----------ETQVLHEQIEVPGTSLKLNYLSSRTQGYRSLLKVTMTPAVVSMGLLKVHLMVAVEGHLFQKWFHASPNLAFTYIWDKTDAYGQRVYGLSEAVVSVGYEYESCASLILWEKRTAILQGFELDPTNLGGWSLDKHHILNTRSGILHKGSGENIFVTEQPPVITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAMGTDGSLYVGDLNFVRRVYPSMNTTGILEL-----------RNKDF--------RHSNNP-THKYFMAVDPVSGALFISDTNSRRIYRVR-SLTGGRLLSDNADVVAGTGEQCLPFDERCGDGGKATEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDTSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHAALESATAIALSNTGILYIAETDEKKINRVRQVSTNGEISLLAGVASDCDCKNDVNCNCFYGDDGYAPDAGLNSPTSLAVSPDGTLFIADLNNIRIRAVRANRPGPAVSSVGFAGSAQYEVASPREQELYVFNGEGLHIQTVSLVTGEPLFNFTY---GPDGELAMLVDNCNN-TVKVRRDGLGQGGGAGLLRLVLLPENQVVTLGLDPSGGLRSVSAMGQEVALMGYSGNTGLLAT-KADETGWTTFYQYDSEGRLTNMTYPTGMVT 1764          

HSP 2 Score: 131.724 bits (330), Expect = 1.065e-29
Identity = 150/659 (22.76%), Postives = 292/659 (44.31%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  + +G+N L + +D N+R E   +Y++ + K  ++ +Y+   +    +P    ++LA + V Y+ +G L  ++         +D+  R  S  +     ++ Y Y       K   +   + ++Y   +++  +  ++  P+    ++   +S+GY R  Y P   +++ I+DF S +G      Y     ++ + Y    +L  ++Y +  + F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DGFL Q+ +    + F YN+ G L++ Y R      ++    Y YD   R +  R+ +   Q  Q+FY D  +  R+TH+++H+S  +SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++D+ + ++    R YD
Sbjct: 1880 RKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRIMYDVQGRPAMWLP---SSSLAVVNVSYSSTGQLVGLQRGSMSERTEFDSQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYVFEFDTSGRVTAVTMPSVARHTMFTHVSVGYIRNTYNPPESNASIIHDF-SEDGRPQATQYLGTGRRVLYKYGKLAKLSEIVYDSTAVTFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEIFRS----LMYWMTVQYDSMGRVVKR-------ELKIGPY-ANTTQYRYDYDGDGQLTGVKVNDWSTWRYSYDLNGNLHLLNPGNSARILPLRYDLRDRITRLGDVQYRVDEDGFLSQRGS----DVFDYNSKGQLMRAYNRGSGGWSVV----YHYDGLGRRVSTRNSL--GQHLQFFYADLNHPARVTHIFNHSSSDISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYLDSNPEFQLVVGFHGGLYDALTKLVHFTQRDYD 2475          
BLAST of Teneurin-2 vs. Ensembl Medaka
Match: ENSORLT00000002695.2 (teneurin-3 [Source:NCBI gene;Acc:101157835])

HSP 1 Score: 530.791 bits (1366), Expect = 1.577e-151
Identity = 383/1322 (28.97%), Postives = 613/1322 (46.37%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAW----RQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC--PSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQS--VHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVIN-----PELEKHKLLV---GESCKE---------RTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWI-----VKSDGYLYKV-------------------EGDAQTKPA-FKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKN-YLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYS--LYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W  + + +    + FN ++     +G++ R    P+  +Y   E + G       ++ L    G R  RS++        GF+HY++ G+W L+  ND    E + +      S+ + CP  C+ +G C   G C CF GF G DCS+   P +CSG+G Y +G C C   WKG EC     +C    C G+G C+ G C+C  GY G+NC  + C  PS CS +GVC  +G C C  GW    C   K+      S     + E +T   C C   ++G  C   +C   C        G C C EG++G  C ++ C   C K+G C +G C C +GW G+HC ++GCP  CNNNG+C L  A  ++C C   W+G  C++  E+ C DG DN+ DGL DC DPDCC      P+ Q Q+Y + S    + L     +    +   +F ++I FL   + T         N+  +S++RG+V+ SDG+P  G  +       +G+T T KDG+FDL+  GG+ + L   R P    T Y  V+VP N F       + D L+ K       P C   D S  +  S VI    +   + S +      +   +  +  VL     +  + L L++ SSR  G+K  L V +    +P NL +++L + V G+   +     P L+YTF WD+ +AY + +FGL+   V VG+ YE+C   I WE +  ++ G+++ A ++G W L+  HI D   GI+Y+G+G ++F++ +   I+ I G  G+ R +  C  C+G+ +     +  A+     G I + D  YIR +  +GN     ++           R  +         +H NNP  +   LA +P   ++Y+S++ S  I+         +L  +  +V   GE C           R     +L+ PKG+ +     ++F DG  I+ +   N  I TV+G     +  +R   C + +  S+ RL+WPT +  N +D+S+Y +DN N+V ++  +N  V  VAG    C  P +E  +    A++        I ++  G L+IAE     I     V +DG +  +                    GD   K A     +S+ ++  G L VAD G  +I ++    ++      Y+V SP ++ELY F++ G H+ T S +TG   ++  + + L   N      V+ S     ++ RDT     ++  P      +T+     +  L A       F Y+    L++  +S +I    F  Y   GRL +V  P+GV T
Sbjct:  329 WRSQLYVDQPQFLKFNISVQRDALVGVYGRKGLPPSHTQYDFVELLDGSRLISKDKRALKSAAGTRHTRSVS----VHEAGFIHYMDTGIWHLAFYNDGRNTEQVSYATIIIDSIME-CPQNCHGNGDCLS-GICHCFPGFLGPDCSRAACPVLCSGNGQYSRGRCQCYSGWKGTECDVPSNQCIDIHCGGHGICIVGACICNTGYKGENCDEVDCIEPS-CSSHGVCI-HGECHCQPGWGGASCEIAKAMCPDQCSGHGTYSAETST---CTCDQNWTGPDCSLEVCEVDCGTHGVCYGGVCRCEEGWTGTVCDQKACHPLCSKNGVCKDGKCECDQGWTGEHCNIEGCPGLCNNNGRCTL-EASGWHCICQSGWRGAGCHVPMETLCTDGKDNEGDGLADCMDPDCC----LQPSCQNQQYCKGSPDPAEVLSQSPSSLAPQQAARSFFQRIHFLVGPESTHVISGDSPFNKSLVSIIRGQVLTSDGTPLIGVNVTFVHYPDHGYTITRKDGMFDLLANGGASLTLSFERAP--FLTQYRTVWVPWNVFY------VMDTLVMKKEENDI-PSC---DLSGFIRPSPVIVASPLSTFYRSSL------EDGPIVPETQVLQEETSIPGSDLNLVYLSSRAAGYKPVLKVSMTQSSIPFNLMKVHLMVAVVGRLFQKWFPAQPNLSYTFIWDKTDAYGQRVFGLSEAVVSVGFEYESCLDLILWEKRTAILQGYEMDASNMGGWTLDKHHILDVQSGILYKGNGENIFVSLLPPVISSIMGN-GR-RRSISCPSCNGQAEGNKLLAPLALACGADGSIFVGDFNYIRRIFPSGNVTSVMEL-----------RNKDF--------RHSNNP-AHRYYLATDPVTGQLYVSDTNSRRIYRPKMLSGARDLSSNGEVVAGTGEQCPPFDEARCGDGRKAPEAQLLGPKGIAVDKNGLIYFVDGTMIRKVD-RNGIISTVLGSNDLTS--ARPLTCDTSMHISQVRLEWPTDLAINPMDNSMYVLDN-NVVLQI-TENRQVRIVAGRPMHCQVPGIEY-TLGKRAVQTMLEGATAIALSYSGILYIAETDEKKIHRIRQVSTDGEITHLAGAPSECDCKNDANCDCYQAGDGYAKDARLNCPSSLVVSPDGTLYVADLGNIRIRAIRRNCSLASGPSSYEVASPASQELYVFDANGTHQFTMSLVTGDYKFNFRIVFNLTPFNEEDVTAVTDSSGNTLRIRRDTNRMPVRVVAPDNQVIWLTIGTNGGLKTLTAQGQELVLFTYHGNSGLLAT-KSIQIGWTTFYDYDSEGRLTNVTFPTGVVT 1587          

HSP 2 Score: 142.895 bits (359), Expect = 3.970e-33
Identity = 154/657 (23.44%), Postives = 289/657 (43.99%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIP-FKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNV--FGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESI-----------VVYNSANQIIQWDEFIF--EINIVNKIKLPNNKGF------IRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSL-ILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  ++NG+N L V YD   R E   +Y++ + K ++K IY++       +P   QV  L  + + Y+ +G +  ++         YD+  R  S   A    I+ Y Y       K   +   +  +Y   Y+S D+  ++  P+    +++ + SIGY R +Y P   +++   D+ S +G L R+ +     QI + Y   N+L  ++Y + R+ F   ++      ++KT N+   GF    ++   GPLV    +       S+D +  +++  Y+YD+  ++  +  ++ + P      + + I           V+Y   NQII      +    ++  +IK    + F      I    +  G++  R I +     T +  Y+ D    L             E L +R++Y  + +L +LN  ++          GRL  L+ +       + D  T L    G V Y  ++DG L Q+      E F YN+ GLL       ++  I     Y YD   R +  ++ +   Q  Q+FY D     R+TH+Y+H+S +++S+YY+   GH+F++ +     +++  D  G+P  + S+N  ++ +  Y  +GE     +    + IGF G ++D  + ++   +R YD
Sbjct: 1704 RKLRVNGRNLLSVDYDRALRTE--KIYDDHR-KFLLKIIYDNQGHPTLWVPSCSQVPKLLSVNLTYSSTGQVTGLQRGPTTERWEYDSQGRIISRVFA-DGKIWSYTY-----LDKSMVLLLHSQHQYIFDYDSGDRLSAVTMPSVARHTMQTIRSIGYYRNIYTPPESNASVTVDY-SEDGQLLRVAFLGTGRQILYKYRKQNKLAEILYDSTRVSFTYDET----AGVLKTVNLQSEGFICSIRYRQIGPLVDRQIFRF-----SEDGM-VNARFDYTYDNSFRVTSMQAVINETPLPIDLYQFDDISGKMEQFGKFGVIYYDINQIISTAVMTYTKHFDVHGRIKEIQYEIFRSLMYWITIQYDNMGRVTKREIKIGPFANTTKYGYEYDVDGQLQTVYLN-------EKLMWRYNYDLNGNLHLLNPGNS----------GRLTPLRYD-------LRDRITRL----GDVQYRLDEDGLLRQR----GAEIFEYNSKGLLTRVYSKAASWTI----TYRYDGLGRRVASKNSL--GQHLQFFYADLNYPTRITHVYNHSSSEITSFYYD-LQGHVFAMEISSGDEFHIACDNTGTPLAVFSNNGLLLKQVQYTAYGEVYFDSNPDFVLVIGFHGGLYDPLTRLLHFGDRDYD 2301          
BLAST of Teneurin-2 vs. Ensembl Medaka
Match: si:dkey-34l15.2 (teneurin transmembrane protein 2 [Source:NCBI gene;Acc:101165320])

HSP 1 Score: 525.013 bits (1351), Expect = 1.364e-149
Identity = 387/1347 (28.73%), Postives = 613/1347 (45.51%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLD---------GCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSD------IIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLL---------VGESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDG---YLYKVEGDAQTK-----------------PAFKSITSITITMFGELIVADNGKKQIFSVHYKQ--------AIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRD------TQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W    + +    + FN ++      G+++R    P+  +Y + ER+ G+    V+      R +RS+     +E+  FV YL+ G W L+  ND    E++ F+ N  M   Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P CSG+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+D         GCP  CN NGQC +     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C  +          C    D   ++  + +S+P   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG+FDL+  GG+ + L   R P    +    V++P ++F  +      D L+ K     T PGC        D  VI  P  L+ + S       IIP           +  VL   +++  T LKL + SSR +G++S L V +    V   L +++L + V G    +     P L +T+ WD+ +AY + ++GL+   V VGY YE+C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G ++F+T+    I  I G  G+ R +  C  C+G        +  A+     G + + D  ++R +  + N  G  ++           R  +         +H NNP  +   +A +P    +++S++ S  I+ +   L   +LL          GE C    ER           L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C + +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I ++  G L+IAE        V  V ++G    L  V  D   K                     S TS+ ++  G L +AD    +I +V   +            +  Y+V SP  +ELY FN  G H +T S +TG  L++  Y     +G L+ +V    N   KV RD             +  P      + LD    + ++ AM        Y+    L++  ++ E     F  Y   GRL ++  P+G+ T
Sbjct:  437 WRALLYLSQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV---ESPRERRSIQTVVLNEAV-FVQYLDAGAWHLAFYNDGRERESVSFSTNI-MDSVQECPRNCHGNGECNS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCVCYSGWKGPECDVPVTQCIDPLCSGHGTCTDGNCVCSIGYKGQNCAEVDCLDPTCSNNGICV-NGECHCKPGWGGLHCELPRAQCPDQCHGHGAFIPDTG------LCSCDPNWMGPDCSMEVCSVDCGTHGVCMGGACRCEEGWTGAACDQRVCNPLCIKHGTCKDGKCQCHQGWNGEHCTIDHGSMVDKADGCPNLCNGNGQCTMGQ-QSWHCECQTGWRGPGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQTPCQNS--------PLCRGSRDPLQVIQQSPMSQPRVRSFYDRVKMLVGRDGTHIIPGENPFNSSLASLIRGQVLTTDGTPLVGVNVSFVNYPHYGYTLTRQDGMFDLIANGGASLTLRFERAP--FLSQERTVWLPWSQFYAM------DTLVLKTEE-NTIPGCDLSGFVRPDPVVIASP--LSSFFSSKPGEKPIIP-----------ETQVLHEQIEVPGTSLKLNYLSSRTQGYRSLLKVTMTPAVVSMGLLKVHLMVAVEGHLFQKWFHASPNLAFTYIWDKTDAYGQRVYGLSEAVVSVGYEYESCASLILWEKRTAILQGFELDPTNLGGWSLDKHHILNTRSGILHKGSGENIFVTEQPPVITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAMGTDGSLYVGDLNFVRRVYPSMNTTGILEL-----------RNKDF--------RHSNNP-THKYFMAVDPVSGALFISDTNSRRIYRVR-SLTGGRLLSDNADVVAGTGEQCLPFDERCGDGGKATEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDTSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHAALESATAIALSNTGILYIAETDEKKINRVRQVSTNGEISLLAGVASDCDCKNDVNCNCFYGDDGYAPDAGLNSPTSLAVSPDGTLFIADLNNIRIRAVRANRPGPAVSSVGFAGSAQYEVASPREQELYVFNGEGLHIQTVSLVTGEPLFNFTY---GPDGELAMLVDNCNN-TVKVRRDGLGQGGGAGLLRLVLLPENQVVTLGLDPSGGLRSVSAMGQEVALMGYSGNTGLLAT-KADETGWTTFYQYDSEGRLTNMTYPTGMVT 1703          

HSP 2 Score: 131.724 bits (330), Expect = 9.983e-30
Identity = 156/692 (22.54%), Postives = 302/692 (43.64%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQF 7990
            R  + +G+N L + +D N+R E   +Y++ + K  ++ +Y+   +    +P    ++LA + V Y+ +G L  ++         +D+  R  S  +     ++ Y Y       K   +   + ++Y   +++  +  ++  P+    ++   +S+GY R  Y P   +++ I+DF S +G      Y     ++ + Y    +L  ++Y +  + F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DGFL Q+ +    + F YN+ G L++ Y R      ++    Y YD   R +  R+ +   Q  Q+FY D  +  R+TH+++H+S  +SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++D+ + ++    R YD      AG      ++    +  +P   N Y F
Sbjct: 1819 RKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRIMYDVQGRPAMWLP---SSSLAVVNVSYSSTGQLVGLQRGSMSERTEFDSQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYVFEFDTSGRVTAVTMPSVARHTMFTHVSVGYIRNTYNPPESNASIIHDF-SEDGRPQATQYLGTGRRVLYKYGKLAKLSEIVYDSTAVTFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEIFRS----LMYWMTVQYDSMGRVVKR-------ELKIGPY-ANTTQYRYDYDGDGQLTGVKVNDWSTWRYSYDLNGNLHLLNPGNSARILPLRYDLRDRITRLGDVQYRVDEDGFLSQRGS----DVFDYNSKGQLMRAYNRGSGGWSVV----YHYDGLGRRVSTRNSL--GQHLQFFYADLNHPARVTHIFNHSSSDISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYLDSNPEFQLVVGFHGGLYDALTKLVHFTQRDYDV----LAGRWTSPDYSMWSKIGKDPSPFNLYMF 2443          
BLAST of Teneurin-2 vs. Ensembl Medaka
Match: si:dkey-34l15.2 (teneurin transmembrane protein 2 [Source:NCBI gene;Acc:101165320])

HSP 1 Score: 525.013 bits (1351), Expect = 1.455e-149
Identity = 387/1347 (28.73%), Postives = 613/1347 (45.51%), Query Frame = 2
Query: 1664 WSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLC-PSNCSENGVCQRNGFCRCFQGWESKDCSKRKS---DKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLD---------GCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPG-SAFHEQIEFLTRRKYT-----TKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSD------IIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENC-SQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEP---KIYLSESLSGSIWVINPELEKHKLL---------VGESC---KERT-----CIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIG--DASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGC--PSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEK-----RTVWIVKSDG---YLYKVEGDAQTK-----------------PAFKSITSITITMFGELIVADNGKKQIFSVHYKQ--------AIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRD------TQSRATQLETPSGINYNVTLDERKRIINL-AMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTT 5434
            W    + +    + FN ++      G+++R    P+  +Y + ER+ G+    V+      R +RS+     +E+  FV YL+ G W L+  ND    E++ F+ N  M   Q CP  C+ +G C   G C CF GF G DCSK   P +CSG+G Y +G+C C   WKG EC     +C  P CSG+G C  G CVC  GY G+NC+ + C    CS NG+C  NG C C  GW    C   ++   D+      F  + G      +C C   + G  C   +CS  C      + G C C EG++G  C +R+C+  C KHG C +G C C +GWNG+HCT+D         GCP  CN NGQC +     ++C C   W+G  C+++ E+ C D  DN+ DGLTDC DPDCC    C  +          C    D   ++  + +S+P   +F+++++ L  R  T         N    S++RG+V+ +DG+P  G  +        G+T T +DG+FDL+  GG+ + L   R P    +    V++P ++F  +      D L+ K     T PGC        D  VI  P  L+ + S       IIP           +  VL   +++  T LKL + SSR +G++S L V +    V   L +++L + V G    +     P L +T+ WD+ +AY + ++GL+   V VGY YE+C S I WE +  ++ G +L   ++G W+L+  HI +   GI+++G G ++F+T+    I  I G  G+ R +  C  C+G        +  A+     G + + D  ++R +  + N  G  ++           R  +         +H NNP  +   +A +P    +++S++ S  I+ +   L   +LL          GE C    ER           L+ PKG+ +     ++F D   I+ +   N  I T++G  D +A+    R   C + +  S+ RL+WPT +  N +D+S+Y ++N N++ R+  +N  V+ +AG    C  P ++  S + LAI         I ++  G L+IAE        V  V ++G    L  V  D   K                     S TS+ ++  G L +AD    +I +V   +            +  Y+V SP  +ELY FN  G H +T S +TG  L++  Y     +G L+ +V    N   KV RD             +  P      + LD    + ++ AM        Y+    L++  ++ E     F  Y   GRL ++  P+G+ T
Sbjct:  507 WRALLYLSQPQFLKFNISLGKDALFGVYIRKGLPPSHAQYDYMERLDGKEKWSVV---ESPRERRSIQTVVLNEAV-FVQYLDAGAWHLAFYNDGRERESVSFSTNI-MDSVQECPRNCHGNGECNS-GVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSCVCYSGWKGPECDVPVTQCIDPLCSGHGTCTDGNCVCSIGYKGQNCAEVDCLDPTCSNNGICV-NGECHCKPGWGGLHCELPRAQCPDQCHGHGAFIPDTG------LCSCDPNWMGPDCSMEVCSVDCGTHGVCMGGACRCEEGWTGAACDQRVCNPLCIKHGTCKDGKCQCHQGWNGEHCTIDHGSMVDKADGCPNLCNGNGQCTMGQ-QSWHCECQTGWRGPGCSVAMETSCADNKDNEGDGLTDCMDPDCCIQTPCQNS--------PLCRGSRDPLQVIQQSPMSQPRVRSFYDRVKMLVGRDGTHIIPGENPFNSSLASLIRGQVLTTDGTPLVGVNVSFVNYPHYGYTLTRQDGMFDLIANGGASLTLRFERAP--FLSQERTVWLPWSQFYAM------DTLVLKTEE-NTIPGCDLSGFVRPDPVVIASP--LSSFFSSKPGEKPIIP-----------ETQVLHEQIEVPGTSLKLNYLSSRTQGYRSLLKVTMTPAVVSMGLLKVHLMVAVEGHLFQKWFHASPNLAFTYIWDKTDAYGQRVYGLSEAVVSVGYEYESCASLILWEKRTAILQGFELDPTNLGGWSLDKHHILNTRSGILHKGSGENIFVTEQPPVITSIMGN-GR-RRSISCPSCNGLADGNKLLAPVALAMGTDGSLYVGDLNFVRRVYPSMNTTGILEL-----------RNKDF--------RHSNNP-THKYFMAVDPVSGALFISDTNSRRIYRVR-SLTGGRLLSDNADVVAGTGEQCLPFDERCGDGGKATEATLMSPKGIAVDKNGLMYFVDATMIRKVD-QNGIISTLLGANDLTAV----RPLSCDTSMDVSQVRLEWPTDLAVNPMDNSLYVLEN-NVILRI-TENHQVSIIAGRPMHCQVPGIDY-SLSKLAIHAALESATAIALSNTGILYIAETDEKKINRVRQVSTNGEISLLAGVASDCDCKNDVNCNCFYGDDGYAPDAGLNSPTSLAVSPDGTLFIADLNNIRIRAVRANRPGPAVSSVGFAGSAQYEVASPREQELYVFNGEGLHIQTVSLVTGEPLFNFTY---GPDGELAMLVDNCNN-TVKVRRDGLGQGGGAGLLRLVLLPENQVVTLGLDPSGGLRSVSAMGQEVALMGYSGNTGLLAT-KADETGWTTFYQYDSEGRLTNMTYPTGMVT 1773          

HSP 2 Score: 131.339 bits (329), Expect = 1.209e-29
Identity = 150/659 (22.76%), Postives = 292/659 (44.31%), Query Frame = 2
Query: 5993 RIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSY-DSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQY-YE-DGRLMSLKVNSGAPVEYIYDSNTGL---------------------LKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFG-LLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDK-KFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD 7891
            R  + +G+N L + +D N+R E   +Y++ + K  ++ +Y+   +    +P    ++LA + V Y+ +G L  ++         +D+  R  S  +     ++ Y Y       K   +   + ++Y   +++  +  ++  P+    ++   +S+GY R  Y P   +++ I+DF S +G      Y     ++ + Y    +L  ++Y +  + F   D    V K++   +  GF    ++   GPL+ +  Y       S++ +  +++  Y+Y D+  +I  +  ++ + P      R + I     + ++  + +F      +N+I        I T       ++T S   D      EV Y+  R     +  +  ++  SM  +  R        L +  Y A++ QY+Y Y+ DG+L  +KVN  +   Y YD N  L                     +   G V Y  ++DGFL Q+ +    + F YN+ G L++ Y R      ++    Y YD   R +  R+ +   Q  Q+FY D  +  R+TH+++H+S  +SS YY+   GHLF++ V   + YY+ SD  G+P  + SSN  ++ +  Y  +GE     +    + +GF G ++D+ + ++    R YD
Sbjct: 1889 RKLRAHGRNLLSIDFDRNTRTE--KIYDDHR-KFTLRIMYDVQGRPAMWLP---SSSLAVVNVSYSSTGQLVGLQRGSMSERTEFDSQGRILS-RSFVDGKVWSYSY-----LDKSMVLLLQSQRQYVFEFDTSGRVTAVTMPSVARHTMFTHVSVGYIRNTYNPPESNASIIHDF-SEDGRPQATQYLGTGRRVLYKYGKLAKLSEIVYDSTAVTFGY-DETAGVLKMVNLQS-GGFSCTIRYRKMGPLIDKQIYRF-----SEEGM-VNARFDYTYHDNSFRIASMKPVISETPLPVDLYRYDEI-----SGKVEHFGKFGVIYYDINQI--------ITTA------VMTLSKHFDTHGRIKEVQYEIFRS----LMYWMTVQYDSMGRVVKR-------ELKIGPY-ANTTQYRYDYDGDGQLTGVKVNDWSTWRYSYDLNGNLHLLNPGNSARILPLRYDLRDRITRLGDVQYRVDEDGFLSQRGS----DVFDYNSKGQLMRAYNRGSGGWSVV----YHYDGLGRRVSTRNSL--GQHLQFFYADLNHPARVTHIFNHSSSDISSLYYD-LQGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYLDSNPEFQLVVGFHGGLYDALTKLVHFTQRDYD 2484          
BLAST of Teneurin-2 vs. Planmine SMEST
Match: SMESG000016735.1 (SMESG000016735.1)

HSP 1 Score: 5277.61 bits (13689), Expect = 0.000e+0
Identity = 2652/2685 (98.77%), Postives = 2665/2685 (99.26%), Query Frame = 2
Query:  863 GWKSEESIKYPKLRMLFQKRQKKIPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYEXXXXXXXXXXXXXXSKPMKTVTSGKFPPSNSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRXXXXXXXXXXXXXXXXXXXXKSVWLEGRISKRYAQDPVVIGLFDXXXXXXXXXXXXXYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTL-DGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY 8914
            G  S   ++  ++RM      ++IPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYENPYNSLNRHNNNNNSKPMKTVTSGKFPPSNSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRISLFGLAILLLLSLIAYFAAKSVWLEGRISKRYAQDPVVIGLFDPKNLPLLLTPLKTYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQF LNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSK +SDKQS RSNFCLNNGELNT+DVCMCPLGYSGEKCEK+LCSGKCYNGYCS NGTCICNEGFSGKQCGKRICDSRCYKHGRCI+GNCICRKGWNGKHCTL +GCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDLGLLLLTTKLSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLE+NSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGF  PNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDP+NLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCSSISEQISIITETIKSETEKLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY
Sbjct:  184 GPVSHNGLQGIRVRMDQDHILQQIPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYENPYNSLNRHNNNNNSKPMKTVTSGKFPPSNSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRISLFGLAILLLLSLIAYFAAKSVWLEGRISKRYAQDPVVIGLFDPKNLPLLLTPLKTYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFNLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCYNGYCSGNGTCICNEGFSGKQCGKRICDSRCYKHGRCIKGNCICRKGWNGKHCTLGNGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDLGLLLLTTKLSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLETNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGF--PNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPLNLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCSSISEQISIITETIKSETEKLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY 2866          

HSP 2 Score: 325.479 bits (833), Expect = 1.381e-88
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 2
Query:   92 MYFTHKNEIXXXXXXXXXXXXXXXSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVXXXXXXXXXXXXXXXXXYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNXXXXXXXXXXXXXXRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ 709
            MYFTHKNEINLDHLNNKKHLNEKNSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVSSNLLHNNGSNSSGIGSYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNSIPPPPSEPPPSTPRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ
Sbjct:    1 MYFTHKNEINLDHLNNKKHLNEKNSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVSSNLLHNNGSNSSGIGSYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNSIPPPPSEPPPSTPRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ 206          
BLAST of Teneurin-2 vs. Planmine SMEST
Match: SMESG000016735.1 (SMESG000016735.1)

HSP 1 Score: 5259.89 bits (13643), Expect = 0.000e+0
Identity = 2633/2684 (98.10%), Postives = 2645/2684 (98.55%), Query Frame = 2
Query:  863 GWKSEESIKYPKLRMLFQKRQKKIPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYEXXXXXXXXXXXXXXSKPMKTVTSGKFPPSNSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRXXXXXXXXXXXXXXXXXXXXKSVWLEGRISKRYAQDPVVIGLFDXXXXXXXXXXXXXYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY 8914
            G  S   ++  ++RM      ++IPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYENPYNSLNRHNNNNNSKPMKTVTSG                    MPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRISLFGLAILLLLSLIAYFAAKSVWLEGRISKRYAQDPVVIGLFDPKNLPLLLTPLKTYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQF LNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSK +SDKQS RSNFCLNNGELNT+DVCMCPLGYSGEKCEK+LCSGKCYNGYCS NGTCICNEGFSGKQCGKRICDSRCYKHGRCI+GNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDLGLLLLTTKLSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLE+NSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGF  PNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDP+NLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCSSISEQISIITETIKSETEKLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY
Sbjct:  184 GPVSHNGLQGIRVRMDQDHILQQIPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYENPYNSLNRHNNNNNSKPMKTVTSG--------------------MPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRISLFGLAILLLLSLIAYFAAKSVWLEGRISKRYAQDPVVIGLFDPKNLPLLLTPLKTYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFNLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCYNGYCSGNGTCICNEGFSGKQCGKRICDSRCYKHGRCIKGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDLGLLLLTTKLSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLETNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGF--PNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPLNLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCSSISEQISIITETIKSETEKLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY 2845          

HSP 2 Score: 325.865 bits (834), Expect = 1.082e-88
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 2
Query:   92 MYFTHKNEIXXXXXXXXXXXXXXXSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVXXXXXXXXXXXXXXXXXYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNXXXXXXXXXXXXXXRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ 709
            MYFTHKNEINLDHLNNKKHLNEKNSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVSSNLLHNNGSNSSGIGSYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNSIPPPPSEPPPSTPRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ
Sbjct:    1 MYFTHKNEINLDHLNNKKHLNEKNSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVSSNLLHNNGSNSSGIGSYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNSIPPPPSEPPPSTPRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ 206          
BLAST of Teneurin-2 vs. Planmine SMEST
Match: SMESG000016735.1 (SMESG000016735.1)

HSP 1 Score: 5244.86 bits (13604), Expect = 0.000e+0
Identity = 2625/2684 (97.80%), Postives = 2637/2684 (98.25%), Query Frame = 2
Query:  863 GWKSEESIKYPKLRMLFQKRQKKIPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYEXXXXXXXXXXXXXXSKPMKTVTSGKFPPSNSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRXXXXXXXXXXXXXXXXXXXXKSVWLEGRISKRYAQDPVVIGLFDXXXXXXXXXXXXXYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDXXXXXXXXXXSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRNGFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCXXXXXXXXXXXXXXXXXXXXLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY 8914
            G  S   ++  ++RM      ++IPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYENPYNSLNRHNNNNNSKPMKTVTSGKFPPSNSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRISLFGLAILLLLSLIAYFAAKSVWLEGRISKRYAQDPVVIGLFDPKNLPLLLTPLKTYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQF LNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSK +SDKQS RSNFCLNNGELNT+DVCMCPLGYSGEKCEK+LCSGKCYNGYCS NGTCICNEGFSGKQCGKRICDSRCYKHGRCI+GNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDLGLLLLTTKLSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLE+NSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQ                              MNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDP+NLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCSSISEQISIITETIKSETEKLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY
Sbjct:  184 GPVSHNGLQGIRVRMDQDHILQQIPGVMESDNNQMPYLMMGQTNSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTGFGIPSIPRAPGSVSGTSNVYENPYNSLNRHNNNNNSKPMKTVTSGKFPPSNSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGRCSWTCIRISLFGLAILLLLSLIAYFAAKSVWLEGRISKRYAQDPVVIGLFDPKNLPLLLTPLKTYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLGIFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSESTGFVHYLEKGLWFLSVINDQPREENIQFNLNTKMSMKQTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKLRSDKQSVRSNFCLNNGELNTEDVCMCPLGYSGEKCEKKLCSGKCYNGYCSGNGTCICNEGFSGKQCGKRICDSRCYKHGRCIKGNCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCNISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMDDLGLLLLTTKLSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQSDGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNRFTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSSVIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRSSRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYTFYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAKDIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMANGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKWKMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSESLSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFADGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTSVVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLETNSETVLAIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAFKSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELYSFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHRDTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISIQQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLKNFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLIGPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKIIFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQ------------------------------MNGKNKLQVAYDSNSREEIFSVYENEKVKNVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEINYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYESEDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNLFRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTHNVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQINKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKLPNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKIIRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGAPVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQEYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPLNLDRLTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISSNSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYDPNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQFFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFESIHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPDISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILLYLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFIISIRYCSSISEQISIITETIKSETEKLFWINKRRQLTHNDLMRDQISIDHKDELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY 2837          

HSP 2 Score: 325.479 bits (833), Expect = 1.255e-88
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 2
Query:   92 MYFTHKNEIXXXXXXXXXXXXXXXSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVXXXXXXXXXXXXXXXXXYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNXXXXXXXXXXXXXXRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ 709
            MYFTHKNEINLDHLNNKKHLNEKNSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVSSNLLHNNGSNSSGIGSYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNSIPPPPSEPPPSTPRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ
Sbjct:    1 MYFTHKNEINLDHLNNKKHLNEKNSTNEDLLPPTLKHGRRDKFQEETMPFLGEFEPPVPYPVSSNLLHNNGSNSSGIGSYTGQGLHFGSAAMRNTNHREGRIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPSALLNSIPPPPSEPPPSTPRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQDHILQQ 206          
BLAST of Teneurin-2 vs. Planmine SMEST
Match: SMESG000005380.1 (SMESG000005380.1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.566e-18
Identity = 62/172 (36.05%), Postives = 79/172 (45.93%), Query Frame = 2
Query: 2216 CSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYN-GYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGN-CICRKGWNGKHCTLDGCPKNCNNNGQC 2725
            C  NG CV  +C C  GY GK C   +C   C   G C     C+C +G+E   C K K D        C N G+    ++C C  GY G  CEKR+C+  C   G C     C C EG  G +C K  C  +C   G CI  N C C + ++G  C    C + C N G+C
Sbjct:  448 CQNNGQCVKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDIT------CENGGQCLRPNLCTCAFGYIGTFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQCMNGGTCIGKNKCHCPQSFSGSFCENHICTR-CYNGGKC 612          

HSP 2 Score: 85.8853 bits (211), Expect = 3.330e-16
Identity = 64/203 (31.53%), Postives = 94/203 (46.31%), Query Frame = 2
Query: 2000 QTCPDFCNKHGVCTEFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYF-QGTCTCNPEWKGKECQTIWYECEYPDCSGNGDCVSGE-CVCKHGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRIC 2602
            ++C   C  +G C ++ KC C TG++G+ C      + C   G       C C+  ++G  C+ +  +C+   C   G C+    C C  GY G  C   +C   C + G+CQ+   C C +G     C K +   Q      C+N G    K+ C CP  +SG  CE  +C+ +CYNG   V   C C  GF G +C  RIC
Sbjct:  442 ESCNITCQNNGQCVKW-KCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKL--KCDI-TCENGGQCLRPNLCTCAFGYIGTFCEKRICNPPCQKGGICQKGNICSCPEGTVGNRCEKYECYPQ------CMNGGTCIGKNKCHCPQSFSGSFCENHICT-RCYNGGKCVGNMCQCPTGFFGPECKSRIC 633          

HSP 3 Score: 62.3882 bits (150), Expect = 5.806e-9
Identity = 49/148 (33.11%), Postives = 66/148 (44.59%), Query Frame = 2
Query: 2351 CFQGWESK-------DCSKRKSDKQSARSNF-------------CLNNGELNTKDVCMCPLGYSGEKCEKRLCSGKCYN-GYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEGN-CICRKGWNGKHCTLDGCPKNCNNNGQCK 2728
            C  GW+ +       +C ++++ K   RS F             C NNG+   K  C CP GY G+ C+  +C+ KC N G C     C C+EGF G  C K  CD  C   G+C+  N C C  G+ G  C    C   C   G C+
Sbjct:  404 CGIGWQKRYRPCQDDECLEKENIKSEIRSCFIQKRCPNESCNITCQNNGQC-VKWKCFCPTGYQGKFCQNPICNEKCKNGGKCIGPNICQCSEGFEGLFCEKLKCDITCENGGQCLRPNLCTCAFGYIGTFCEKRICNPPCQKGGICQ 550          
BLAST of Teneurin-2 vs. Planmine SMEST
Match: SMESG000027800.1 (SMESG000027800.1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.284e-13
Identity = 74/245 (30.20%), Postives = 106/245 (43.27%), Query Frame = 2
Query: 2147 CTCNPEWKGKECQTIWYECEYPDCSGNGDCV----SGECVCK-HGYSGKNCSTLLCPSNCSENGVCQRNGFCRCFQGWESKDCSKRKS-----DKQSARSNFCLNNGE---LNTKDVCMC-PLGYSGEKCEKRLCSGK-CYNGYCSV----NGTCICNEGFSGKQCGKRICDSR-CYKHGRCIEGN----CICRKGWNGKHCTLDG-CPKN-CNNNGQCKLNHAMEYYCSCLPI-WKGISCNISK 2800
            C C+  + G++C+ I + C    C   G C       +C C   G+ G NC    C      +  CQ NG C    G    DC   +      +K     +FC N G     N + +C C   G+ G+KCE+ +C+   C NG   V      TC C   F+G QC +R C S  C+  G C   N    C C K + G+ C ++  CP + C   G C++ +    YC C    ++G  CNI K
Sbjct: 1137 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFC-----SDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYP-YCDCQNTNYEGTRCNIPK 1375          
The following BLAST results are available for this feature:
BLAST of Teneurin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TENM31.642e-15529.71teneurin transmembrane protein 3 [Source:HGNC Symb... [more]
TENM22.313e-15428.89teneurin transmembrane protein 2 [Source:HGNC Symb... [more]
TENM24.105e-15429.03teneurin transmembrane protein 2 [Source:HGNC Symb... [more]
TENM23.901e-15328.69teneurin transmembrane protein 2 [Source:HGNC Symb... [more]
TENM43.578e-14228.35teneurin transmembrane protein 4 [Source:HGNC Symb... [more]
back to top
BLAST of Teneurin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ten-13.028e-11525.79Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-13.697e-11525.79Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-14.125e-11525.79Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-14.845e-11525.79Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
T01D3.11.122e-1833.64pep chromosome:WBcel235:V:13689892:13703330:1 gene... [more]
back to top
BLAST of Teneurin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ten-m5.593e-17530.34gene:FBgn0004449 transcript:FBtr0078509[more]
Ten-m5.696e-17329.95gene:FBgn0004449 transcript:FBtr0330159[more]
Ten-m9.436e-17329.95gene:FBgn0004449 transcript:FBtr0306107[more]
Ten-a5.822e-12928.13gene:FBgn0267001 transcript:FBtr0300201[more]
Ten-a6.648e-12928.13gene:FBgn0267001 transcript:FBtr0299859[more]
back to top
BLAST of Teneurin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX537102.31.513e-16925.08si:dkey-34l15.2 [Source:NCBI gene;Acc:563197][more]
BX537102.38.992e-16925.13si:dkey-34l15.2 [Source:NCBI gene;Acc:563197][more]
BX537102.36.967e-16825.22si:dkey-34l15.2 [Source:NCBI gene;Acc:563197][more]
TENM22.580e-15629.04si:dkey-34l15.2 [Source:ZFIN;Acc:ZDB-GENE-081027-5... [more]
BX537102.34.310e-15629.42si:dkey-34l15.2 [Source:NCBI gene;Acc:563197][more]
back to top
BLAST of Teneurin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tenm20.000e+026.34teneurin transmembrane protein 3 [Source:HGNC Symb... [more]
tenm20.000e+026.34teneurin transmembrane protein 3 [Source:HGNC Symb... [more]
tenm20.000e+026.23teneurin transmembrane protein 3 [Source:HGNC Symb... [more]
tenm20.000e+026.23teneurin transmembrane protein 3 [Source:HGNC Symb... [more]
tenm20.000e+026.27teneurin transmembrane protein 3 [Source:HGNC Symb... [more]
back to top
BLAST of Teneurin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tenm31.409e-15629.86teneurin transmembrane protein 3 [Source:MGI Symbo... [more]
Tenm24.964e-15629.24teneurin transmembrane protein 2 [Source:MGI Symbo... [more]
Tenm21.328e-15429.24teneurin transmembrane protein 2 [Source:MGI Symbo... [more]
Tenm21.328e-15429.24teneurin transmembrane protein 2 [Source:MGI Symbo... [more]
Tenm32.065e-15429.66teneurin transmembrane protein 3 [Source:MGI Symbo... [more]
back to top
BLAST of Teneurin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O61307|TENM_DROME5.607e-17430.34Teneurin-m OS=Drosophila melanogaster OX=7227 GN=T... [more]
sp|Q9P273|TEN3_HUMAN7.887e-15529.71Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 S... [more]
sp|Q9WTS5|TEN2_MOUSE8.597e-15429.24Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 ... [more]
sp|Q9WTS6|TEN3_MOUSE1.483e-15329.66Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 ... [more]
sp|Q9NT68|TEN2_HUMAN1.971e-15329.03Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 S... [more]
back to top
BLAST of Teneurin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JR480.000e+026.76teneurin-m-like isoform X8 OS=Lingula unguis OX=75... [more]
A0A1S3JS290.000e+026.76teneurin-m-like isoform X9 OS=Lingula unguis OX=75... [more]
A0A1S3JR430.000e+026.76teneurin-m-like isoform X7 OS=Lingula unguis OX=75... [more]
A0A2R2MLA00.000e+026.79teneurin-m-like isoform X2 OS=Lingula unguis OX=75... [more]
A0A2R2MLA50.000e+026.76teneurin-m-like isoform X6 OS=Lingula unguis OX=75... [more]
back to top
BLAST of Teneurin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tenm46.994e-17926.18teneurin transmembrane protein 4 [Source:NCBI gene... [more]
tenm49.764e-17826.18teneurin transmembrane protein 4 [Source:NCBI gene... [more]
tenm41.684e-17726.18teneurin transmembrane protein 4 [Source:NCBI gene... [more]
tenm44.085e-17726.05teneurin transmembrane protein 4 [Source:NCBI gene... [more]
tenm41.344e-17626.08teneurin transmembrane protein 4 [Source:NCBI gene... [more]
back to top
BLAST of Teneurin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001302.12.046e-13928.66pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 ... [more]
VWDE3.998e-3130.13von Willebrand factor D and EGF domains [Source:HG... [more]
ENSPMAT00000009276.11.237e-1635.67pep scaffold:Pmarinus_7.0:GL476916:212692:218299:-... [more]
ENSPMAT00000009665.16.771e-1634.65pep scaffold:Pmarinus_7.0:GL480729:2444:4403:-1 ge... [more]
ENSPMAT00000000962.11.184e-1431.37pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 ... [more]
back to top
BLAST of Teneurin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Teneurin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO480423.130e-1933.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413822.491e-1530.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344413.674e-1330.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283793.813e-1330.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462436.797e-1333.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Teneurin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-34l15.24.793e-15228.92teneurin transmembrane protein 2 [Source:NCBI gene... [more]
si:dkey-34l15.29.145e-15228.92teneurin transmembrane protein 2 [Source:NCBI gene... [more]
ENSORLT00000002695.21.577e-15128.97teneurin-3 [Source:NCBI gene;Acc:101157835][more]
si:dkey-34l15.21.364e-14928.73teneurin transmembrane protein 2 [Source:NCBI gene... [more]
si:dkey-34l15.21.455e-14928.73teneurin transmembrane protein 2 [Source:NCBI gene... [more]
back to top
BLAST of Teneurin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016735.11.381e-8898.77SMESG000016735.1[more]
SMESG000016735.11.082e-8898.10SMESG000016735.1[more]
SMESG000016735.11.255e-8897.80SMESG000016735.1[more]
SMESG000005380.14.566e-1836.05SMESG000005380.1[more]
SMESG000027800.13.284e-1330.20SMESG000027800.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003560 ID=SMED30003560|Name=Teneurin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=8949bp
TGAACACTCGCTAATGAATATTTGAATAGTTTGCAATTAAAAATCCTGAA
TCAGATGAAGAATATTTGAATTTTAGAGATTTTTTCTCCCTATGTATTTT
ACTCACAAAAACGAAATCAATCTTGACCATTTGAATAATAAAAAACATTT
GAATGAGAAAAATTCTACTAATGAGGATTTACTGCCACCGACATTGAAAC
ACGGCAGACGAGACAAATTCCAAGAAGAAACCATGCCTTTTCTCGGTGAA
TTCGAACCTCCGGTTCCGTATCCGGTCTCATCGAACTTGTTGCATAACAA
TGGAAGTAATAGCAGTGGAATCGGCTCCTACACCGGTCAAGGCTTGCATT
TCGGCAGCGCAGCGATGCGAAATACAAATCATCGAGAAGGCCGAATTGTT
ACCACTGATGTTGAAGATCTCTCCACAGATGATGATAACACTTGCCCAGC
AAATAACAAAAGAGGTCTTGATGAAATGTTCGACAGCATAAGCAGTAATC
CAGCTTCTAGTATAATGAACCAAGAAATGTCTCATCCGTCAGCTTTATTA
AATAGTATTCCTCCTCCACCGTCAGAACCGCCTCCATCAACTCCACGAGA
TTCTTATCAGGAGTCAGTATTTCCGAAATGCTCAATGATGGGTCCAGTCT
CTCATAATGGATTGCAGGGTATTCGAGTTCGAATGGACCAGGATCATATT
CTTCAACAAAAAAATCCGCCAAAAACGGCCGAGGTCTCATTGACCTATCC
GAAACGAATAAATAGCCAAGCTACGGCATCGGTGTTTGAACCTCTCTATG
TCCACACCCTTGACACCCAATCTGATGGTACGTTGTTGGCTAATCCTATC
CGACCCTCGTCCGGATGGAAGTCTGAAGAGTCGATAAAATATCCGAAATT
GCGAATGCTGTTTCAGAAACGGCAGAAAAAAATTCCAGGAGTCATGGAAT
CGGATAACAACCAAATGCCATATTTGATGATGGGCCAGACCAATAGTAGA
GGAACGAATATATTTTCAGATAATCCTAATGGATTCACTCCAATACAGAC
AATGGGAACTATCGGTAGATATAGAAACCAAATGCCAATGTCCGAGACAT
CCGCCATGTCTACTCTGCCTCATACACATTCACAAACAGGATTTGGGATT
CCGTCGATTCCGAGAGCTCCGGGCAGTGTTAGTGGAACTTCAAATGTCTA
TGAAAATCCTTATAACTCATTAAATCGTCATAATAATAACAACAACAGCA
AACCAATGAAAACAGTGACATCAGGTAAATTTCCCCCTTCAAACAGTACT
CATGACATGGCATATCCTTTGGTAAATCCTTCAGGAATGCCTCAAAATCA
CATTATTTACCGACAAAGCAGCATAAGATCACCACAAAACCATTCATTTA
CAGATCCCTTTTTCGGAATAGGGAAAACTGGTTCTGGTCGGTGCTCTTGG
ACGTGCATTCGTATTTCCTTATTTGGATTAGCCATATTGCTATTGTTGAG
CCTAATTGCCTATTTTGCAGCTAAATCAGTTTGGTTAGAGGGTCGGATAA
GCAAACGTTATGCTCAGGATCCTGTAGTCATTGGCCTTTTTGATCCTAAA
AACTTGCCTCTTTTATTGACACCTCTCAAAACGTATAAAATTTCATTGAA
ATCAATGGGAGTTTGGAGTGGGCGATGGTTTCAAAACCACAGTGATAATA
TCCATTTTAACTTCACAATTAATGCTCTTACGAGTTTGGGAATCTTTCTG
CGAGTTAATAGCGTTCCAACAATTGTCAGATACTCTCATTTTGAAAGAAT
TTCTGGAAGAGCATGGAGACAAGTTCTCATCGACAACAACGGAAATCGGG
TCAAAAGATCTTTAAATGAACAATATTTTTCGGAATCTACCGGATTTGTT
CATTACCTGGAAAAGGGGTTATGGTTTCTCTCAGTAATCAACGACCAGCC
GAGGGAGGAAAATATTCAGTTCACTCTAAACACCAAGATGTCAATGAAAC
AAACTTGCCCAGACTTTTGTAACAAGCACGGAGTTTGTACTGAGTTTGGC
AAATGTGATTGTTTTACAGGATTCAAAGGACAAGATTGTTCTAAAGTCGA
TTTTCCAAAGGTTTGTAGTGGACATGGTAACTATTTCCAAGGAACTTGTA
CGTGTAATCCAGAATGGAAGGGTAAGGAATGCCAAACGATATGGTACGAA
TGTGAATATCCCGATTGTTCTGGGAATGGTGACTGTGTATCTGGTGAATG
CGTTTGCAAACACGGTTATTCAGGGAAAAATTGTTCGACTTTGCTTTGCC
CATCAAATTGTTCAGAGAATGGTGTTTGTCAGAGGAATGGTTTTTGTCGA
TGCTTTCAAGGTTGGGAATCGAAAGACTGTTCAAAACGGAAATCCGACAA
ACAATCTGCCCGGTCTAATTTTTGCTTGAATAATGGAGAACTGAACACCA
AGGATGTCTGCATGTGTCCACTTGGTTATTCTGGTGAGAAATGTGAAAAA
AGATTATGTTCGGGTAAATGTTACAATGGCTATTGTAGTGTCAATGGGAC
CTGTATTTGTAATGAAGGCTTTAGTGGTAAGCAATGCGGCAAAAGGATCT
GTGATTCGAGATGCTACAAACACGGAAGATGTATTGAAGGAAATTGCATT
TGCCGAAAAGGATGGAATGGAAAACATTGTACTTTAGATGGATGTCCAAA
AAATTGTAATAATAATGGACAATGCAAGTTGAACCATGCCATGGAATATT
ACTGTTCATGCTTACCAATCTGGAAGGGCATTTCGTGCAATATTAGCAAG
GAGAGCAAATGTGATGATGGAGTTGACAATGACAACGACGGTTTAACCGA
TTGCCAAGATCCCGATTGTTGTCCCACGCAATACTGTGATCCAACGAATC
AAAAACAGAAATATGCGGAAGAAAGTTGCCCGAAAATGGACGACCTCGGA
TTATTGCTATTAACAACGAAGTTATCCCGACCCGGAAGTGCTTTTCATGA
ACAAATAGAATTTTTAACCAGAAGAAAATACACAACGAAATCGTTAAATC
AAAAGAAAATTTCCGTTGTTCGCGGCAAAGTTATTCAATCAGACGGTTCT
CCGTTTCCTGGTTGCAGGATCCAGGACCGGATTCGAGAAGTCAACGGGCA
TACCTTTACCGACAAAGATGGAATATTCGATTTAGTAGTTGAAGGCGGCA
GTTTGGTGCAGCTGGAAATCATCCGTTATCCCGGAAATAGGTTTACCGGA
TATTACAATGTCTACGTGCCGATAAATGAGTTTGTGAATATCGGCGATTT
CGAGCTAAAGGATTTATTAATTTCTAAAGCTAACAGCGGCAAAACGGAGC
CTGGCTGTTTTAATGGCGATCAATCTGTACATGATAGCTCCGTTATCGGA
GGTCCCCGAATACTTGCGGATTGGTCATCTGACATCATCCCAATCTATAA
CACGGATTCCTTTTCCGTTGCCTTTGATAACGGAGTTCTAGTCAACAGCA
TGGATTTGAAAGAAACTGGACTGAAACTAATGCACCGATCAAGCCGAGTT
AAAGGATTCAAGTCATCGTTGTTAGTTCTTTTGATTGGAAAAGACGTTCC
GAGGAATTTAAAGGAAATAAATTTAAAAATTTACGTTGCCGGACAAAACA
TATCACAACGATTGGAACCAGATCCGTATTTAACATATACATTTTACTGG
GACAGACTCAATGCCTACACGAGGTTATTGTTCGGTCTGGCTTCAGTAAA
AGTAAGAGTGGGATATATATATGAAAATTGTAGCCAGATATTTTGGGAGA
CAAAAATGACAGTGATTAATGGACATGATCTTGTTGCCAAAGATATTGGG
AATTGGAATCTTAATAACCGACATATTTTTGATTACAATCACGGAATAGT
TTATCGAGGAGATGGGTCTCACTTATTTCTAACTCAGATCAATTGGCAAA
TAAATCCTATTTCAGGTCAGCTTGGGAAACCCCGCATGGCAAATGGTTGC
GTTAGATGTGACGGCGAACCGAAGGAGAAAAATTTTTACAGTTTAAATGC
AATTTTGTCTGACGACAAAGGTCGAATTGTTATATCTGATGGAAAGTATA
TTAGAATTCTCACTAAGGCCGGTAATTATGAAGGCAAATGGAAAATGCTC
TCTCCATATTTGCTTATGTTTATTACAAAACGGGAGAACAATCTCCAAGG
TCTCTCTATATTTTTAGCAAAACACGAAAACAATCCAAATGTGAATAATG
ATTTGTTAGCAGGAGAGCCGAAAATTTATTTATCTGAATCTTTATCAGGT
TCCATATGGGTCATTAACCCTGAACTAGAAAAGCATAAACTGCTGGTTGG
GGAATCTTGTAAGGAAAGAACTTGTATCAGACAGAAACTTGTTCATCCCA
AAGGAATGACAATTACATATAAGTTTTCATTGTTCTTCGCTGATGGGAGA
GCGATAAAAATGATTTCGTTGACAAATTTGACTATCCATACAGTTATTGG
TGACGCGTCAGCTTTGGCTGAACATTCACGACTTCCTGGGTGCTATTCCG
GTCTATCGGCATCGGAAACAAGATTAAAATGGCCGACAAGTGTTGTATAT
AATCAAATAGATGATTCCATTTATTTTGTGGATAATATGAATATGGTATA
TAGATTGGGTCTTGATAATTTCATGGTGACAACTGTCGCAGGCAACAGTC
AGGGATGTCCATCTTTAGAAAGTAACTCTGAAACCGTTTTGGCAATAAGG
CACAAATTTTCTGACATTCGAGACATAGAGATTAACCCTTTGGGAGAATT
GTTTATCGCTGAGAAGAGAACGGTTTGGATAGTAAAATCCGATGGATATC
TTTATAAAGTTGAAGGAGATGCTCAAACAAAACCAGCATTCAAAAGCATA
ACATCAATTACCATAACAATGTTTGGTGAACTTATCGTAGCAGACAATGG
AAAAAAACAGATTTTTTCTGTTCATTATAAGCAAGCAATCAAGAAAAACT
ATTTATATCAAGTTCTTTCTCCGGATACTAGAGAATTATACTCCTTCAAT
AGTGCTGGACAGCACAGGCGCACCGATAGCTCTATTACCGGGACAAATCT
ATATTCTCTATATTACCGTCTTAACTCCATAAACGGATGGTTGTCTAAAA
TAGTCAGTCCCAGTGGAAATCTTCAATTTAAAGTCCATCGAGACACACAA
AGTCGAGCAACACAACTGGAAACTCCGTCAGGAATCAATTACAATGTCAC
TTTGGATGAGAGGAAAAGAATTATCAATTTGGCTATGCCATCCAGCTCCT
GGAAATTTCAATATAATGATCAAGATTTGCTAATATCCATTCAGCAGTCA
TCGGAGATCGCTCCATACAGATTTACGTATTATCCCGACAGTGGAAGACT
GAAATCTGTAATTCGTCCGTCGGGAGTCACTACAATGTTTGTCGAGCATC
CGGTTTACCATGAATATGTCCTTTCAAAATTCAAGCTGAAAAATTTCATT
AAAGGTTTCAACAAAAACCGGCTTGCCTCGACTGCCTTAACCCCGTATAA
CTCTTTAATTTACTCTCCTCTCGCCAGCAATTACTTTAATAGCAAGCTTA
ACAAAAATTGGGACCTGCAGATTTTCCAGCTCCATTTAATAGGGCCGGCT
AATCAAGTTAAATTGTCTAACGGATTTCAACCTCAGTCAATGTCGCTCAT
TGATTCACACTCGAAAATCGAACTCGCTACGCATTTCACCACATATTCTC
ATTCGAATACACCAAATGGACTCCAGTTTACAAGGAAAATCATTTTTAAA
ACTGAAAGTGATTTTAAGGATTTTGAATCCGAGTGGGTTTATAATGTAAT
CTCGCCCTCTTTGGATGCGACAATTTCAAAGAACTCCAATATCCGAGTTG
ATGGAAATTATCAGGTAATTAATGACGAGGGTTATAGAAATGGATTCCAA
TACCCTAATGATGAGAGTGCTAGTTCTCTTTCTCCTGATCCGAGAATATT
TAAAATGAATGGAAAAAACAAATTGCAAGTGGCATACGATTCGAATTCTC
GAGAGGAAATCTTTTCGGTTTATGAGAATGAAAAGGTTAAAAACGTGATG
AAATTTATATATAACGACGACAATCAAATTGTAAAAATTATTCCCTTTAA
ACAAGTTACGAATCTGGCGGAGCTAACTGTAGAATACACAAGATCCGGAT
TACTTAAACAAATAAAATGGATCAAACCGTTATTAGAAATAAACTATGAT
AATTTAAACCGAACAAGCTCAATATACAATGCGTATACGAATGACATATT
CCATTACATATATGACGGAAACGAGGTGAGCAGTAAAATTGCTTTTATAA
ATAAAGGCAATGACAAAAAATACAAATTATTATATGAATCGGAAGACAAG
TTCGAGTCAATAAAAACTCCGAATAACATTTACGTATCTGTCAAACAGTT
GATCTCAATCGGATATCGTCGGATTCTCTACAAACCGTACGGAGTGAGCT
CGAATTTTATTTACGATTTCGATTCAATAAATGGCAACCTTTTCCGGTTG
ATTTATCCCAGCAGGATGCACCAAATCAATTTCTTCTATTCGACAACCAA
TCAACTGAAAAATGTCATTTACGGAGCTGAAAGAATTGAATTTGTTATAA
GCGATTCGAATTTTCTTGTGGAAAAAATCATCAAAACCCACAATGTGTTT
GGATTTCGTCTGGTTCAGAAATTTGCGTATTATGGGCCCCTAGTAGCGGA
AATCGATTACGAAATGGATTTGCCGACCCCCAGTCAAGACATCATCAGTT
TTGACAGTAAAATTGTCTATAGTTACGATTCGGAAATGCAGATAAATAAA
ATTAATTTAATTCTAATCGACAAACCGTTTTCCAAATCAAATTTGCGCCT
GGAAAGCATCGTTGTGTACAATTCAGCCAATCAGATTATCCAATGGGATG
AGTTCATTTTTGAAATCAATATTGTCAATAAAATCAAGCTGCCAAACAAT
AAAGGATTTATCCGGACGACTCTCAATGAAAACGGGCAAATTTTAACGAG
ATCAATCGATATGGATAATAGCAAAATCACCATTGAAGTTTCGTATGATG
AGGATAGAAAAAACCCCTTGCTGGTCGCGTCGTACAAAATCATCAGATCT
TCAAGCATGGAGATTCTTAATTTTCGATTTTCCTATTACAAAGATTCGAG
TTTAATTCTCAATGCTTACAGCGCCGATTCTATTCAGTATCAATATTACG
AAGATGGCCGACTCATGTCTTTGAAAGTCAATTCTGGAGCGCCTGTTGAA
TATATCTACGACAGCAATACCGGTTTGTTGAAGAATTGCGGCTTGGTTAC
GTACTTTTACAATGATGATGGGTTTCTGATTCAGAAACGAAACGGAAAGC
AACTGGAAAAGTTCAGCTATAACGCTTTCGGTTTGTTGCAAGAGTATTTG
AGAATGGAATCGAATTCTAAAATTCTAAAACGGGTGGAATATTTCTACGA
CAGTAGGCATCGGATAATTCTTCATAGAGATATCATGGATCCAAAGCAAA
TGTACCAGTACTTCTATACAGATCCCATAAATCTCGACCGGCTGACCCAC
ATGTATGATCACAATTCGAAAAAGTTGAGCAGTTATTATTATGAGCCGTT
TTCCGGGCATTTGTTTTCTATAAGGGTCGATAAGAAATTCTATTACGTTT
TATCGGACTTTCTCGGTTCTCCACGGACGATTATTTCCTCTAATTCCGAC
ATTGTTTGGGAGAGAGATTATGATATTTTCGGCGAAGCGAAATCCCTCAA
GGATTGGTCGGTGCATGTGCCAATCGGATTTGGAGGATTCATTTTTGACT
CGGAATCCAATATGATTTTCATGAAAAATCGGATCTACGATCCGAACAGC
AAGAACTTTGCCGGGTTTCAATGGTTTGGACTGTTTACCCAACTGAAAAA
CGTTAAATTGAATCCTTTTCTTCTCAACAGTTATCAATTCCATTTCCTTC
CCCAAACCTATAGCGTTACGGAGCAGTTTGATTTTTCTCAGTTTTTTAAA
CCGGAATTCTGGCTGGAGAAAATCGGAATCAATACAGAAACCATGGTAAC
GACAAAACCGTTGGAGATCTATCGAGAAATTACCGGACTTCCTTCGGGAT
TTCTTTTGAAATCGGTTTTTGAACATTTCAAATTCGAGTCGATTCACAGC
CGGTTGGCAAAGCACAATGAAGAAAGCTTTCGAACCCTGTCCAATTTACA
AACCAACGACTTACTTGCCCATGATTGTTTGCCTTATAATTTGATCAATT
TCAACCAAATCTCCTCACATATTTTCAGTCTCCAACCGGATATTAGCATA
TCGTTAAGGGAAAGCAATAAACTAGAGATCGTATCGAAACTCGGCAAATT
CGATTCTCCGTTCAGTGTCATTGCGAACTCTCTATTTCGCAACACAACTC
TTTTGAATATCTACAGCAGTCGTGGAGATGTTATCCTTCTGTATTTAGTA
AAAGACATTTGTGGTATGTTGAAGAAAGATCTCCAAGATCTCGGAATGAT
CGACAAATCCCAGCCGGTATTGAATCTGTCAACAATCTCCCATCACAACA
ATGTCACAGAGATCATCTTGCATCAGAAGTACTTCATCATTTCCATCAGA
TATTGCTCGTCGATTTCCGAACAAATCTCTATAATAACCGAAACGATAAA
GAGTGAAACTGAGAAATTGTTTTGGATCAACAAACGCCGGCAATTGACTC
ACAACGATTTGATGCGCGATCAGATTTCGATAGATCACAAAGATGAACTG
ACCAAGTATGGATTAGTACGGAACTTTTTCCTTGATGTCTGGTTCAATTT
AACTGAATTTCCATTAGTTTTCGATGATCCCTCTGTATATAGAGTCAAAT
GGAAACCTTCATATTGAATACTCAATTCCATCTAGTTACACAACAAATG
back to top

protein sequence of SMED30003560-orf-1

>SMED30003560-orf-1 ID=SMED30003560-orf-1|Name=SMED30003560-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2942bp
MYFTHKNEINLDHLNNKKHLNEKNSTNEDLLPPTLKHGRRDKFQEETMPF
LGEFEPPVPYPVSSNLLHNNGSNSSGIGSYTGQGLHFGSAAMRNTNHREG
RIVTTDVEDLSTDDDNTCPANNKRGLDEMFDSISSNPASSIMNQEMSHPS
ALLNSIPPPPSEPPPSTPRDSYQESVFPKCSMMGPVSHNGLQGIRVRMDQ
DHILQQKNPPKTAEVSLTYPKRINSQATASVFEPLYVHTLDTQSDGTLLA
NPIRPSSGWKSEESIKYPKLRMLFQKRQKKIPGVMESDNNQMPYLMMGQT
NSRGTNIFSDNPNGFTPIQTMGTIGRYRNQMPMSETSAMSTLPHTHSQTG
FGIPSIPRAPGSVSGTSNVYENPYNSLNRHNNNNNSKPMKTVTSGKFPPS
NSTHDMAYPLVNPSGMPQNHIIYRQSSIRSPQNHSFTDPFFGIGKTGSGR
CSWTCIRISLFGLAILLLLSLIAYFAAKSVWLEGRISKRYAQDPVVIGLF
DPKNLPLLLTPLKTYKISLKSMGVWSGRWFQNHSDNIHFNFTINALTSLG
IFLRVNSVPTIVRYSHFERISGRAWRQVLIDNNGNRVKRSLNEQYFSEST
GFVHYLEKGLWFLSVINDQPREENIQFTLNTKMSMKQTCPDFCNKHGVCT
EFGKCDCFTGFKGQDCSKVDFPKVCSGHGNYFQGTCTCNPEWKGKECQTI
WYECEYPDCSGNGDCVSGECVCKHGYSGKNCSTLLCPSNCSENGVCQRNG
FCRCFQGWESKDCSKRKSDKQSARSNFCLNNGELNTKDVCMCPLGYSGEK
CEKRLCSGKCYNGYCSVNGTCICNEGFSGKQCGKRICDSRCYKHGRCIEG
NCICRKGWNGKHCTLDGCPKNCNNNGQCKLNHAMEYYCSCLPIWKGISCN
ISKESKCDDGVDNDNDGLTDCQDPDCCPTQYCDPTNQKQKYAEESCPKMD
DLGLLLLTTKLSRPGSAFHEQIEFLTRRKYTTKSLNQKKISVVRGKVIQS
DGSPFPGCRIQDRIREVNGHTFTDKDGIFDLVVEGGSLVQLEIIRYPGNR
FTGYYNVYVPINEFVNIGDFELKDLLISKANSGKTEPGCFNGDQSVHDSS
VIGGPRILADWSSDIIPIYNTDSFSVAFDNGVLVNSMDLKETGLKLMHRS
SRVKGFKSSLLVLLIGKDVPRNLKEINLKIYVAGQNISQRLEPDPYLTYT
FYWDRLNAYTRLLFGLASVKVRVGYIYENCSQIFWETKMTVINGHDLVAK
DIGNWNLNNRHIFDYNHGIVYRGDGSHLFLTQINWQINPISGQLGKPRMA
NGCVRCDGEPKEKNFYSLNAILSDDKGRIVISDGKYIRILTKAGNYEGKW
KMLSPYLLMFITKRENNLQGLSIFLAKHENNPNVNNDLLAGEPKIYLSES
LSGSIWVINPELEKHKLLVGESCKERTCIRQKLVHPKGMTITYKFSLFFA
DGRAIKMISLTNLTIHTVIGDASALAEHSRLPGCYSGLSASETRLKWPTS
VVYNQIDDSIYFVDNMNMVYRLGLDNFMVTTVAGNSQGCPSLESNSETVL
AIRHKFSDIRDIEINPLGELFIAEKRTVWIVKSDGYLYKVEGDAQTKPAF
KSITSITITMFGELIVADNGKKQIFSVHYKQAIKKNYLYQVLSPDTRELY
SFNSAGQHRRTDSSITGTNLYSLYYRLNSINGWLSKIVSPSGNLQFKVHR
DTQSRATQLETPSGINYNVTLDERKRIINLAMPSSSWKFQYNDQDLLISI
QQSSEIAPYRFTYYPDSGRLKSVIRPSGVTTMFVEHPVYHEYVLSKFKLK
NFIKGFNKNRLASTALTPYNSLIYSPLASNYFNSKLNKNWDLQIFQLHLI
GPANQVKLSNGFQPQSMSLIDSHSKIELATHFTTYSHSNTPNGLQFTRKI
IFKTESDFKDFESEWVYNVISPSLDATISKNSNIRVDGNYQVINDEGYRN
GFQYPNDESASSLSPDPRIFKMNGKNKLQVAYDSNSREEIFSVYENEKVK
NVMKFIYNDDNQIVKIIPFKQVTNLAELTVEYTRSGLLKQIKWIKPLLEI
NYDNLNRTSSIYNAYTNDIFHYIYDGNEVSSKIAFINKGNDKKYKLLYES
EDKFESIKTPNNIYVSVKQLISIGYRRILYKPYGVSSNFIYDFDSINGNL
FRLIYPSRMHQINFFYSTTNQLKNVIYGAERIEFVISDSNFLVEKIIKTH
NVFGFRLVQKFAYYGPLVAEIDYEMDLPTPSQDIISFDSKIVYSYDSEMQ
INKINLILIDKPFSKSNLRLESIVVYNSANQIIQWDEFIFEINIVNKIKL
PNNKGFIRTTLNENGQILTRSIDMDNSKITIEVSYDEDRKNPLLVASYKI
IRSSSMEILNFRFSYYKDSSLILNAYSADSIQYQYYEDGRLMSLKVNSGA
PVEYIYDSNTGLLKNCGLVTYFYNDDGFLIQKRNGKQLEKFSYNAFGLLQ
EYLRMESNSKILKRVEYFYDSRHRIILHRDIMDPKQMYQYFYTDPINLDR
LTHMYDHNSKKLSSYYYEPFSGHLFSIRVDKKFYYVLSDFLGSPRTIISS
NSDIVWERDYDIFGEAKSLKDWSVHVPIGFGGFIFDSESNMIFMKNRIYD
PNSKNFAGFQWFGLFTQLKNVKLNPFLLNSYQFHFLPQTYSVTEQFDFSQ
FFKPEFWLEKIGINTETMVTTKPLEIYREITGLPSGFLLKSVFEHFKFES
IHSRLAKHNEESFRTLSNLQTNDLLAHDCLPYNLINFNQISSHIFSLQPD
ISISLRESNKLEIVSKLGKFDSPFSVIANSLFRNTTLLNIYSSRGDVILL
YLVKDICGMLKKDLQDLGMIDKSQPVLNLSTISHHNNVTEIILHQKYFII
SIRYCSSISEQISIITETIKSETEKLFWINKRRQLTHNDLMRDQISIDHK
DELTKYGLVRNFFLDVWFNLTEFPLVFDDPSVYRVKWKPSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR008979Galactose-bd-like_sf
IPR000742EGF-like_dom
IPR0110426-blade_b-propeller_TolB-like
IPR013032EGF-like_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 735..764
e-value: 12.0
score: 14.9
coord: 765..802
e-value: 120.0
score: 3.8
coord: 836..864
e-value: 21.0
score: 12.3
coord: 867..900
e-value: 1.1
score: 18.3
coord: 638..667
e-value: 26.0
score: 11.2
coord: 703..732
e-value: 0.041
score: 23.0
coord: 805..833
e-value: 13.0
score: 14.6
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 635..667
score: 9.717
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 769..802
score: 9.65
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 864..900
score: 12.404
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 732..764
score: 8.569
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 1388..1657
e-value: 1.5E-5
score: 26.3
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 611..669
e-value: 3.6E-6
score: 28.5
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 671..699
e-value: 1.8E-6
score: 29.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 700..764
e-value: 1.3E-8
score: 37.0
coord: 834..900
e-value: 2.4E-8
score: 36.1
coord: 769..833
e-value: 4.3E-10
score: 41.7
NoneNo IPR availablePANTHERPTHR11219TENEURIN AND N-ACETYLGLUCOSAMINE-1-PHOSPHODIESTER ALPHA-N-ACETYLGLUCOSAMINIDASEcoord: 1429..2930
NoneNo IPR availablePANTHERPTHR11219:SF69TENEURIN-Mcoord: 385..1345
NoneNo IPR availablePANTHERPTHR11219:SF69TENEURIN-Mcoord: 1429..2930
NoneNo IPR availablePANTHERPTHR11219TENEURIN AND N-ACETYLGLUCOSAMINE-1-PHOSPHODIESTER ALPHA-N-ACETYLGLUCOSAMINIDASEcoord: 385..1345
NoneNo IPR availableCDDcd00054EGF_CAcoord: 703..731
e-value: 5.56924E-4
score: 37.6162
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 1393..1630
NoneNo IPR availableTMHMMTMhelixcoord: 455..477
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 655..666
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 888..899
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 655..666
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 790..801
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 790..801
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 752..763