Epiphycan

Overview
NameEpiphycan
Smed IDSMED30003556
Length (bp)3437
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Epiphycan (SMED30003556) t-SNE clustered cells

Violin plots show distribution of expression levels for Epiphycan (SMED30003556) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epiphycan (SMED30003556) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epiphycan (SMED30003556) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003556

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003556h1SMcG0017488 dd_Smed_v4_6669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003556h1SMcG0017488 dd_Smed_v4_6669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003556h1SMcG0017488 dd_Smed_v4_6669_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epiphycan vs. Ensembl Human
Match: LGR4 (leucine rich repeat containing G protein-coupled receptor 4 [Source:HGNC Symbol;Acc:HGNC:13299])

HSP 1 Score: 105.531 bits (262), Expect = 3.139e-22
Identity = 113/402 (28.11%), Postives = 186/402 (46.27%), Query Frame = 2
Query:  185 CPIPCKC-THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMT---KLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF--------VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-NLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPA-SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIES 1345
            C  PC C     VDC  + L  VP+G+S     L L+ N +  +   +   L  LK L L +N++K +   A  GLS L++L L+ N ++ + PE   +GL++L H++L +N   ++PV   +++     L L  NKI S++ D +F   + L  L L  N+I+ ++Q  F        ++L    L      + +L ++    F     S+I +   +GN LL +  +      F G + F  L                    S LH L +   SM++   N    G  +L+ L L   KIS  P+        L  L ++ NN+ + P      +L+ + LQ N I QI++  F+ L +L+ L L +N I  I + +F  L  +T+LD+ FN LT   +
Sbjct:   29 CAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSV-PEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKI-SSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNL--------------------SDLHSLVIRGASMVQQFPN--LTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPT 406          

HSP 2 Score: 80.1073 bits (196), Expect = 1.667e-14
Identity = 82/288 (28.47%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP-HRLP--ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQ------------QNPVLLTIA----PNSFV-------LSNLESIELQGNRI--KFDATAG-----------------------------------------PIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMN 1621
            +N+ LK++ ++A RGL  LQ L L    I+  P+  F  + +L HL+++DN+L   P H L    +L+ L L  N I  I    F +L++L  LHL  N I S+  + FD L +L +LDL +N L      I   +P L  L                 NP+L TI     P SFV       LS+L S+ ++G  +  +F    G                                         P F+    L  +SL+ NQI ++ E  F G ++++++DLS N
Sbjct:   89 QNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAI-KALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRN 375          

HSP 3 Score: 57.3806 bits (137), Expect = 1.509e-7
Identity = 50/177 (28.25%), Postives = 86/177 (48.59%), Query Frame = 2
Query: 1109 NDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWP 1639
            +   L   P  L A  + L L  N++  I       L  LK L L+ N + ++ + +   L++L SL L  N +T +    F  + +L  L L+  +   + + P S  L  L+++ L  N+I   +     F NL  LV L L +N+I  L+++ F G  N++ +DL+ N+L  +P
Sbjct:   44 SGKGLTAVPEGLSAFTQALQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLS-NLPTLQALTLALNKIS--SIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFP 217          

HSP 4 Score: 57.3806 bits (137), Expect = 1.789e-7
Identity = 51/188 (27.13%), Postives = 91/188 (48.40%), Query Frame = 2
Query: 1076 SAMAKLTHLFMNDNNLINCPH---RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            S + +L  L + +N L   P    R  ++L+ L L +N+I  + +D F+ L  L+ L L  NS+  +  +   +L +L +L L  N+++ I    F  +  L+ L+L   N  + +++ + F  L NLE+++L  N +     A      LP L  L    N I+ + +  F G+  ++ I L  N L
Sbjct:   78 SGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHL--HNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQA---IKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPL 260          
BLAST of Epiphycan vs. Ensembl Human
Match: LGR4 (leucine rich repeat containing G protein-coupled receptor 4 [Source:HGNC Symbol;Acc:HGNC:13299])

HSP 1 Score: 104.375 bits (259), Expect = 7.178e-22
Identity = 116/425 (27.29%), Postives = 188/425 (44.24%), Query Frame = 2
Query:  185 CPIPCKC-THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-----------------------PETFNKGLIKLLHVYLGNNEFEKIPVLKATHMT---KLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF--------VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-NLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPA-SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIES 1345
            C  PC C     VDC  + L  VP+G+S     LD+S N I  L  ++F+    L+ L+L+ N++  I+  A  GL  L+ L L+NN L  +                        PE   +GL++L H++L +N   ++PV   +++     L L  NKI S++ D +F   + L  L L  N+I+ ++Q  F        ++L    L      + +L ++    F     S+I +   +GN LL +  +      F G + F  L                    S LH L +   SM++   N    G  +L+ L L   KIS  P+        L  L ++ NN+ + P      +L+ + LQ N I QI++  F+ L +L+ L L +N I  I + +F  L  +T+LD+ FN LT   +
Sbjct:   29 CAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKI-SSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNL--------------------SDLHSLVIRGASMVQQFPN--LTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPT 430          

HSP 2 Score: 80.1073 bits (196), Expect = 1.988e-14
Identity = 82/288 (28.47%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP-HRLP--ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQ------------QNPVLLTIA----PNSFV-------LSNLESIELQGNRI--KFDATAG-----------------------------------------PIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMN 1621
            +N+ LK++ ++A RGL  LQ L L    I+  P+  F  + +L HL+++DN+L   P H L    +L+ L L  N I  I    F +L++L  LHL  N I S+  + FD L +L +LDL +N L      I   +P L  L                 NP+L TI     P SFV       LS+L S+ ++G  +  +F    G                                         P F+    L  +SL+ NQI ++ E  F G ++++++DLS N
Sbjct:  113 QNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAI-KALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRN 399          

HSP 3 Score: 63.929 bits (154), Expect = 1.952e-9
Identity = 71/260 (27.31%), Postives = 125/260 (48.08%), Query Frame = 2
Query:  866 GFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPH---RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            G + +D    GLT++  + L  F  +    LD+S N++ + +  DAF+    L+ L LA   +S   P    S + +L  L + +N L   P    R  ++L+ L L +N+I  + +D F+ L  L+ L L  NS+  +  +   +L +L +L L  N+++ I    F  +  L+ L+L   N  + +++ + F  L NLE+++L  N +     A      LP L  L    N I+ + +  F G+  ++ I L  N L
Sbjct:   37 GDRRVDCSGKGLTAVP-EGLSAFTQA----LDISMNNITQ-LPEDAFKNFPFLEELQLAGNDLSFIHPK-ALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHL--HNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQA---IKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPL 284          

HSP 4 Score: 55.0694 bits (131), Expect = 9.764e-7
Identity = 55/201 (27.36%), Postives = 94/201 (46.77%), Query Frame = 2
Query: 1109 NDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFK---------------------SLTNLKELH---LKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWP 1639
            +   L   P  L A  + L +  NNI Q+ +D FK                     +L+ LKEL    L+ N + ++ + +   L++L SL L  N +T +    F  + +L  L L+  +   + + P S  L  L+++ L  N+I   +     F NL  LV L L +N+I  L+++ F G  N++ +DL+ N+L  +P
Sbjct:   44 SGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLS-NLPTLQALTLALNKIS--SIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFP 241          
BLAST of Epiphycan vs. Ensembl Human
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:HGNC Symbol;Acc:HGNC:5468])

HSP 1 Score: 99.3673 bits (246), Expect = 1.096e-20
Identity = 132/494 (26.72%), Postives = 205/494 (41.50%), Query Frame = 2
Query:  185 CPIPCKCTHH------SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDF-------------------LKPFFDSKLHHLD---LSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLF---MNDNNLINCPH---RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQI 1555
            CP  C C++       SV C  + L  +P G+      L L  N + S+   +FQ L +L  L L   ++  +   A +GL NL +LHLE N L  L   TF      L  + L NN   ++          +  LNL  N + + + D +F     L+ L+L  N +  +    F      +L  L L  N+L  I A  FV +   L  L L+ N      I   A   F G    ++LDL    +  +  D                    L+P     LH L+   L  N + + +   +F GL  L++L L   ++   +++  A   LT++    ++ N L N P    R    L  LHL+ + + +IR   F  L+ L+ L LK N ++ IE  S   LA L  LDL  N+LT +   +F  + KL  L L +     L   P   +     +  L  +  + +A    +   L +L  LSLR+N +
Sbjct:   41 CPAACVCSYDDDADELSVFCSSRNLTRLPDGVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFAH-TPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSL-AVLPDAAFRGLGSLRELVLAGNRLAYLQPALF--SGLAELRELDLSRNALRAIKANVFVQLPR-LQKLYLDRN-----LIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRI-RQLAERSFEGLGQLEVLTLDHNQLQ--EVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNR---LAELPADALGPLQRAFWLDVSHNRLEALPNSLLAPLGRLRYLSLRNNSL 518          

HSP 2 Score: 74.7146 bits (182), Expect = 5.378e-13
Identity = 63/214 (29.44%), Postives = 95/214 (44.39%), Query Frame = 2
Query: 1100 LFMNDNNLINCPHRLPA------SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKF----------------------DATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTF 1651
            L+++ NNL + P   PA      SL FL+LQ   +  +       L NL  LHL++N + S+   +F    +L SL L  NRL+R+E G+F  +  L  LNL   +   L + P++    L +L  + L GNR+ +                       A    +F  LP+L  L L  N I  +    F G   ++ +DLS N + G    TF
Sbjct:   79 LWLDGNNLSSVP---PAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNS---LAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTF 286          
BLAST of Epiphycan vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 100.523 bits (249), Expect = 1.307e-20
Identity = 158/643 (24.57%), Postives = 275/643 (42.77%), Query Frame = 2
Query:  176 VFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDS---NKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKS-----CGLTSISGDFLK--------PFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDL---GFNRLTRIES-GIFHRMPKLISLNLEQQNPVLLTIAP---------------------------------NSFVLSNLESIELQGNRIKFDATA----GPIFDNLPK-------LVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID-FNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQIL-CNIPNEKAGK 1894
            V  CP  C C+++ VDCR + L ++P  +   +T + L  N IK +   +F     L+R+ LS+N++ E+  +AF GL +L +L L  N ++ L P++  +GL  L  + L  N+   + V     +  LNL S   NK+++ +   +F     +QT+ L +N         F+   + K     L  N +E   A    P + +   +    +K    +  E   +  +G     F DL       C  T++     K        P + ++L  L+ +E ++L++     F+ L  L+ +N +  KI+D  +  F   + +  + +  N L N  H++     SLK L L+SN I  +  D F  L++++ L L  N I ++   +FD L SL++L+L    FN    +   G + R  ++++ N   Q P  L   P                                 ++ V  + + +++    I  D T     G  F  +PK       L  + L +N+I+ L+   FS    +  + LS N L   P +TF  L S  + + L+ N +S +    FN       D + L ++++  N   C C+ +QWL  + K       I  C  P E A K
Sbjct:  270 VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITEL-PKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQT-IAKGTFSPLRAIQTMHLAQNP--------FICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDC---FADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAEL-RLNNNEFTVLEAT--GIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRL-LSLHGNDISVVPEGAFN-------DLSALSHLAIGANPLYCDCN-MQWLSDWVKSEYKEPGIARCAGPGEMADK 887          

HSP 2 Score: 79.337 bits (194), Expect = 4.223e-14
Identity = 62/185 (33.51%), Postives = 86/185 (46.49%), Query Frame = 2
Query:  140 LLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF 685
            L+L I N V      CP  C C+  +VDC   AL+ VP+ I  +   LDL+ N I  ++   F  L +L+ L+L  N++  I   AF  L  L  L L  N L  L PE    G  KL  + L  N+ + IP      A  +  L LD N+I S + D +F     L+ L L  N I  ++   F
Sbjct:   15 LVLAILNKVAPQA--CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQ-LFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQI-SCIEDGAFRALRDLEVLTLNNNNITRLSVASF 195          

HSP 3 Score: 54.299 bits (129), Expect = 1.482e-6
Identity = 58/230 (25.22%), Postives = 88/230 (38.26%), Query Frame = 2
Query: 1133 PHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWL 1822
            P  +P + + L L  NNI +I + DF  L +L+ L L +N I +IE  +F DL  L  L L  N L      +F    KL  L+L +                                                   NQI  +    F G+V+I+ + L  N +       F  L    + + LN N ++ +S+   S N++P    KL+   L +N   C CH + WL
Sbjct:   50 PRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSE---------------------------------------------------NQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEV-LTLNNNNITRLSV--ASFNHMP----KLRTFRLHSNNLYCDCH-LAWL 220          

HSP 4 Score: 51.9878 bits (123), Expect = 7.768e-6
Identity = 37/119 (31.09%), Postives = 58/119 (48.74%), Query Frame = 2
Query:  167 CLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNS-FQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNE 520
            C     CP  C+C   +VDC +Q L  +P+ I      L L+ N    L     F+ L  L+++  S+N++ +I E AF G S +  + L +N L  +  + F KGL  L  + L +N 
Sbjct:  492 CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMF-KGLESLKTLMLRSNR 609          
BLAST of Epiphycan vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 100.523 bits (249), Expect = 1.473e-20
Identity = 158/643 (24.57%), Postives = 275/643 (42.77%), Query Frame = 2
Query:  176 VFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDS---NKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKS-----CGLTSISGDFLK--------PFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDL---GFNRLTRIES-GIFHRMPKLISLNLEQQNPVLLTIAP---------------------------------NSFVLSNLESIELQGNRIKFDATA----GPIFDNLPK-------LVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID-FNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQIL-CNIPNEKAGK 1894
            V  CP  C C+++ VDCR + L ++P  +   +T + L  N IK +   +F     L+R+ LS+N++ E+  +AF GL +L +L L  N ++ L P++  +GL  L  + L  N+   + V     +  LNL S   NK+++ +   +F     +QT+ L +N         F+   + K     L  N +E   A    P + +   +    +K    +  E   +  +G     F DL       C  T++     K        P + ++L  L+ +E ++L++     F+ L  L+ +N +  KI+D  +  F   + +  + +  N L N  H++     SLK L L+SN I  +  D F  L++++ L L  N I ++   +FD L SL++L+L    FN    +   G + R  ++++ N   Q P  L   P                                 ++ V  + + +++    I  D T     G  F  +PK       L  + L +N+I+ L+   FS    +  + LS N L   P +TF  L S  + + L+ N +S +    FN       D + L ++++  N   C C+ +QWL  + K       I  C  P E A K
Sbjct:  274 VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITEL-PKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQT-IAKGTFSPLRAIQTMHLAQNP--------FICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDC---FADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAEL-RLNNNEFTVLEAT--GIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRL-LSLHGNDISVVPEGAFN-------DLSALSHLAIGANPLYCDCN-MQWLSDWVKSEYKEPGIARCAGPGEMADK 891          

HSP 2 Score: 78.9518 bits (193), Expect = 4.560e-14
Identity = 62/185 (33.51%), Postives = 86/185 (46.49%), Query Frame = 2
Query:  140 LLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF 685
            L+L I N V      CP  C C+  +VDC   AL+ VP+ I  +   LDL+ N I  ++   F  L +L+ L+L  N++  I   AF  L  L  L L  N L  L PE    G  KL  + L  N+ + IP      A  +  L LD N+I S + D +F     L+ L L  N I  ++   F
Sbjct:   15 LVLAILNKVAPQA--CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQ-LFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQI-SCIEDGAFRALRDLEVLTLNNNNITRLSVASF 195          

HSP 3 Score: 54.299 bits (129), Expect = 1.534e-6
Identity = 58/230 (25.22%), Postives = 88/230 (38.26%), Query Frame = 2
Query: 1133 PHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWL 1822
            P  +P + + L L  NNI +I + DF  L +L+ L L +N I +IE  +F DL  L  L L  N L      +F    KL  L+L +                                                   NQI  +    F G+V+I+ + L  N +       F  L    + + LN N ++ +S+   S N++P    KL+   L +N   C CH + WL
Sbjct:   50 PRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSE---------------------------------------------------NQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEV-LTLNNNNITRLSV--ASFNHMP----KLRTFRLHSNNLYCDCH-LAWL 220          

HSP 4 Score: 51.9878 bits (123), Expect = 8.106e-6
Identity = 37/118 (31.36%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  167 CLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNS-FQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNN 517
            C     CP  C+C   +VDC +Q L  +P+ I      L L+ N    L     F+ L  L+++  S+N++ +I E AF G S +  + L +N L  +  + F KGL  L  + L +N
Sbjct:  496 CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMF-KGLESLKTLMLRSN 612          
BLAST of Epiphycan vs. Ensembl Celegans
Match: lron-15 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q18902])

HSP 1 Score: 91.2781 bits (225), Expect = 3.399e-18
Identity = 144/522 (27.59%), Postives = 239/522 (45.79%), Query Frame = 2
Query:  269 DVTILDLSFNLIKSLSNNSFQTL-INLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKG-LIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNT-----------------------GLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLK---FLHLQSNNIRQIRQDDF------KSLTNLKELHLKKNSILSIETN-SFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRI-KFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQL--IDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTIS 1714
            D+  LD S N I++++ N+F+ L + L +L LSHN +  I   A   L +L+ LHLENN + VL   TF++  L  L  +YL NN+   IP L   H+  + L     R   + K  L  T                        LQ++ L  N I  +  T+ V  ++     L    N +  +   +F   +  +  L++  N++     VE +   F      Q LDL    +  +    LK F  + L  L L+EN M+ +   +A R L NL  LNL   K++  D D+       L  LF+ +N L + PH + + +K    L +  N I  +++         +  + ++ L+L  N I ++     F+ +  LT +D+ FNR+  I   +F ++  L SL L+      L   P+ F L  L  + L  N+I K D  +     +LPKL +LSL  NQ+  + EN+F  S + +L  ++L+ N +    +++F  L  +   +RL+ N + TI+
Sbjct:  119 DIQTLDFSNNQIQTVNVNAFRGLEMKLTQLDLSHNNLSVIPTWALTYLHSLQILHLENNRIDVLRSNTFDETQLNNLQFLYLDNNQLRIIPNLAFNHLRLVVLMLANNRITEIQKMSLPQTLKFLVLRNNLLTQIPYVALNDLKTLQSIDLEGNNITHLMDTNEVTFESEMKVILRN--NKVRRLDKHSFRSFR-KIRELDISYNQI---QTVEDS--SFETVGHMQSLDLSYNRIAYLPRGMLKNFAKT-LKTLKLAEN-MIHATP-EALRDLRNLTHLNLNGNKLNRIDGDVLKGCTDTLVELFIANNYLEHIPHGVLSGMKQLEHLDISKNKIMSLKKPTSLLSITKEETSTVRRLNLAGNRINNMSDYLIFEHMPLLTYVDVSFNRIRFISPRVFEKLKNLESLFLQNNQ---LAHFPSLFRLDKLRHLMLDNNQIQKIDNFS---LADLPKLQHLSLAGNQLDIITENMFGSSSSSELKSLNLAHNKIHSISSRSFSDL-DNLQQLRLSHNNIRTIT 622          

HSP 2 Score: 83.1889 bits (204), Expect = 8.659e-16
Identity = 144/539 (26.72%), Postives = 246/539 (45.64%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMK-----------------EINEN-------AFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP--VLKAT-HMTKLNLDSNKIRSAVVDKSFLLNTGLQT-----LILTKNEIKEINQTDF-VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKL-----------LNSTIVE----QALTGFNGA--TGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLI----NCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISL---NLEQQNPVLLTIAPNSFVLSNLESIELQGNR-IKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID 1720
            LD+S+N I+++ ++SF+T+ +++ L LS+N +                  ++ EN       A   L NL +L+L  N L+ +  +        L+ +++ NN  E IP  VL     +  L++  NKI S     S L  T  +T     L L  N I   N +D+ +      LT + +  N +  I+   F  +KN L +L L+ N+L           L   +++    Q +  F+ A     Q L L    L  I+ +       S+L  L+L+ N  + SI + +F  LDNLQ L L+   I     + FS +  L +L ++ N +I    +  ++LPA L  LHL  NN+ +I +D F+S ++L+ L L  N+           ++ +  LDL  N++  I+     R  + +SL   ++E+ N  LL  A      + L SI++  N  I  D+ A   F    KL ++ L  N I  L +  F    ++  +D+S N ++     TF    ++ + + +N NKLS I ++
Sbjct:  315 LDISYNQIQTVEDSSFETVGHMQSLDLSYNRIAYLPRGMLKNFAKTLKTLKLAENMIHATPEALRDLRNLTHLNLNGNKLNRIDGDVLKGCTDTLVELFIANNYLEHIPHGVLSGMKQLEHLDISKNKIMSLKKPTSLLSITKEETSTVRRLNLAGNRIN--NMSDYLIFEHMPLLTYVDVSFNRIRFISPRVFEKLKN-LESLFLQNNQLAHFPSLFRLDKLRHLMLDNNQIQKIDNFSLADLPKLQHLSLAGNQLDIITENMFGSSSSSELKSLNLAHNK-IHSISSRSFSDLDNLQQLRLSHNNIRTITSMTFSNLRNLRYLDLSHNRIIKILPSALYQLPA-LDVLHLDHNNLNEIDRDAFRSFSDLQSLKLSHNAFRRFSCEFLGSISQVHQLDLSSNQINEIDIFCIARGIRKLSLASNSVEKINRKLLQDA------TELTSIDISHNGIIDVDSDA---FCECRKLSHIKLSHNYIRNLWKGTFQYQESLHTLDISFNDILFLHQGTFGK--NNILQLHVNNNKLSRIPLE 837          

HSP 3 Score: 67.781 bits (164), Expect = 4.649e-11
Identity = 120/464 (25.86%), Postives = 201/464 (43.32%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPET-FNKGLIKLLHVYLGN-NEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLN-TGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFD-SKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAK-----LTHLFMNDNNLINCP----HRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIK--FDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            L+L+ N I S+S+ SF  L NL++L+LSHN ++ I    F  L NLR L L +N +  + P   +    + +LH+   N NE ++      + +  L L  N  R    +  FL + + +  L L+ N+I EI+    +      +  L+L  NS+E I                    KLL              AT    +D+   G+  +  D    F +  KL H+ LS N  ++++    F+  ++L  L+     IS  DI F          +  L +N+N L   P        ASL  L L  NNI+ +      S  NL  L    N + SIE  +F++L SL  LDL  N +T      F  +   IS ++   N  L ++    F   +++S+ +  N+I    +    P    L K+V L +  N + +++   F   ++++ +++S N +
Sbjct:  587 LNLAHNKIHSISSRSFSDLDNLQQLRLSHNNIRTITSMTFSNLRNLRYLDLSHNRIIKILPSALYQLPALDVLHLDHNNLNEIDRDAFRSFSDLQSLKLSHNAFRRFSCE--FLGSISQVHQLDLSSNQINEID----IFCIARGIRKLSLASNSVEKI------------------NRKLL------------QDATELTSIDISHNGIIDVDSD---AFCECRKLSHIKLSHN-YIRNLWKGTFQYQESLHTLD-----ISFNDILFLHQGTFGKNNILQLHVNNNKLSRIPLEALSSTMASLHLLDLAHNNIKIVDSSQLTSFGNLSILSFANNKVDSIEDGAFENLLSLKILDLSNNPVTSWSPTAFRDLSHSIS-SINMANTGLFSMP--KFSHRSIQSLNISCNKIYELSEKDLAP----LTKVVALDISHNNLKQISSMAFEPLIHLKQLNVSANPI 998          

HSP 4 Score: 65.0846 bits (157), Expect = 3.345e-10
Identity = 103/411 (25.06%), Postives = 178/411 (43.31%), Query Frame = 2
Query:  731 NSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLS--ENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH---------------------------LQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPK-LISLNLEQQNPVLLTIAPNSFV-LSNLESIELQG---NRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLIS---SAIDIRLN-----------------MNKLSTISIDFNSTNYL-PIDFAKLKNIS---LENNQ 1789
            N ++ +   AF  ++  L  L+L  N L  S I   ALT  +     Q L L++  +  +  +    F +++L++L     +N+ L+ I N AF  L  L +L LA  +I++   + S    L  L + +N L   P+     LK L                            L++N +R++ +  F+S   ++EL +  N I ++E +SF+ +  + SLDL +NR+  +  G+     K L +L L +    ++   P +   L NL  + L G   NRI  D   G        LV L + +N +  +   + SG   ++ +D+S N ++     T L  I+   ++   RLN                 M  L+ + + FN   ++ P  F KLKN+    L+NNQ
Sbjct:  128 NQIQTVNVNAFRGLEMKLTQLDLSHNNL--SVIPTWALTYLHS---LQILHLENNRIDVLRSN---TFDETQLNNLQFLYLDNNQLRIIPNLAFNHL-RLVVLMLANNRITEIQ-KMSLPQTLKFLVLRNNLLTQIPYVALNDLKTLQSIDLEGNNITHLMDTNEVTFESEMKVILRNNKVRRLDKHSFRSFRKIRELDISYNQIQTVEDSSFETVGHMQSLDLSYNRIAYLPRGMLKNFAKTLKTLKLAEN---MIHATPEALRDLRNLTHLNLNGNKLNRIDGDVLKGCT----DTLVELFIANNYLEHIPHGVLSGMKQLEHLDISKNKIMSLKKPTSLLSITKEETSTVRRLNLAGNRINNMSDYLIFEHMPLLTYVDVSFNRIRFISPRVFEKLKNLESLFLQNNQ 521          

HSP 5 Score: 53.5286 bits (127), Expect = 1.066e-6
Identity = 122/459 (26.58%), Postives = 205/459 (44.66%), Query Frame = 2
Query:  263 SIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPV------LKATHMTKLNLDSNKIRSAVVDKSFLLNTG-LQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQI---------RQDDFKS-LTNLKELHLKKNSILSIETNSFD------DLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLN 1567
            + ++T +D+S N I  + +++F     L  +KLSHN ++ + +  F    +L  L +  ND+  LH  TF K  I  LHV   NN+  +IP+      + + H+  L+L  N I+  +VD S L + G L  L    N++  I    F NL + K+  L+   N + + +  AF  + +S+ ++ +    L        ++  F+  +  Q L++    +  +S   L P   +K+  LD+S N+ LK I + AF  L +L+ LN++   I+   +     + KL  L ++D   +    RLP S  F   Q NN++           R     S L+NL  LH      + I+ ++ D      D   L  L +    LT+IE G F  + +   + +E  N                 SIE   +RI FD   G        +++LSL DN++T  N
Sbjct:  747 ATELTSIDISHNGIIDVDSDAFCECRKLSHIKLSHNYIRNLWKGTFQYQESLHTLDISFNDILFLHQGTFGKNNILQLHV--NNNKLSRIPLEALSSTMASLHL--LDLAHNNIK--IVDSSQLTSFGNLSILSFANNKVDSIEDGAFENLLSLKILDLSN--NPVTSWSPTAFRDLSHSISSINMANTGLF-------SMPKFSHRS-IQSLNISCNKIYELSEKDLAPL--TKVVALDISHNN-LKQISSMAFEPLIHLKQLNVSANPITHLTNEHIQQLYKLETLHVSDMPFL---LRLPDSHAF--GQMNNLKHFFLYNIPDMARPYQISSILSNLPPLH---TIYVDIKESALDRQFYTADTRLLRHLVVAGRNLTKIEVGAFATI-RGFRVRIEIHN----------------SSIEEFPSRI-FDTLTG------ISILSLSLTDNKLTTFN 1154          
BLAST of Epiphycan vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 83.5741 bits (205), Expect = 7.019e-16
Identity = 152/628 (24.20%), Postives = 242/628 (38.54%), Query Frame = 2
Query:  155 YNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFN-------KGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNE---------IKEIN-QTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS-DPDIRFSAMAKLTHLFMNDNNLINCPHRLP-------ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILS----------IETNSFD--DLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDAT----------AGPIFD--NLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLP----IDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQILCNIPN 1879
            Y   C     CP+PC CT  +VDCR   L  VP  +    T + L  N I S+ ++SF+ L NL RL LS N + EI   AF+GL NL  L L  N+++ L  +TF          L       +    F+ +P L     + L+L  N I+S + + +F   T L TL L KN          + +IN Q +             L+      +    F   K S   + +  +     +I       + G T    +D    GL +I      P F ++L    LS N++     N     L+NL++L+L+   I+   D  F  ++KL  L +NDN L    H          ++L+ L L  NNI+      F   T ++E+ +  N +L           + +NS    D+          N   +     F   P+    +     P   +        SN +++    +RI FD T            P  D   L  L  L L  N++  L  N FS    +  + +S N L     +   PL  +       +N L  +S+  N  ++LP     +   + +I++ +N   C C+   +    +   +      C  PN
Sbjct:  250 YKKTCETAEICPLPCTCTGTTVDCRDSGLTYVPTNLPPSTTEIRLEQNQISSIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGSLQLLLLNANQLTCIRRGTFDHVPKL-----SMLSLYDNDIKS-ISEVTFQNLTSLSTLHLAKNPLICDCNLQWLAQINLQKNIETSGARCEQPKRLRKKKFATLPPNKF-KCKGSESFVSMYADSCFIDSICPTQCDCY-GTT----VDCNKRGLNTIPTSI--PRFATQLL---LSGNNISTVDLNSNIHVLENLEVLDLSNNHITFINDKSFEKLSKLRELRLNDNKL----HHFSSMVLDEQSNLEILDLSGNNIQCFSSIFFNKATRIREIKVIGNDLLCDCRILPLMSWLRSNSSHSIDIPPCQQFQYSDNESDKQRCAAF---PEETCSDDSNLCPPKCSCLDRVVRCSN-KNLTSFPSRIPFDTTELYLDANYINEIPAHDLNRLYSLTKLDLSHNRLISLENNTFSNLTRLSTLIISYNKL-----RCLQPLAFNG------LNALRILSLHGNDISFLPQSAFSNLTSITHIAVGSNSLYCDCNMAWFSKWIKSKFIEAGIARCEYPN 841          

HSP 2 Score: 67.781 bits (164), Expect = 4.499e-11
Identity = 127/538 (23.61%), Postives = 200/538 (37.17%), Query Frame = 2
Query:  185 CPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIR-------SAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAE----AFVPVKNSLINLELEGNKLLNS----------TIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIR-FSAMAKLTHLFMNDNNLIN-----------------------CPHR-----LPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLES-IELQGNRIKFDATAGPIFDNLPKLVNLSLRD-----NQITKLNENLFSGSVNIQLIDLSMN 1621
            CP  C C   +V C  Q L +VP+ I  D   LDL  N I  +  N F +L+NLK L+L  N++  I+  +F  L  L+ L L  N +  L    F   L KL H+ L  N+   +    +     +  LNLD N I        S+ V    L   G +     +       Q D  N        L      LE    +       P+     ++E+  +K +            T     +           +D +  GLT +  +      + +L      E + + SI + +F+ L NL  L+L+K  I++   + F  +  L  L +  NN+ +                       C  R     +P  L  L L  N+I+ I +  F++LT+L  LHL KN ++  + N    L  L  ++L  N  T   SG     PK +      +     T+ PN F     ES + +  +    D+      D     V+ + R        I +    L     NI  +DL+ N
Sbjct:   17 CPAECVCVDRTVSCVGQQLTEVPQNIPNDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNL-KLTHLDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLENNVISSWVSLEVLTLNGNRLTTFEEPSNARFRQLDLFNNPWNCDCRLRWMRKWLEKAEGQNKTVCATPLNLQGSSIEILQDKFMTCSGNRKRRYKKTCETAEICPLPCTCTGTTVDCRDSGLTYVPTNLPPSTTEIRL------EQNQISSIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGSLQLLLLNANQLTCIRRGTFDHVP-KLSMLSLYDNDIKSISEVTFQNLTSLSTLHLAKNPLI-CDCN----LQWLAQINLQKNIET---SGARCEQPKRL------RKKKFATLPPNKFKCKGSESFVSMYADSCFIDSICPTQCDCYGTTVDCNKRGLNTIPTSIPRFATQLLLSGNNISTVDLNSN 532          

HSP 3 Score: 66.2402 bits (160), Expect = 1.601e-10
Identity = 65/248 (26.21%), Postives = 102/248 (41.13%), Query Frame = 2
Query: 1133 PHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQILCNIP 1876
            P  +P     L LQ N I +I  +DF SL NLK L L  N I++I   SF  L  L  L L  NR+  +   +F    KL  L+L + +  +++ A            +LQ          GP F     L  L+L  N I  L  N+ S  V++++                         + LN N+L+T     N         A+ + + L NN WNC C +++W+  + +    +++ +C  P
Sbjct:   39 PQNIPNDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTHLDLSENDITVVSDA------------QLQ----------GPEF-----LEVLNLDKNHIFCLENNVISSWVSLEV-------------------------LTLNGNRLTTFEEPSN---------ARFRQLDLFNNPWNCDC-RLRWMRKWLEKAEGQNKTVCATP 224          
BLAST of Epiphycan vs. Ensembl Celegans
Match: sma-10 (Leucine-rich repeats and immunoglobulin-like domains protein sma-10 [Source:UniProtKB/Swiss-Prot;Acc:Q965M2])

HSP 1 Score: 78.5666 bits (192), Expect = 1.955e-14
Identity = 137/607 (22.57%), Postives = 252/607 (41.52%), Query Frame = 2
Query:  128 FTFCLLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDN--LPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHF-RKLILNRDQIL--CNIPNEKAGKNLFLVMVNCSDV 1930
            + F   +V ++ VC+ +      C C  + VDC    L ++P  I  +  IL LS N I+S+  +  +    L+ L +S+N ++ I+   F  L NL+ L++  N               +L  +  G++E          H+ KL+L SN I S V  +       ++++ L++N I  + +          +  L L  NS+ +I  + F    N+L+ L+L  N +   T + Q          F F  L+                  KL  LDL+ N M++ +   AF  L +LQ ++LA+  +                 ++D     C       LK L+L +N ++ + +     LT+L+ L L  N I S   +S+     L  L L  NR+  + SG F  + +L  L L   +  + ++   + V +S+L  ++L  N +      G +  N  +P L +L   +NQ+  + +  F     ++ +DL+ N +     + F PL                                +LK + + ++   C C QI WL  +  +L L++  I+  C+ P   A  +L++V ++ +++
Sbjct:   12 YDFLPKVVTFDTVCIGL------CHCVGNVVDCSSLDLSEIPTTIPNNTRILLLSDNEIESIDKSRLKGFYFLQTLDISNNIIRHIDFEFFYNLPNLKILNIRKN---------------RLARIPRGSHEL--------GHLEKLDLRSNLI-STVTSEELSYLAAVRSVDLSRNLISYLPKP--TTSAKVNIEKLDLASNSITDIGTDHFSSF-NTLVTLKLARNHI---TTLNQ----------FSFSRLR------------------KLESLDLTRN-MIREVRFLAFNQLPSLQNVSLARNDVYR---------------LDDGMFYAC-----EGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANS--IDSLHKFALVGMSSLHKLDLSSNTLAVCVEDGAVLYNTSMPFLRSLRFTNNQLRVIPKRAFERFPALEELDLTDNPIATIHPEAFEPL--------------------------------ELKRLVMNSSSILCDC-QISWLASWIYRLKLDKSSIIAKCSYPPPLA--DLYVVAIDTANL 496          
BLAST of Epiphycan vs. Ensembl Celegans
Match: sma-10 (Leucine-rich repeats and immunoglobulin-like domains protein sma-10 [Source:UniProtKB/Swiss-Prot;Acc:Q965M2])

HSP 1 Score: 78.5666 bits (192), Expect = 1.955e-14
Identity = 137/607 (22.57%), Postives = 252/607 (41.52%), Query Frame = 2
Query:  128 FTFCLLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDN--LPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHF-RKLILNRDQIL--CNIPNEKAGKNLFLVMVNCSDV 1930
            + F   +V ++ VC+ +      C C  + VDC    L ++P  I  +  IL LS N I+S+  +  +    L+ L +S+N ++ I+   F  L NL+ L++  N               +L  +  G++E          H+ KL+L SN I S V  +       ++++ L++N I  + +          +  L L  NS+ +I  + F    N+L+ L+L  N +   T + Q          F F  L+                  KL  LDL+ N M++ +   AF  L +LQ ++LA+  +                 ++D     C       LK L+L +N ++ + +     LT+L+ L L  N I S   +S+     L  L L  NR+  + SG F  + +L  L L   +  + ++   + V +S+L  ++L  N +      G +  N  +P L +L   +NQ+  + +  F     ++ +DL+ N +     + F PL                                +LK + + ++   C C QI WL  +  +L L++  I+  C+ P   A  +L++V ++ +++
Sbjct:   12 YDFLPKVVTFDTVCIGL------CHCVGNVVDCSSLDLSEIPTTIPNNTRILLLSDNEIESIDKSRLKGFYFLQTLDISNNIIRHIDFEFFYNLPNLKILNIRKN---------------RLARIPRGSHEL--------GHLEKLDLRSNLI-STVTSEELSYLAAVRSVDLSRNLISYLPKP--TTSAKVNIEKLDLASNSITDIGTDHFSSF-NTLVTLKLARNHI---TTLNQ----------FSFSRLR------------------KLESLDLTRN-MIREVRFLAFNQLPSLQNVSLARNDVYR---------------LDDGMFYAC-----EGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANS--IDSLHKFALVGMSSLHKLDLSSNTLAVCVEDGAVLYNTSMPFLRSLRFTNNQLRVIPKRAFERFPALEELDLTDNPIATIHPEAFEPL--------------------------------ELKRLVMNSSSILCDC-QISWLASWIYRLKLDKSSIIAKCSYPPPLA--DLYVVAIDTANL 496          
BLAST of Epiphycan vs. Ensembl Celegans
Match: sma-10 (Leucine-rich repeats and immunoglobulin-like domains protein sma-10 [Source:UniProtKB/Swiss-Prot;Acc:Q965M2])

HSP 1 Score: 77.411 bits (189), Expect = 4.640e-14
Identity = 137/607 (22.57%), Postives = 252/607 (41.52%), Query Frame = 2
Query:  128 FTFCLLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDN--LPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHF-RKLILNRDQIL--CNIPNEKAGKNLFLVMVNCSDV 1930
            + F   +V ++ VC+ +      C C  + VDC    L ++P  I  +  IL LS N I+S+  +  +    L+ L +S+N ++ I+   F  L NL+ L++  N               +L  +  G++E          H+ KL+L SN I S V  +       ++++ L++N I  + +          +  L L  NS+ +I  + F    N+L+ L+L  N +   T + Q          F F  L+                  KL  LDL+ N M++ +   AF  L +LQ ++LA+  +                 ++D     C       LK L+L +N ++ + +     LT+L+ L L  N I S   +S+     L  L L  NR+  + SG F  + +L  L L   +  + ++   + V +S+L  ++L  N +      G +  N  +P L +L   +NQ+  + +  F     ++ +DL+ N +     + F PL                                +LK + + ++   C C QI WL  +  +L L++  I+  C+ P   A  +L++V ++ +++
Sbjct:   12 YDFLPKVVTFDTVCIGL------CHCVGNVVDCSSLDLSEIPTTIPNNTRILLLSDNEIESIDKSRLKGFYFLQTLDISNNIIRHIDFEFFYNLPNLKILNIRKN---------------RLARIPRGSHEL--------GHLEKLDLRSNLI-STVTSEELSYLAAVRSVDLSRNLISYLPKP--TTSAKVNIEKLDLASNSITDIGTDHFSSF-NTLVTLKLARNHI---TTLNQ----------FSFSRLR------------------KLESLDLTRN-MIREVRFLAFNQLPSLQNVSLARNDVYR---------------LDDGMFYAC-----EGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANS--IDSLHKFALVGMSSLHKLDLSSNTLAVCVEDGAVLYNTSMPFLRSLRFTNNQLRVIPKRAFERFPALEELDLTDNPIATIHPEAFEPL--------------------------------ELKRLVMNSSSILCDC-QISWLASWIYRLKLDKSSIIAKCSYPPPLA--DLYVVAIDTANL 496          
BLAST of Epiphycan vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0075614)

HSP 1 Score: 98.2117 bits (243), Expect = 3.211e-20
Identity = 145/527 (27.51%), Postives = 238/527 (45.16%), Query Frame = 2
Query:  266 IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI-PVLKAT--HMTKLNLDSNKIRSAVVDK-SFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLI---NCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPI-DFAKLKNISLENNQWNCSCHQIQWL 1822
            +D+  LD+S N    L  N F TL  L+ L +++N +  I + A  GL NL+ L+L +N +  L  E F +    +  VYL NN    + P L +    +  L+L  N+I S  +DK +F+    L  L L+ N++ ++    F       L  L L+ N LENIAA+ F P+ N+L  L L  NKL                   ++LD  +          L   +   L  LD   N+ L  +  DAFR    LQ LNL   ++    +    M  L  + + +N +    +   +   +L  L L  N +  I    F+ L NL+ L+L +N I  +E  +F+  +S+ ++ L  N L  I +G+F  MP L+ LN+       L       V S L+ ++L  NR+   +    + D+  KL  L +  NQ+ ++  +    S  I+L+ L+ N +      TF+   ++   + L  N+++T  +D  S   LP+ +   L    +  N + C C+ I WL
Sbjct:  277 LDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIF--SDLYTLQILNLRHNQLENIAADTFAPM-NNLHTLLLSHNKL-------------------KYLDAYA----------LNGLYVLSLLSLD---NNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDI-NGLFSNMPSLLWLNISDNR---LESFDYGHVPSTLQWLDLHKNRLSSLSNRFGL-DSELKLQTLDVSFNQLQRIGPSSIPNS--IELLFLNDNLITTVDPDTFMH-KTNLTRVDLYANQITT--LDIKSLRILPVWEHRALPEFYIGGNPFTCDCN-IDWL 757          

HSP 2 Score: 79.337 bits (194), Expect = 1.986e-14
Identity = 145/524 (27.67%), Postives = 216/524 (41.22%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLS-----------------------------NLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTK----LNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKI--SDPDIRFSAMAKLTHLFMNDNNLINCPHRLP--ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSV--NIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMN---KLSTISIDFN 1726
            LDLS N I SL +N F TL  L  L +S N ++++NE  F   S                             +L  L + +ND  VL    F  G ++ L V   NN    +   KA    K    LNL SNKI +   +        +Q + L  N I  +N   F NL   +   L++   +   I    FV +   L+ L L  NKL   T +E  +  F+     Q L+L+   L +I+ D   P   + LH L LS N  LK +D  A  GL  L +L+L    +    PD  F   + L  L +N N L   P  L     L+ + L  N I  +    FK L NL  L L  N + +I  ++F DL +L  L+L  NR+  +E G F                          + S+++++ L GN +        +F N+P L+ L++ DN++    E+   G V   +Q +DL  N L             S++  R  ++   KL T+ + FN
Sbjct:  205 LDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGF--GTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIR-LVLLNLSHNKL---TKLEPEI--FSDLYTLQILNLRHNQLENIAADTFAPM--NNLHTLLLSHNK-LKYLDAYALNGLYVLSLLSLDNNALIGVHPDA-FRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFE-------------------------MTSSIQAVRLDGNELN---DINGLFSNMPSLLWLNISDNRL----ESFDYGHVPSTLQWLDLHKNRL-------------SSLSNRFGLDSELKLQTLDVSFN 671          
BLAST of Epiphycan vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0306307)

HSP 1 Score: 98.2117 bits (243), Expect = 3.211e-20
Identity = 145/527 (27.51%), Postives = 238/527 (45.16%), Query Frame = 2
Query:  266 IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI-PVLKAT--HMTKLNLDSNKIRSAVVDK-SFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLI---NCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPI-DFAKLKNISLENNQWNCSCHQIQWL 1822
            +D+  LD+S N    L  N F TL  L+ L +++N +  I + A  GL NL+ L+L +N +  L  E F +    +  VYL NN    + P L +    +  L+L  N+I S  +DK +F+    L  L L+ N++ ++    F       L  L L+ N LENIAA+ F P+ N+L  L L  NKL                   ++LD  +          L   +   L  LD   N+ L  +  DAFR    LQ LNL   ++    +    M  L  + + +N +    +   +   +L  L L  N +  I    F+ L NL+ L+L +N I  +E  +F+  +S+ ++ L  N L  I +G+F  MP L+ LN+       L       V S L+ ++L  NR+   +    + D+  KL  L +  NQ+ ++  +    S  I+L+ L+ N +      TF+   ++   + L  N+++T  +D  S   LP+ +   L    +  N + C C+ I WL
Sbjct:  277 LDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIF--SDLYTLQILNLRHNQLENIAADTFAPM-NNLHTLLLSHNKL-------------------KYLDAYA----------LNGLYVLSLLSLD---NNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDI-NGLFSNMPSLLWLNISDNR---LESFDYGHVPSTLQWLDLHKNRLSSLSNRFGL-DSELKLQTLDVSFNQLQRIGPSSIPNS--IELLFLNDNLITTVDPDTFMH-KTNLTRVDLYANQITT--LDIKSLRILPVWEHRALPEFYIGGNPFTCDCN-IDWL 757          

HSP 2 Score: 79.337 bits (194), Expect = 1.986e-14
Identity = 145/524 (27.67%), Postives = 216/524 (41.22%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLS-----------------------------NLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTK----LNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKI--SDPDIRFSAMAKLTHLFMNDNNLINCPHRLP--ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSV--NIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMN---KLSTISIDFN 1726
            LDLS N I SL +N F TL  L  L +S N ++++NE  F   S                             +L  L + +ND  VL    F  G ++ L V   NN    +   KA    K    LNL SNKI +   +        +Q + L  N I  +N   F NL   +   L++   +   I    FV +   L+ L L  NKL   T +E  +  F+     Q L+L+   L +I+ D   P   + LH L LS N  LK +D  A  GL  L +L+L    +    PD  F   + L  L +N N L   P  L     L+ + L  N I  +    FK L NL  L L  N + +I  ++F DL +L  L+L  NR+  +E G F                          + S+++++ L GN +        +F N+P L+ L++ DN++    E+   G V   +Q +DL  N L             S++  R  ++   KL T+ + FN
Sbjct:  205 LDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGF--GTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIR-LVLLNLSHNKL---TKLEPEI--FSDLYTLQILNLRHNQLENIAADTFAPM--NNLHTLLLSHNK-LKYLDAYALNGLYVLSLLSLDNNALIGVHPDA-FRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFE-------------------------MTSSIQAVRLDGNELN---DINGLFSNMPSLLWLNISDNRL----ESFDYGHVPSTLQWLDLHKNRL-------------SSLSNRFGLDSELKLQTLDVSFN 671          
BLAST of Epiphycan vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0306308)

HSP 1 Score: 98.2117 bits (243), Expect = 3.211e-20
Identity = 145/527 (27.51%), Postives = 238/527 (45.16%), Query Frame = 2
Query:  266 IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI-PVLKAT--HMTKLNLDSNKIRSAVVDK-SFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLI---NCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPI-DFAKLKNISLENNQWNCSCHQIQWL 1822
            +D+  LD+S N    L  N F TL  L+ L +++N +  I + A  GL NL+ L+L +N +  L  E F +    +  VYL NN    + P L +    +  L+L  N+I S  +DK +F+    L  L L+ N++ ++    F       L  L L+ N LENIAA+ F P+ N+L  L L  NKL                   ++LD  +          L   +   L  LD   N+ L  +  DAFR    LQ LNL   ++    +    M  L  + + +N +    +   +   +L  L L  N +  I    F+ L NL+ L+L +N I  +E  +F+  +S+ ++ L  N L  I +G+F  MP L+ LN+       L       V S L+ ++L  NR+   +    + D+  KL  L +  NQ+ ++  +    S  I+L+ L+ N +      TF+   ++   + L  N+++T  +D  S   LP+ +   L    +  N + C C+ I WL
Sbjct:  277 LDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIF--SDLYTLQILNLRHNQLENIAADTFAPM-NNLHTLLLSHNKL-------------------KYLDAYA----------LNGLYVLSLLSLD---NNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDI-NGLFSNMPSLLWLNISDNR---LESFDYGHVPSTLQWLDLHKNRLSSLSNRFGL-DSELKLQTLDVSFNQLQRIGPSSIPNS--IELLFLNDNLITTVDPDTFMH-KTNLTRVDLYANQITT--LDIKSLRILPVWEHRALPEFYIGGNPFTCDCN-IDWL 757          

HSP 2 Score: 79.337 bits (194), Expect = 1.986e-14
Identity = 145/524 (27.67%), Postives = 216/524 (41.22%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLS-----------------------------NLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTK----LNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKI--SDPDIRFSAMAKLTHLFMNDNNLINCPHRLP--ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSV--NIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMN---KLSTISIDFN 1726
            LDLS N I SL +N F TL  L  L +S N ++++NE  F   S                             +L  L + +ND  VL    F  G ++ L V   NN    +   KA    K    LNL SNKI +   +        +Q + L  N I  +N   F NL   +   L++   +   I    FV +   L+ L L  NKL   T +E  +  F+     Q L+L+   L +I+ D   P   + LH L LS N  LK +D  A  GL  L +L+L    +    PD  F   + L  L +N N L   P  L     L+ + L  N I  +    FK L NL  L L  N + +I  ++F DL +L  L+L  NR+  +E G F                          + S+++++ L GN +        +F N+P L+ L++ DN++    E+   G V   +Q +DL  N L             S++  R  ++   KL T+ + FN
Sbjct:  205 LDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGF--GTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIR-LVLLNLSHNKL---TKLEPEI--FSDLYTLQILNLRHNQLENIAADTFAPM--NNLHTLLLSHNK-LKYLDAYALNGLYVLSLLSLDNNALIGVHPDA-FRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFE-------------------------MTSSIQAVRLDGNELN---DINGLFSNMPSLLWLNISDNRL----ESFDYGHVPSTLQWLDLHKNRL-------------SSLSNRFGLDSELKLQTLDVSFN 671          
BLAST of Epiphycan vs. Ensembl Fly
Match: atk (gene:FBgn0036995 transcript:FBtr0331569)

HSP 1 Score: 96.2857 bits (238), Expect = 1.113e-19
Identity = 115/454 (25.33%), Postives = 193/454 (42.51%), Query Frame = 2
Query:  218 VDCRHQALKDVPKGISIDVTI-----LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFD----------------------SKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKL--THLFMNDNNLINCPHRL--PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF--VLSNLESIELQGNRI 1477
            +  +   +  +P   S D+ +     LDLS N I+ L  + FQ  + L+ L L+ NE++++ + +F+G+  L  LHL+ N L                       E ++  +L    +  LNL SNK+  A+ D  F  N+ L+ L L++N I+ I+ T F                             + SL  L+L GN LL+ ++      G       + +DL    ++ I  D +  + +                       KL +LDLS N  +++++  A +GLD LQ   LA  K+ +  D  F  +  L  +H   N    I  P       SL FL+L +N+ R +     +S+ NL+ L L  N +  + T     L  L  L +  N++ RI+   F  MP+L  L++  +N  L +I   +F  V  N+  +++ GN I
Sbjct:  528 ISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLG----------------------EADERALLPLAELRNLNLQSNKL-EAITDNFFSNNSRLEQLDLSRNLIRSISPTAF---------------------------DTQRSLEYLDLSGNALLDISV------GLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNE-IRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYI-SPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSM--RNNQLRSIKERTFRNVRGNIAILDVDGNPI 921          

HSP 2 Score: 88.9669 bits (219), Expect = 2.058e-17
Identity = 121/459 (26.36%), Postives = 203/459 (44.23%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHR--LP-ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIEL---QGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            LD+S NL+  L   + +    L++L L+HN ++ I  +A + +  LR L + NN LS   P  F   L  L  + L  N+F ++    +     + +L+L  N +   +   SF  N  L+TL ++ NE+ +I+ +  +             +  L  + A ++  +K+ +  L           IVE+             + LK   +TS+     K      L  LDLS+N  ++ +    F+G   L++L+LA+ ++    D  F  + +L  L + +N L     R  LP A L+ L+LQSN +  I  + F + + L++L L +N I SI   +FD   SL  LDL  N L  I  G+ +                          L+NL  I+L   Q +RI+ D   G  + N   +V + L +N I +L +  F     +Q +DLS N +
Sbjct:  363 LDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPF-WNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGL-IELAPNSFRHNPLLETLNISSNELTKIHSSTLI------------HLERLFEVDA-SYNQLKSVIAGL---------PRIVER-------------ISLKGNQITSLPAAASKDLQLPNLRMLDLSQNR-IEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGN--------------------------LNNLRDIDLSYNQISRIQSDVIGG--WRN---VVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEI 752          

HSP 3 Score: 87.0409 bits (214), Expect = 8.687e-17
Identity = 131/509 (25.74%), Postives = 231/509 (45.38%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPET-------------FNK------GLIKLL-HVYLGNNEFEKIPV-----LKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTG--FNGATGFQFLDLKSCGLTSISGDFLKPFFDSK--LHHLDLSENSMLK-SIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPH----RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQN-PVLLTIAPNSFVLSNLESIELQGNRIKFDAT----------------------AGPIFDNLPKLVNLSLRDNQITKLNENLFSG-SVNIQLIDLSMNSL 1627
            LDL+ N    + +     L +L+RL LS N + E+  N+F     L  L++ +N+L+ +H  T             +N+      GL +++  + L  N+   +P      L+  ++  L+L  N+I   +    F     L+ L L +NE++++  T F+ ++  +L  L    N L      A +P+   L NL L+ NKL       +A+T   F+  +  + LDL    + SIS       FD++  L +LDLS N++L  S+       L+NL+ ++L+  +IS    D+       +  + +++N ++         LP  L++L L SN IR +     K L  L+E  L  N ++ ++ + F++L SL +    +N+L  I    FH    L+ LNL   +   +  I   S  + NLE ++L  N +K  +T                       G  F+ +P+L  LS+R+NQ+  + E  F     NI ++D+  N +
Sbjct:  435 LDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQ-LPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQE--NQLGEADERALLPLA-ELRNLNLQSNKL-------EAITDNFFSNNSRLEQLDLSRNLIRSIS----PTAFDTQRSLEYLDLSGNALLDISV---GLGNLNNLRDIDLSYNQISRIQSDV-IGGWRNVVEIRLSNNLIVELQQGTFRNLP-KLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRS--MRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPI 921          

HSP 4 Score: 80.1073 bits (196), Expect = 9.467e-15
Identity = 111/424 (26.18%), Postives = 191/424 (45.05%), Query Frame = 2
Query:  728 MNSLENIAAEAFVPVKNSLINLELEG-NKLLNSTIVE------QALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVL---SNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMN--SLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDF---AKLKNISLENNQW-NCSCHQIQWLLHFRKLILNRDQILCNIPNEKAGKNLFLVMVNCSDVILSRILS 1951
            +N LEN   E FV V+  L ++  E  N ++N   +       + L  F+G     +L +++  L  +     +     KL H+ ++  S L  ++   F GL +L+ L+L+   ++   I   A+++L +L                SLK  H Q +++  + +   K L +LK+L L  N I  IE  SF DL +L+ L L  NR+T ++ G F R P+L ++ L  QN ++  I P S +    S +E++ +  N I        + D LP+L  L +  N +++L      G   ++ + L+ N   LI   A   +P +    ++R+  N LS+          LP+ F     LK + L  NQ+       +  L   R+L L+ + ++   PN     N  L  +N S   L++I S
Sbjct:  108 LNELENGLVEIFV-VEPQLRSIPAESLNGMINMLAITIQSEELKHLPDFSGLLSLTYLSVQTGALQELPSHLFRHL--PKLQHIHITGGSGLTRLEAGLFDGLISLKNLDLSHNGLNW--IHLRALSRLPNL---------------VSLKLSHNQISDVGMVGRI-VKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYL--QNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALR---ELRMRNNSLSS---------DLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFR-HNPLLETLNISSNELTKIHS 495          

HSP 5 Score: 70.4774 bits (171), Expect = 9.939e-12
Identity = 74/286 (25.87%), Postives = 130/286 (45.45%), Query Frame = 2
Query: 1079 AMAKLTHLFMNDNNLINCPH---RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF------------------------------------------VLSNL----ESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQ 1789
            A+ +L +L M+ N L   P+   R   +L+ LHL  N++R I +D   ++  L+EL ++ NS+ S     F +L  L  LDL  N+  R++S +   +P L  L+L +    L+ +APNSF                                          V++ L    E I L+GN+I     A      LP L  L L  N+I +L  + F G++ ++++ L+ N L      +F+ +    + + L  N+L     + +    LP+  A+L+N++L++N+
Sbjct:  356 ALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENG--LIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLEL-LHLQENQLG----EADERALLPL--AELRNLNLQSNK 632          

HSP 6 Score: 70.0922 bits (170), Expect = 1.359e-11
Identity = 123/500 (24.60%), Postives = 214/500 (42.80%), Query Frame = 2
Query:  266 IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVG-----LSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAA-EAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKI-SDPDIRFSAMAKLTHLFMNDNNLINCPHRLPA---SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTN 1735
            I +  LDLS N +  +   +   L NL  LKLSHN++ ++     VG     L +L+ L L+NN ++V+                  +  F  +P     ++++L+L+ N+I + +   +FL    L+T+ L  N I+ I+    +    + +  + +  N + ++ A  A +     L  L++ GN L  S +   AL G                                L  L L+ N  L+ I+ DA   +  L+ L +    + SD  + F  +  L  L +  N       +L A   SL+ L L  N + ++  + F+    L+ L++  N +  I +++   L  L  +D  +N+L  + +G+  R+ + ISL   Q    L   A     L NL  ++L  NRI+     G  F    +L  LSL  N++ +L +  F G   ++L+ L  N L     +  LPL +   ++ L  NKL  I+ +F S N
Sbjct:  208 ISLKNLDLSHNGLNWIHLRALSRLPNLVSLKLSHNQISDV---GMVGRIVKDLEHLKKLRLDNNLITVIE-----------------DGSFVDLP-----NLSELHLNDNRI-TELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLL--SELPYGALRGH-----------------------------GTLEQLHLNHNH-LRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGL-PRIVERISLKGNQIT-SLPAAASKDLQLPNLRMLDLSQNRIEQLPRHG--FQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPL-AELRNLNLQSNKLEAITDNFFSNN 644          

HSP 7 Score: 67.3958 bits (163), Expect = 8.098e-11
Identity = 123/517 (23.79%), Postives = 211/517 (40.81%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETF---NKGLIKLLHVYLGNNEFEKIPVLKA-----THMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMND---NNLINCPHRLPASLKFLHLQSNNIRQIRQDDFK--SLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRI-KFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQ 1789
            L L  NLI  + + SF  L NL  L L+ N + E+   AF+    L+ ++L+NN +  +HPE+    +   ++ +H+Y  NNE   +  L+A       +  L++  N + S +   +   +  L+ L L  N ++ I +   +             M +L  +                    ++ N+++       F    G + LDL       +    L       L  LDLSEN +++   N +FR    L+ LN++  +++   I  S +  L  LF  D   N L +    LP  ++ + L+ N I  +     K   L NL+ L L +N I  +  + F     L  L L  N L +++   F                           +  LE + LQ N++ + D  A      L +L NL+L+ N++  + +N FS +  ++ +DLS N LI   + T      S   + L+ N L  IS+   + N        L++I L  NQ
Sbjct:  263 LRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMY--NNEIGHVEALRALLDALPRLRYLDMSGNLL-SELPYGALRGHGTLEQLHLNHNHLRLIERDALMA------------MPALREL--------------------RMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGL--PSLRRLDLSENGLIELAPN-SFRHNPLLETLNISSNELTK--IHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSF-------------------------IGIQRLELLHLQENQLGEADERA---LLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRN-LIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGNLN-------NLRDIDLSYNQ 703          
BLAST of Epiphycan vs. Ensembl Fly
Match: atk (gene:FBgn0036995 transcript:FBtr0331570)

HSP 1 Score: 96.2857 bits (238), Expect = 1.113e-19
Identity = 115/454 (25.33%), Postives = 193/454 (42.51%), Query Frame = 2
Query:  218 VDCRHQALKDVPKGISIDVTI-----LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFD----------------------SKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKL--THLFMNDNNLINCPHRL--PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF--VLSNLESIELQGNRI 1477
            +  +   +  +P   S D+ +     LDLS N I+ L  + FQ  + L+ L L+ NE++++ + +F+G+  L  LHL+ N L                       E ++  +L    +  LNL SNK+  A+ D  F  N+ L+ L L++N I+ I+ T F                             + SL  L+L GN LL+ ++      G       + +DL    ++ I  D +  + +                       KL +LDLS N  +++++  A +GLD LQ   LA  K+ +  D  F  +  L  +H   N    I  P       SL FL+L +N+ R +     +S+ NL+ L L  N +  + T     L  L  L +  N++ RI+   F  MP+L  L++  +N  L +I   +F  V  N+  +++ GN I
Sbjct:  528 ISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLG----------------------EADERALLPLAELRNLNLQSNKL-EAITDNFFSNNSRLEQLDLSRNLIRSISPTAF---------------------------DTQRSLEYLDLSGNALLDISV------GLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNE-IRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYI-SPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSM--RNNQLRSIKERTFRNVRGNIAILDVDGNPI 921          

HSP 2 Score: 88.9669 bits (219), Expect = 2.058e-17
Identity = 121/459 (26.36%), Postives = 203/459 (44.23%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHR--LP-ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIEL---QGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            LD+S NL+  L   + +    L++L L+HN ++ I  +A + +  LR L + NN LS   P  F   L  L  + L  N+F ++    +     + +L+L  N +   +   SF  N  L+TL ++ NE+ +I+ +  +             +  L  + A ++  +K+ +  L           IVE+             + LK   +TS+     K      L  LDLS+N  ++ +    F+G   L++L+LA+ ++    D  F  + +L  L + +N L     R  LP A L+ L+LQSN +  I  + F + + L++L L +N I SI   +FD   SL  LDL  N L  I  G+ +                          L+NL  I+L   Q +RI+ D   G  + N   +V + L +N I +L +  F     +Q +DLS N +
Sbjct:  363 LDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPF-WNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGL-IELAPNSFRHNPLLETLNISSNELTKIHSSTLI------------HLERLFEVDA-SYNQLKSVIAGL---------PRIVER-------------ISLKGNQITSLPAAASKDLQLPNLRMLDLSQNR-IEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGN--------------------------LNNLRDIDLSYNQISRIQSDVIGG--WRN---VVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEI 752          

HSP 3 Score: 87.0409 bits (214), Expect = 8.687e-17
Identity = 131/509 (25.74%), Postives = 231/509 (45.38%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPET-------------FNK------GLIKLL-HVYLGNNEFEKIPV-----LKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTG--FNGATGFQFLDLKSCGLTSISGDFLKPFFDSK--LHHLDLSENSMLK-SIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPH----RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQN-PVLLTIAPNSFVLSNLESIELQGNRIKFDAT----------------------AGPIFDNLPKLVNLSLRDNQITKLNENLFSG-SVNIQLIDLSMNSL 1627
            LDL+ N    + +     L +L+RL LS N + E+  N+F     L  L++ +N+L+ +H  T             +N+      GL +++  + L  N+   +P      L+  ++  L+L  N+I   +    F     L+ L L +NE++++  T F+ ++  +L  L    N L      A +P+   L NL L+ NKL       +A+T   F+  +  + LDL    + SIS       FD++  L +LDLS N++L  S+       L+NL+ ++L+  +IS    D+       +  + +++N ++         LP  L++L L SN IR +     K L  L+E  L  N ++ ++ + F++L SL +    +N+L  I    FH    L+ LNL   +   +  I   S  + NLE ++L  N +K  +T                       G  F+ +P+L  LS+R+NQ+  + E  F     NI ++D+  N +
Sbjct:  435 LDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQ-LPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQE--NQLGEADERALLPLA-ELRNLNLQSNKL-------EAITDNFFSNNSRLEQLDLSRNLIRSIS----PTAFDTQRSLEYLDLSGNALLDISV---GLGNLNNLRDIDLSYNQISRIQSDV-IGGWRNVVEIRLSNNLIVELQQGTFRNLP-KLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRS--MRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPI 921          

HSP 4 Score: 80.1073 bits (196), Expect = 9.467e-15
Identity = 111/424 (26.18%), Postives = 191/424 (45.05%), Query Frame = 2
Query:  728 MNSLENIAAEAFVPVKNSLINLELEG-NKLLNSTIVE------QALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVL---SNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMN--SLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDF---AKLKNISLENNQW-NCSCHQIQWLLHFRKLILNRDQILCNIPNEKAGKNLFLVMVNCSDVILSRILS 1951
            +N LEN   E FV V+  L ++  E  N ++N   +       + L  F+G     +L +++  L  +     +     KL H+ ++  S L  ++   F GL +L+ L+L+   ++   I   A+++L +L                SLK  H Q +++  + +   K L +LK+L L  N I  IE  SF DL +L+ L L  NR+T ++ G F R P+L ++ L  QN ++  I P S +    S +E++ +  N I        + D LP+L  L +  N +++L      G   ++ + L+ N   LI   A   +P +    ++R+  N LS+          LP+ F     LK + L  NQ+       +  L   R+L L+ + ++   PN     N  L  +N S   L++I S
Sbjct:  108 LNELENGLVEIFV-VEPQLRSIPAESLNGMINMLAITIQSEELKHLPDFSGLLSLTYLSVQTGALQELPSHLFRHL--PKLQHIHITGGSGLTRLEAGLFDGLISLKNLDLSHNGLNW--IHLRALSRLPNL---------------VSLKLSHNQISDVGMVGRI-VKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYL--QNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALR---ELRMRNNSLSS---------DLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFR-HNPLLETLNISSNELTKIHS 495          

HSP 5 Score: 70.4774 bits (171), Expect = 9.939e-12
Identity = 74/286 (25.87%), Postives = 130/286 (45.45%), Query Frame = 2
Query: 1079 AMAKLTHLFMNDNNLINCPH---RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF------------------------------------------VLSNL----ESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQ 1789
            A+ +L +L M+ N L   P+   R   +L+ LHL  N++R I +D   ++  L+EL ++ NS+ S     F +L  L  LDL  N+  R++S +   +P L  L+L +    L+ +APNSF                                          V++ L    E I L+GN+I     A      LP L  L L  N+I +L  + F G++ ++++ L+ N L      +F+ +    + + L  N+L     + +    LP+  A+L+N++L++N+
Sbjct:  356 ALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENG--LIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLEL-LHLQENQLG----EADERALLPL--AELRNLNLQSNK 632          

HSP 6 Score: 70.0922 bits (170), Expect = 1.359e-11
Identity = 123/500 (24.60%), Postives = 214/500 (42.80%), Query Frame = 2
Query:  266 IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVG-----LSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAA-EAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKI-SDPDIRFSAMAKLTHLFMNDNNLINCPHRLPA---SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTN 1735
            I +  LDLS N +  +   +   L NL  LKLSHN++ ++     VG     L +L+ L L+NN ++V+                  +  F  +P     ++++L+L+ N+I + +   +FL    L+T+ L  N I+ I+    +    + +  + +  N + ++ A  A +     L  L++ GN L  S +   AL G                                L  L L+ N  L+ I+ DA   +  L+ L +    + SD  + F  +  L  L +  N       +L A   SL+ L L  N + ++  + F+    L+ L++  N +  I +++   L  L  +D  +N+L  + +G+  R+ + ISL   Q    L   A     L NL  ++L  NRI+     G  F    +L  LSL  N++ +L +  F G   ++L+ L  N L     +  LPL +   ++ L  NKL  I+ +F S N
Sbjct:  208 ISLKNLDLSHNGLNWIHLRALSRLPNLVSLKLSHNQISDV---GMVGRIVKDLEHLKKLRLDNNLITVIE-----------------DGSFVDLP-----NLSELHLNDNRI-TELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLL--SELPYGALRGH-----------------------------GTLEQLHLNHNH-LRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGL-PRIVERISLKGNQIT-SLPAAASKDLQLPNLRMLDLSQNRIEQLPRHG--FQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPL-AELRNLNLQSNKLEAITDNFFSNN 644          

HSP 7 Score: 67.3958 bits (163), Expect = 8.098e-11
Identity = 123/517 (23.79%), Postives = 211/517 (40.81%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETF---NKGLIKLLHVYLGNNEFEKIPVLKA-----THMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMND---NNLINCPHRLPASLKFLHLQSNNIRQIRQDDFK--SLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRI-KFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQ 1789
            L L  NLI  + + SF  L NL  L L+ N + E+   AF+    L+ ++L+NN +  +HPE+    +   ++ +H+Y  NNE   +  L+A       +  L++  N + S +   +   +  L+ L L  N ++ I +   +             M +L  +                    ++ N+++       F    G + LDL       +    L       L  LDLSEN +++   N +FR    L+ LN++  +++   I  S +  L  LF  D   N L +    LP  ++ + L+ N I  +     K   L NL+ L L +N I  +  + F     L  L L  N L +++   F                           +  LE + LQ N++ + D  A      L +L NL+L+ N++  + +N FS +  ++ +DLS N LI   + T      S   + L+ N L  IS+   + N        L++I L  NQ
Sbjct:  263 LRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMY--NNEIGHVEALRALLDALPRLRYLDMSGNLL-SELPYGALRGHGTLEQLHLNHNHLRLIERDALMA------------MPALREL--------------------RMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGL--PSLRRLDLSENGLIELAPN-SFRHNPLLETLNISSNELTK--IHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSF-------------------------IGIQRLELLHLQENQLGEADERA---LLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRN-LIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGNLN-------NLRDIDLSYNQ 703          
BLAST of Epiphycan vs. Ensembl Zebrafish
Match: si:dkey-182i3.11 (si:dkey-182i3.11 [Source:ZFIN;Acc:ZDB-GENE-121214-258])

HSP 1 Score: 112.464 bits (280), Expect = 7.776e-25
Identity = 186/662 (28.10%), Postives = 291/662 (43.96%), Query Frame = 2
Query:  134 FCLLLVIYNLVCLYVFPCPIPCKC----------------------THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP--VLKAT-HMTKLNLDSNKIRSAVVDKSFLLN-TGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP----HRLPASLKFLHLQSNNI-----------RQIRQDDFKS--LT---------NLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI------------SIDFNSTNYLPID------FAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQILCNIPNEKAGKNL 1900
            F  LL+I +L+   V  CPI C C                      T H    R++ ++ +P     ++ +LDL+ N+     N ++Q++  L  L L  N ++ +    F GL NL+ L L NN +  L P+ F  GLI L  + L  N+   +   VL+    +T L L  N I   +++ +   N T L  L L+KN++K +    F     T L  L L +N L  I         N L +L L+ N +  ++I +     F+     + LDL   GL SIS    +    S+L +LDLS N  L+++    F  L  L+ LNL   K++  P+  F  +  L  L ++ NN+   P    H L A LK L L +N+I           RQ++Q D  S  LT         NLKEL+L+ N I  I   SF +L  L SL L  N L+++   +   + +L  L L +     +   P  F   L NL  ++L  N++ F       F++L  L +L L  N +  L E++F+   N+  + L  N L   P++ F  L+    ++ L+ N +  I             +D  S     ++        KLK I L+ N W+CS   I   L+  +   N  Q++   P   +G+NL
Sbjct:    2 FWPLLIILDLIA-AVDACPISCSCVDVDIVTCWNTNLLEFPPLPNGTKHFYATRNK-IQALPNETFHELRVLDLTKNVFNLSLNTNWQSVRGLTHLHLGGNRLRALTPRQFEGLLNLQVLDLSNNAIKSL-PQMFLYGLINLQTLNLNINQILSLSYGVLEGPLALTDLQLRDNMID--MIEMNVFENCTYLAKLYLSKNKLKSVGNGSF--KGATGLNHLDLGLNGLAGIPTIVLQETSN-LTSLYLQKNDI--TSIPDNV---FSEILSLKHLDLSYNGLVSISNGSFRSL--SQLVYLDLSFNQ-LQTLTQHVFEDLGKLENLNLYHNKLTSLPNNMFKNLTMLKELQLDSNNISVIPPDLFHPLSA-LKDLQLDNNHISKLHSHTFKKLRQLKQLDISSNDLTKIPNHLFHKNLKELNLENNHISFISKFSFKNLHRLQSLKLSHNNLSKLYRELLTNLTRLRELLLNENQ---IETIPVGFFKGLENLRVLDLSNNKMHFILPDA--FNDLSALKDLDLSFNFLHNLPEDIFASLRNLTKLHLQNNKLRYLPSRLFSALVGLE-ELHLDRNYIQRIHPTQFEGLVKLHELDMKSNQLRSMEDGTLMPLRKLKRIHLDGNPWDCSTVVI---LYISQWFNNNTQLVKTTPMCSSGQNL 637          
BLAST of Epiphycan vs. Ensembl Zebrafish
Match: igfals (insulin-like growth factor binding protein, acid labile subunit [Source:ZFIN;Acc:ZDB-GENE-061009-25])

HSP 1 Score: 105.531 bits (262), Expect = 9.289e-23
Identity = 140/504 (27.78%), Postives = 216/504 (42.86%), Query Frame = 2
Query:  182 PCPIPCKCTHH------SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSM-----------------------LKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLP-------ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPK----LISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKL 1564
            PC   C C         +V C  +    VP  I +    L L  NL  +L   +F+ L NL+ L L  + +  ++ +AF GL++L +LHLE N+L  L    F +G   L  + L NN+  +I        +HM  LN     + S + +  F    GL+ LIL  N +  +    F      +L  L L  N L+ I A  F+ +       +L+   L  + IV  A   F G    ++LDL    LT +  +         LH L LS NS+                       ++++    F GL +L++LNL   ++ +   R      L HL +      +C H LP       + L  +HL  + + ++    F  LT L+ L L+ N+I  +E  SF +L  L  LDL FN+LT I S  F+ +      L+S NL    P     A     L +L  ++L GN+++    A      LP+L  L+L+DN +  L
Sbjct:   48 PCAKGCTCLQDDYSLELNVYCSTRNFTQVPSDIPLSTRSLWLDGNLFSNLPAGAFEKLTNLEFLNLQSSLLVSLDAHAFRGLNSLAHLHLERNNLRSLSGLVF-QGTSNLATLSLNNNQMFRIDDRLFAGMSHMWLLN-LGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLF--QGLNELKELDLTGNYLKVIKANVFLKLP------KLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGL--QSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQE--ARMGTFMGLNHLAVMKLT-GSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLKNLDYLLLSGNLLHNLP-----AEALLPLQHLSWLDLSGNKLELILNA--TIYMLPRLRYLNLKDNILVNL 529          

HSP 2 Score: 64.6994 bits (156), Expect = 4.411e-10
Identity = 97/332 (29.22%), Postives = 157/332 (47.29%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNE--------FEKIPVLKA-------------------THMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSK-LHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS-DPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIR 1189
            LDL+ N +K +  N F  L  L++L L  N++  +   AFVG+ +LR L L  N L+VLH ETF  GL  L  + L NN         F  +  L+                     H+  LNL++N+++ A +     LN  L  + LT +    +   D V    +KL ++ L  + L  +++++F  +   L  L L+ N   N ++VE+    F      Q LDL+   LT+I+ +    F+  K L +L LS N +L ++  +A   L +L  L+L+  K+    +     + +L +L + DN L+N P  +P SL  L L  NN +
Sbjct:  231 LDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETF-IGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNH-LAVMKLTGSCFHSL--PDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGL-TGLRRLFLQHN---NISLVERQ--SFVELQRLQQLDLRFNKLTTITSN---TFYGLKNLDYLLLSGN-LLHNLPAEALLPLQHLSWLDLSGNKLELILNATIYMLPRLRYLNLKDNILVNLPVSIPESLDQLWLSGNNWK 548          
BLAST of Epiphycan vs. Ensembl Zebrafish
Match: igfals (insulin-like growth factor binding protein, acid labile subunit [Source:ZFIN;Acc:ZDB-GENE-061009-25])

HSP 1 Score: 105.531 bits (262), Expect = 9.289e-23
Identity = 140/504 (27.78%), Postives = 216/504 (42.86%), Query Frame = 2
Query:  182 PCPIPCKCTHH------SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSM-----------------------LKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLP-------ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPK----LISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKL 1564
            PC   C C         +V C  +    VP  I +    L L  NL  +L   +F+ L NL+ L L  + +  ++ +AF GL++L +LHLE N+L  L    F +G   L  + L NN+  +I        +HM  LN     + S + +  F    GL+ LIL  N +  +    F      +L  L L  N L+ I A  F+ +       +L+   L  + IV  A   F G    ++LDL    LT +  +         LH L LS NS+                       ++++    F GL +L++LNL   ++ +   R      L HL +      +C H LP       + L  +HL  + + ++    F  LT L+ L L+ N+I  +E  SF +L  L  LDL FN+LT I S  F+ +      L+S NL    P     A     L +L  ++L GN+++    A      LP+L  L+L+DN +  L
Sbjct:   48 PCAKGCTCLQDDYSLELNVYCSTRNFTQVPSDIPLSTRSLWLDGNLFSNLPAGAFEKLTNLEFLNLQSSLLVSLDAHAFRGLNSLAHLHLERNNLRSLSGLVF-QGTSNLATLSLNNNQMFRIDDRLFAGMSHMWLLN-LGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLF--QGLNELKELDLTGNYLKVIKANVFLKLP------KLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGL--QSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQE--ARMGTFMGLNHLAVMKLT-GSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLKNLDYLLLSGNLLHNLP-----AEALLPLQHLSWLDLSGNKLELILNA--TIYMLPRLRYLNLKDNILVNL 529          

HSP 2 Score: 64.6994 bits (156), Expect = 4.411e-10
Identity = 97/332 (29.22%), Postives = 157/332 (47.29%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNE--------FEKIPVLKA-------------------THMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSK-LHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS-DPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIR 1189
            LDL+ N +K +  N F  L  L++L L  N++  +   AFVG+ +LR L L  N L+VLH ETF  GL  L  + L NN         F  +  L+                     H+  LNL++N+++ A +     LN  L  + LT +    +   D V    +KL ++ L  + L  +++++F  +   L  L L+ N   N ++VE+    F      Q LDL+   LT+I+ +    F+  K L +L LS N +L ++  +A   L +L  L+L+  K+    +     + +L +L + DN L+N P  +P SL  L L  NN +
Sbjct:  231 LDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETF-IGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNH-LAVMKLTGSCFHSL--PDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGL-TGLRRLFLQHN---NISLVERQ--SFVELQRLQQLDLRFNKLTTITSN---TFYGLKNLDYLLLSGN-LLHNLPAEALLPLQHLSWLDLSGNKLELILNATIYMLPRLRYLNLKDNILVNLPVSIPESLDQLWLSGNNWK 548          
BLAST of Epiphycan vs. Ensembl Zebrafish
Match: lgr4 (Danio rerio leucine-rich repeat containing G protein-coupled receptor 4 (lgr4), mRNA. [Source:RefSeq mRNA;Acc:NM_001353862])

HSP 1 Score: 98.2117 bits (243), Expect = 2.869e-20
Identity = 125/465 (26.88%), Postives = 198/465 (42.58%), Query Frame = 2
Query:  185 CPIPCKCTH-HSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-----------------------PETFNKGLIKLLHVYLGNNEFEKIPVLKATH---MTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF---------------------VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-NLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKI-SDPDIRFSAMAKLTHLFMNDNNLINCPH-RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKL-ISLNLEQQNPVLLTIAP 1423
            C   C+C      DC  + L  VP G+S     LD+S N I  L  N F+ L  L+ L+L+ N++  I+  A  GL  L+ L L+NN L  +                        PE   +GL +L H++L +N   ++P+    H   +  L L  N+I + + D +F   + L  L L  N I+EI +  F                           KL  L    N++ +I   AF   +NSL+  + L  N L            F G T FQ L                    S LH L L   SM++  D  +  G  NL+ L L   KI S P      +  L  + ++ N++ + P  +    L+ ++LQ N I+QI +  F+ +T+L+ L L +N I  I  ++F  L++LT+LDL  N L  + +     + +L ++ N+E +N ++    P
Sbjct:   32 CSPLCRCDEDGGADCSGRGLTSVPTGLSAFTYYLDISMNNITELPANVFRNLPYLEELRLAGNDLAFIHPEALSGLHQLKVLMLQNNQLKTVPSAALKNLNALQSLRLDANHITSVPEDSFEGLQQLRHLWLDDNSLTEVPISPLQHQSNLQALTLALNRI-THIPDNAFANLSSLVVLHLHNNRIQEIGKNCFNGLDNLETLDLNFNNLKIFPEAIQMLPKLKELGFHSNNIASIPEGAF--CRNSLLRTIHLFDNPL-----------SFVGTTAFQNL--------------------SDLHSLMLRGASMMQ--DFPSLTGTINLESLTLTGTKIRSIPADLCEDLTVLRTVDLSYNDIEDLPSFQGCVRLQDINLQHNQIKQIDRGTFQGMTSLRVLDLSRNQIKFIHRDAFLSLSALTNLDLSLNSLASVPTAGLSALNQLKLTGNMELRNGLMSKTLP 460          

HSP 2 Score: 78.9518 bits (193), Expect = 2.526e-14
Identity = 92/338 (27.22%), Postives = 149/338 (44.08%), Query Frame = 2
Query:  920 FLKPFFDSKLHHLD--LSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP-----HRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQ------------QNPVLLTIA----PNSFVLS------------------------------NLESIELQGNRIKF--------------------DATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI 1711
            F+ P   S LH L   + +N+ LK++ + A + L+ LQ L L    I+  P+  F  + +L HL+++DN+L   P     H+  ++L+ L L  N I  I  + F +L++L  LHL  N I  I  N F+ L +L +LDL FN L      I   +PKL  L                +N +L TI     P SFV +                              NLES+ L G +I+                     D    P F    +L +++L+ NQI +++   F G  +++++DLS N +       FL L S+  ++ L++N L+++
Sbjct:   98 FIHPEALSGLHQLKVLMLQNNQLKTVPSAALKNLNALQSLRLDANHITSVPEDSFEGLQQLRHLWLDDNSLTEVPISPLQHQ--SNLQALTLALNRITHIPDNAFANLSSLVVLHLHNNRIQEIGKNCFNGLDNLETLDLNFNNLKIFPEAI-QMLPKLKELGFHSNNIASIPEGAFCRNSLLRTIHLFDNPLSFVGTTAFQNLSDLHSLMLRGASMMQDFPSLTGTINLESLTLTGTKIRSIPADLCEDLTVLRTVDLSYNDIEDLPSFQGCVRLQDINLQHNQIKQIDRGTFQGMTSLRVLDLSRNQIKFIHRDAFLSL-SALTNLDLSLNSLASV 431          

HSP 3 Score: 66.2402 bits (160), Expect = 1.999e-10
Identity = 68/239 (28.45%), Postives = 110/239 (46.03%), Query Frame = 2
Query:  881 DLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPHRLPA---SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLF 1579
            D    GLTS+          +  ++LD+S N++ + +  + FR L  L+ L LA   ++   P+   S + +L  L + +N L   P        +L+ L L +N+I  + +D F+ L  L+ L L  NS+  +  +     ++L +L L  NR+T I    F  +  L+ L+L   N  +  I  N F  L NLE+++L  N +K    A      LPKL  L    N I  + E  F
Sbjct:   45 DCSGRGLTSVPTGL-----SAFTYYLDISMNNITE-LPANVFRNLPYLEELRLAGNDLAFIHPE-ALSGLHQLKVLMLQNNQLKTVPSAALKNLNALQSLRLDANHITSVPEDSFEGLQQLRHLWLDDNSLTEVPISPLQHQSNLQALTLALNRITHIPDNAFANLSSLVVLHL--HNNRIQEIGKNCFNGLDNLETLDLNFNNLKIFPEA---IQMLPKLKELGFHSNNIASIPEGAF 271          

HSP 4 Score: 56.9954 bits (136), Expect = 1.345e-7
Identity = 54/171 (31.58%), Postives = 89/171 (52.05%), Query Frame = 2
Query: 1154 LKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGP--IFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWP-AKTFLP 1657
            L+ L L  N++  I  +    L  LK L L+ N + ++ + +  +L +L SL L  N +T +    F  + +L  L L+  +   + I+P     SNL+++ L  NRI    T  P   F NL  LV L L +N+I ++ +N F+G  N++ +DL+ N+L  +P A   LP
Sbjct:   86 LEELRLAGNDLAFIHPEALSGLHQLKVLMLQNNQLKTVPSAALKNLNALQSLRLDANHITSVPEDSFEGLQQLRHLWLDDNSLTEVPISPLQHQ-SNLQALTLALNRI----THIPDNAFANLSSLVVLHLHNNRIQEIGKNCFNGLDNLETLDLNFNNLKIFPEAIQMLP 251          
BLAST of Epiphycan vs. Ensembl Zebrafish
Match: tlr5a (toll-like receptor 5a [Source:ZFIN;Acc:ZDB-GENE-040219-14])

HSP 1 Score: 98.2117 bits (243), Expect = 3.190e-20
Identity = 159/611 (26.02%), Postives = 250/611 (40.92%), Query Frame = 2
Query:  197 CKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMK-EINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLG---------NNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTG-LQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTG--FNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQN----------PVL--LTIAPNSF--------VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKL-NENLFSGSVNIQLIDLSMNSL-IGWPAKTFLPLI-----------------SSAIDIRLNMNKLSTISIDFNSTNYLPID-----------------------FAKLKNISLENNQWNCSC 1804
            C    +   C  + L++VPK IS  +T +DLS N I  L+  SF  L  L+ L L H      I  N+F+ LSNL +L L+ N    +    FN GL  L ++ L          +  F K P++    +  L+L  N IR  V   SF LN      L LT N++K I + D +N +            +L  +++     +    +  E  GN   N++I    L+G  FN     +F D       +IS   ++    S  + +  S     K  D   F GL +          I   D+  S++  LT+   +            + L+ + L  + I +I  + F  +TNL +L+L KN +  I+  +F +L  L  LDL +N + R+ S  F  +P L+SLNL   +          P L  L +  N+         +  +L++++LQ N+I   +    I D  P++  +  R NQ+     +N    S NIQ++DLS   L + W     L +                  S   DI  ++  L  + + FNS  YLP D                       F+ L  +SL NN + C C
Sbjct:   25 CSTDGYFAFCMDRGLQEVPK-ISTYITNVDLSKNRIAELNETSFSHLEALEVLILMHQTPGLVIRRNSFMRLSNLTSLQLDYNHHLRIDAGAFN-GLSDLKNLTLTQCGLDDSLLSGNFLK-PLMS---LEMLDLSRNNIRR-VQPASFFLNMRRFHVLDLTFNKVKSICEEDLLNFQGKHF--------TLLRLSSITLQDMNEYWLGWEKCGNPFKNTSITTLDLSGNGFNVDMAKRFFD-------AISSTKIQSLIISNTYRIGKSSGDNSKDPDKSTFSGLKS--------SGIKSFDLSNSSIFSLTYSVFS----------YLSDLEQITLAESQINKIENNAFLGMTNLLKLNLSKNFLGYIDFRTFQNLKGLEVLDLSYNHIWRLGSQSFQGLPNLLSLNLTGNSLGHVYTFATLPKLEKLYLGDNNIQYVYEIPNIAKHLKTLDLQFNQIASMSELYTILDEFPQIEEVVFRGNQLLYCPQDNHEVLSQNIQVLDLSFAGLQVIWSEGKCLNVFDDLHQLEVLHLSSNLLQSLPKDIFKDLTSLLILDLSFNSLKYLPTDVFPKTLQVLHLDYNSIYSVDPNLFSTLSYLSLMNNDFRCDC 595          
BLAST of Epiphycan vs. Ensembl Xenopus
Match: rpl24 (ribosomal protein L24 [Source:Xenbase;Acc:XB-GENE-963922])

HSP 1 Score: 114.775 bits (286), Expect = 3.442e-25
Identity = 128/414 (30.92%), Postives = 185/414 (44.69%), Query Frame = 2
Query:  185 CPIPCKCTHHS----VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLR-----NLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKL---NLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQ--ILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPH----RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKL 1372
            CP PC+C        VDC  +AL  +P+ +SI  + LDLS N I +L +N    L  L+ L+L+ N++  I + AF GL +L+      L L+ N +S + P +FN GL  L H++L +N   +IPV     ++ L    L  NKI   + D +F   + L  L L  N I  + +  F       L TL L  N+L+   A A   +KN L  L    N +   +I EQA  G             +  L +I       F+D+ + H           +   AF+ L  L+  ILN A      PD+  +    L  L +    L+  P     +LP +L+ L L+ N + +IR   F+ L  L+ L L  N I  I  NSF  L SL  LDL  N LT       H +  L
Sbjct:   32 CPTPCECEQEGMLVRVDCSDRALTSLPRNLSIFTSYLDLSMNNITNLPSNVMHNLHFLEELRLAGNDLTYIPKGAFAGLGSLKVLPLIKLRLDANHISYVPPSSFN-GLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHH-IPDYAFRNLSSLVVLHLHNNRIYSLGKKCF--DGLHSLETLDLNYNNLDEFPA-AIKTLKN-LKELGFHSNNI--KSIPEQAFIG-------------NPSLITIH------FYDNPIQH-----------VGRSAFQHLPELRTLILNGASQITEFPDL--TGTTSLESLTLTGAQLVYLPSAVCTQLP-NLQVLDLRHNEVYEIRSTTFQQLVGLRSLDLAWNKIAVIHPNSFSSLPSLIKLDLSSNHLTSFPVTGLHGLTHL 404          

HSP 2 Score: 76.6406 bits (187), Expect = 1.655e-13
Identity = 86/311 (27.65%), Postives = 134/311 (43.09%), Query Frame = 2
Query:  947 LHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD------PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH---LQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGI----------FHR-------------MPKLISLNLE------------QQNPVLLTIA----------PNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISI 1717
            L  L L+ N  L  I   AF GL +L++L L K ++        P   F+ +  L HL+++DN+L   P R   SL  L    L  N I  I    F++L++L  LHL  N I S+    FD L SL +LDL +N L    + I          FH               P LI+++              Q  P L T+           P+    ++LES+ L G ++ +  +A  +   LP L  L LR N++ ++    F   V ++ +DL+ N +      +F  L  S I + L+ N L++  +
Sbjct:   89 LEELRLAGND-LTYIPKGAFAGLGSLKVLPLIKLRLDANHISYVPPSSFNGLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHHIPDYAFRNLSSLVVLHLHNNRIYSLGKKCFDGLHSLETLDLNYNNLDEFPAAIKTLKNLKELGFHSNNIKSIPEQAFIGNPSLITIHFYDNPIQHVGRSAFQHLPELRTLILNGASQITEFPDLTGTTSLESLTLTGAQLVYLPSA--VCTQLPNLQVLDLRHNEVYEIRSTTFQQLVGLRSLDLAWNKIAVIHPNSFSSL-PSLIKLDLSSNHLTSFPV 395          
BLAST of Epiphycan vs. Ensembl Xenopus
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:100489984])

HSP 1 Score: 110.923 bits (276), Expect = 2.188e-24
Identity = 160/539 (29.68%), Postives = 245/539 (45.45%), Query Frame = 2
Query:  212 HSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSF--LLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFD-SKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIR-FSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSC 1804
            +SV C  + L  VP+        L L  N + ++   +F+ L +L  L L  +++  + + A  GL  L +LHLE N +  L P TF      L+ + L NN   KI        +++  LNL  N +   + D  F  LLN  L+ L+L  N +  +  + F++L   K   L+   NSL+ I A  F   + +   L L  N +  ST+  +A   F+G    ++LDL    LT++  D    FF    L+ L LS NS L S+    F+ L  L  LNL + KI     R F  +A+L                     + L L  NN+++IR   F  L N+  ++L  N + S+  + F  L  L SL +  + L+ I+  +F  +  +  L L  QN  ++ I  +SF  L  L  ++L+ N++    T    F  L  L  L L  NQI  ++  +FS    +Q +DLS N L       FLPL SS   + L  N L TIS++F       I    ++ + L  NQW+C C
Sbjct:   49 YSVFCSSRNLTRVPEPPPPAARSLWLDGNNLTTVQAGAFRNLSHLDFLNLQSSQVASLEQQALHGLKALAHLHLERNMIKSLAPSTFTHT-QNLVSLTLNNNFLTKIEDGLFSGLSNLWYLNLGWN-LLVVLPDMVFHDLLN--LRELVLAGNRLVYLQPSLFLSLGELKELDLSG--NSLKGIKANVFTRQQKT-HKLYLNHNHI--STVAPRA---FSGMKNLRWLDLSHNRLTALYED---TFFGLPSLNVLRLSNNS-LTSLRPRIFKDLQFLVELNLGQNKIKILLERTFEGLAQL---------------------ELLSLNHNNVQEIRPGSFLGLLNVAVINLSGNCLKSLAEHCFKGLGKLHSLHMESSCLSHIKPQMFAGLSSIRRLFL--QNNEIVAIENHSFTDLHGLLELDLRSNKLTHLTTRS--FTGLKNLSYLLLSSNQILTISPEVFSPVQQLQWLDLSDNQLKALTEDIFLPL-SSLRYLSLKNNCLKTISVNF------LIPPPTMQQLWLNGNQWDCGC 539          
BLAST of Epiphycan vs. Ensembl Xenopus
Match: rpl24 (ribosomal protein L24 [Source:Xenbase;Acc:XB-GENE-963922])

HSP 1 Score: 108.997 bits (271), Expect = 2.013e-23
Identity = 129/433 (29.79%), Postives = 186/433 (42.96%), Query Frame = 2
Query:  185 CPIPCKCTHHS----VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLEN------------------------NDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKL---NLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQ--ILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPH----RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKL 1372
            CP PC+C        VDC  +AL  +P+ +SI  + LDLS N I +L +N    L  L+ L+L+ N++  I + AF GL +L+ L L+N                        N +S + P +FN GL  L H++L +N   +IPV     ++ L    L  NKI   + D +F   + L  L L  N I  + +  F       L TL L  N+L+   A A   +KN L  L    N +   +I EQA  G             +  L +I       F+D+ + H           +   AF+ L  L+  ILN A      PD+  +    L  L +    L+  P     +LP +L+ L L+ N + +IR   F+ L  L+ L L  N I  I  NSF  L SL  LDL  N LT       H +  L
Sbjct:   32 CPTPCECEQEGMLVRVDCSDRALTSLPRNLSIFTSYLDLSMNNITNLPSNVMHNLHFLEELRLAGNDLTYIPKGAFAGLGSLKVLMLQNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFN-GLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHH-IPDYAFRNLSSLVVLHLHNNRIYSLGKKCF--DGLHSLETLDLNYNNLDEFPA-AIKTLKN-LKELGFHSNNI--KSIPEQAFIG-------------NPSLITIH------FYDNPIQH-----------VGRSAFQHLPELRTLILNGASQITEFPDL--TGTTSLESLTLTGAQLVYLPSAVCTQLP-NLQVLDLRHNEVYEIRSTTFQQLVGLRSLDLAWNKIAVIHPNSFSSLPSLIKLDLSSNHLTSFPVTGLHGLTHL 423          

HSP 2 Score: 75.8702 bits (185), Expect = 3.546e-13
Identity = 82/299 (27.42%), Postives = 132/299 (44.15%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH---LQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGI----------FHR-------------MPKLISLNLE------------QQNPVLLTIA----------PNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISI 1717
            +N++L+ + ++A   L +LQ L L    IS  P   F+ +  L HL+++DN+L   P R   SL  L    L  N I  I    F++L++L  LHL  N I S+    FD L SL +LDL +N L    + I          FH               P LI+++              Q  P L T+           P+    ++LES+ L G ++ +  +A  +   LP L  L LR N++ ++    F   V ++ +DL+ N +      +F  L  S I + L+ N L++  +
Sbjct:  119 QNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFNGLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHHIPDYAFRNLSSLVVLHLHNNRIYSLGKKCFDGLHSLETLDLNYNNLDEFPAAIKTLKNLKELGFHSNNIKSIPEQAFIGNPSLITIHFYDNPIQHVGRSAFQHLPELRTLILNGASQITEFPDLTGTTSLESLTLTGAQLVYLPSA--VCTQLPNLQVLDLRHNEVYEIRSTTFQQLVGLRSLDLAWNKIAVIHPNSFSSL-PSLIKLDLSSNHLTSFPV 414          
BLAST of Epiphycan vs. Ensembl Xenopus
Match: rpl24 (ribosomal protein L24 [Source:Xenbase;Acc:XB-GENE-963922])

HSP 1 Score: 108.612 bits (270), Expect = 2.966e-23
Identity = 138/484 (28.51%), Postives = 210/484 (43.39%), Query Frame = 2
Query:  185 CPIPCKCTHHS----VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLEN------------------------NDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKL---NLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQ--ILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPH----RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKL 1525
            CP PC+C        VDC  +AL  +P+ +SI  + LDLS N I +L +N    L  L+ L+L+ N++  I + AF GL +L+ L L+N                        N +S + P +FN GL  L H++L +N   +IPV     ++ L    L  NKI   + D +F   + L  L L  N I  + +  F       L TL L  N+L+   A A   +KN L  L    N +   +I EQA  G             +  L +I       F+D+ + H           +   AF+ L  L+  ILN A      PD+  +    L  L +    L+  P     +LP +L+ L L  N+I+ +    F     L+++ L+ N +  I + +F  L  L SLDL +N++  I    F  +P LI L+L   +   LT  P +  L  L  ++L GN    D       ++ PKL
Sbjct:   32 CPTPCECEQEGMLVRVDCSDRALTSLPRNLSIFTSYLDLSMNNITNLPSNVMHNLHFLEELRLAGNDLTYIPKGAFAGLGSLKVLMLQNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFN-GLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHH-IPDYAFRNLSSLVVLHLHNNRIYSLGKKCF--DGLHSLETLDLNYNNLDEFPA-AIKTLKN-LKELGFHSNNI--KSIPEQAFIG-------------NPSLITIH------FYDNPIQH-----------VGRSAFQHLPELRTLILNGASQITEFPDL--TGTTSLESLTLTGAQLVYLPSAVCTQLP-NLQVLDLSYNHIKDL--PSFSGCQRLQKIDLRHNEVYEIRSTTFQQLVGLRSLDLAWNKIAVIHPNSFSSLPSLIKLDLSSNH---LTSFPVT-GLHGLTHLKLTGNSALQDLIPS---EHFPKL 465          

HSP 2 Score: 73.559 bits (179), Expect = 1.874e-12
Identity = 86/297 (28.96%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH---LQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGI----------FHRM-------------PKLISLNLE------------QQNPVLLTIA----------PNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI 1711
            +N++L+ + ++A   L +LQ L L    IS  P   F+ +  L HL+++DN+L   P R   SL  L    L  N I  I    F++L++L  LHL  N I S+    FD L SL +LDL +N L    + I          FH               P LI+++              Q  P L T+           P+    ++LES+ L G ++ +  +A  +   LP L  L L  N I  L    FSG   +Q IDL  N +    + TF  L+     + L  NK++ I
Sbjct:  119 QNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFNGLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHHIPDYAFRNLSSLVVLHLHNNRIYSLGKKCFDGLHSLETLDLNYNNLDEFPAAIKTLKNLKELGFHSNNIKSIPEQAFIGNPSLITIHFYDNPIQHVGRSAFQHLPELRTLILNGASQITEFPDLTGTTSLESLTLTGAQLVYLPSA--VCTQLPNLQVLDLSYNHIKDLPS--FSGCQRLQKIDLRHNEVYEIRSTTFQQLVGLR-SLDLAWNKIAVI 410          

HSP 3 Score: 56.6102 bits (135), Expect = 3.013e-7
Identity = 56/189 (29.63%), Postives = 95/189 (50.26%), Query Frame = 2
Query: 1094 THLFMNDNNLINCPHRLPASLKFL---HLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAK 1645
            ++L ++ NN+ N P  +  +L FL    L  N++  I +  F  L +LK L L+ N +  + + +  +L SL SL L  N ++ +    F+ +  L  L L+  +   LT  P   +  LS L+++ L  N+I         F NL  LV L L +N+I  L +  F G  +++ +DL+ N+L  +PA 
Sbjct:   66 SYLDLSMNNITNLPSNVMHNLHFLEELRLAGNDLTYIPKGAFAGLGSLKVLMLQNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFNGLFSLRHLWLDDNS---LTEIPVRALESLSALQAMTLALNKIHHIPDYA--FRNLSSLVVLHLHNNRIYSLGKKCFDGLHSLETLDLNYNNLDEFPAA 249          
BLAST of Epiphycan vs. Ensembl Xenopus
Match: ENSXETT00000011039.1 (toll like receptor 3 [Source:NCBI gene;Acc:100486223])

HSP 1 Score: 106.686 bits (265), Expect = 1.009e-22
Identity = 183/727 (25.17%), Postives = 279/727 (38.38%), Query Frame = 2
Query:  128 FTFC------LLLVIYNLVCLYVFPCPI--PCKCTHH-SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLS-------------NNSFQTL-----------INLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNK--GLI-------KLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDK-SFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DP-------------------------DIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQ--IRQDDFKSLTN--LKELHLKKNSILSIETNSFDDLASLTSLDLG-------------------------FNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIK------FDA----------------------TAGPI--FDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID-FNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHF-----RKLILNRDQILCNIPNEKAG 1891
            F+FC      L L ++ L  +Y        PCK T   + DC H  L  +P  +  ++  LDLS N +K L              +  F TL           + LK L L HNE  +I+EN F    +L  LHL +N +S +    F K   L+       K++   LGN +       +  ++ +L L+SNKI     +   FL NT LQ L L+ N + EIN   F                  + I + A + ++N+           L+    EQ  +     TG   L L +  L+ I     K   D+ L  LDLS NS L  IDND+F  L  L+ILNL    IS  +P                         D+ F ++  + +L M  N +I           SL  L L  + ++Q  +    F SL+   L  L+L K  +  IE  +F  L  L  LD+G                         +NR   + S  F   P L  L L +       + P+ F VL NL  ++L  N I       F++                        GP+     L  L  LSL  N   ++  N F G   ++++D+  N++   P   F    S  + + L+ N ++++  D F +       F+ LK +++  N ++C+C  I W   +       + L   Q +CN P    G
Sbjct:   16 FSFCRNEMGQLWLSLHILYAIYGMSLVAGNPCKITEDLTADCSHLKLSAIPSDLPRNIKALDLSHNQLKKLPAANLSVYDQLERLDAGFNTLHQFEPALCKQLLMLKTLNLEHNEFTKISENDFTFCVHLSELHLASNGISNIDGNPFEKLENLLFLDMSHNKMISTALGNKQ-------QLNNLKELYLNSNKISKLNKEAFEFLANTSLQKLDLSSNPLTEINPGCF------------------QAIGSFAALVIQNT----------QLDPQRTEQVCSEL-AHTGVLNLTLNNIRLSKIHNTTFKGLADTNLTVLDLSGNS-LSQIDNDSFVSLGALEILNLENNDISHVNPKTFNGLSKVRVLNLRKSLSSNLKLDDLSFQSLHNVQYLNMEANKMIAITEHTFIGLTSLTNLSLSDSTLQQHTLTNRTFLSLSKSPLYHLNLTKTGLTKIENGAFLCLKHLQLLDMGLNQIDQEVSGNELEGLANIEMIYLSYNRRITLTSNSFIFAPSLSKLYLRKTALTFRDLNPSPFKVLQNLTVLDLSNNNIANIQEDVFESLSNLRILSFEHNNLARLWKEANPGGPVLFLKGLKNLEKLSLLSNGFDEIPANAFKGLCKLKVLDIGENNVYILPPSVFDDQHSLTL-LDLHKNLITSVEQDLFKNV------FSSLKYLNMGGNPYDCTCESIAWFASWLNTTNTSVPLAHSQYICNTPARYHG 698          
BLAST of Epiphycan vs. Ensembl Mouse
Match: Igfals (insulin-like growth factor binding protein, acid labile subunit [Source:MGI Symbol;Acc:MGI:107973])

HSP 1 Score: 108.227 bits (269), Expect = 1.336e-23
Identity = 137/504 (27.18%), Postives = 225/504 (44.64%), Query Frame = 2
Query:  185 CPIPCKCTHH------SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFN-----------------------KGLIKLLHVYLGNNEFEKIP--VLKA-THMTKLNLDSNKIRSAVVDKSFLLNTG-LQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLD---LSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHL-FMNDNNLINCPHRLP-------ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLT---IAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQI 1555
            CP+ C C++       SV C  + L  +P  I +    L L  N + S+ + +FQ L +L  L L  + ++ +   A +GL NL +LHLE N L  L    F                        +GL  L  + LG N    +P  V +   ++ +L L  NK+    +  + L   G L+ L L++N ++ +    F++L   +   L    N +  +A  AF+ +K +L  L+L  N++  + ++E     F G  G   L L    +TS     L+P     LH L+   L  N + + +    F GL  L++L L   +I +  ++  A   L ++  MN +   NC   LP         L  LHL+ + + +IR   F  L+ L+ L L+ NSI SIE  S   L+ L  LDL  N+LT +   +F  + +L  L L      +L+   + P    L     ++L  NR++  A    +F +L +L  L+LR+N +
Sbjct:   41 CPVTCTCSYDDYTDELSVFCSSRNLTQLPDSIPVSTRALWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKL--TYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDR--NLITAVAPRAFLGMK-ALRWLDLSHNRV--AGLLEDT---FPGLLGLHVLRLAHNAITS-----LRPRTFKDLHFLEELQLGHNRI-RQLGEKTFEGLGQLEVLTLNDNQIHE--VKVGAFFGLFNVAVMNLSG--NCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNNQLTMLSEDVLGP----LQRAFWLDLSHNRLETPAEG--LFSSLGRLRYLNLRNNSL 518          

HSP 2 Score: 80.4925 bits (197), Expect = 6.794e-15
Identity = 91/313 (29.07%), Postives = 147/313 (46.96%), Query Frame = 2
Query:  731 NSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLA-KCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLP---ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLN-LEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTF 1651
            N+L +I + AF  + +SL  L L+G+ L   ++  QAL G         L L+   L S++    +      L  L L  N++L  ++   FRGL +L  LNL     +  PD  F  +  L  L +  N L      L      L+ L L  N +R ++ + F  L  L++L+L +N I ++   +F  + +L  LDL  NR+  +    F   P L+ L+ L   +  + ++ P +F  L  LE ++L  NRI+        F+ L +L  L+L DNQI ++    F G  N+ +++LS N L   P   F
Sbjct:   84 NNLSSIPSAAFQNL-SSLDFLNLQGSWL--RSLEPQALLGLQN---LYHLHLERNLLRSLAAGLFR--HTPSLASLSLG-NNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTF---PGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIR--QLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVF 382          

HSP 3 Score: 77.7962 bits (190), Expect = 4.088e-14
Identity = 68/231 (29.44%), Postives = 107/231 (46.32%), Query Frame = 2
Query: 1100 LFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATA----------------------GPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI 1711
            L+++ NNL + P       +SL FL+LQ + +R +       L NL  LHL++N + S+    F    SL SL LG N L R+E G+F  +  L  LNL   +   L + P++    L NL  + L GN++ +   A                        +F +LP+L  L L  N IT +    F G   ++ +DLS N + G    TF  L+   + +RL  N ++++
Sbjct:   79 LWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNS---LVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHV-LRLAHNAITSL 305          
BLAST of Epiphycan vs. Ensembl Mouse
Match: Lgr4 (leucine-rich repeat-containing G protein-coupled receptor 4 [Source:MGI Symbol;Acc:MGI:1891468])

HSP 1 Score: 101.679 bits (252), Expect = 2.776e-21
Identity = 113/402 (28.11%), Postives = 186/402 (46.27%), Query Frame = 2
Query:  185 CPIPCKC-THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMT---KLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF--------VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-NLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPH-RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIES 1345
            C  PC C     VDC  + L  VP+G+S     L L+ N +  +   +   L  LK L L +N++K +   A  GLS L++L L+ N ++ + PE   +GL++L H++L +N   ++PV   +++     L L  N I S++ D +F   + L  L L  N+IK ++Q  F        ++L    L      + +L ++    F     S+I +    GN LL +  +      F G + F  L                    S LH L +   S+++   N A  G  +L+ L L   KIS  PD        L  L ++ N++ + P      +L+ + LQ N I  I++  F+ LT+L+ L L +N I  I + +F  L ++T+LD+ FN LT   +
Sbjct:   29 CAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSV-PEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLPTLQALTLALNNI-SSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEFPQAIKALPSLKELGFHSNSISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSAFHNL--------------------SDLHSLVIRGASLVQWFPNLA--GTVHLESLTLTGTKISSIPDDLCQNQKMLRTLDLSYNDIRDLPSFNGCRALEEISLQRNQISLIKETTFQGLTSLRILDLSRNLIREIHSGAFAKLGTITNLDVSFNELTSFPT 406          

HSP 2 Score: 88.5817 bits (218), Expect = 3.548e-17
Identity = 85/283 (30.04%), Postives = 135/283 (47.70%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHR----LPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSN--LESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPI--DFAKLKNISLENNQ 1789
            +N+ LK++ ++A RGL  LQ L L    I+  P+  F  + +L HL+++DN L   P R    LP +L+ L L  NNI  I    F +L++L  LHL  N I S+  + FD L +L +LDL +N L      I   +P L  L     +   +++ P+     N  L +I L  N + F   +   F NL  L +L +R   + +   NL +G+V+++ + L+   +   P            D+  N   L T+ + +N    LP       L+ ISL+ NQ
Sbjct:   89 QNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLP-TLQALTLALNNISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEFPQAI-KALPSLKELGFHSNS---ISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSA--FHNLSDLHSLVIRGASLVQWFPNL-AGTVHLESLTLTGTKISSIPD-----------DLCQNQKMLRTLDLSYNDIRDLPSFNGCRALEEISLQRNQ 352          
BLAST of Epiphycan vs. Ensembl Mouse
Match: Lgr4 (leucine-rich repeat-containing G protein-coupled receptor 4 [Source:MGI Symbol;Acc:MGI:1891468])

HSP 1 Score: 100.908 bits (250), Expect = 4.861e-21
Identity = 116/425 (27.29%), Postives = 188/425 (44.24%), Query Frame = 2
Query:  185 CPIPCKC-THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-----------------------PETFNKGLIKLLHVYLGNNEFEKIPVLKATHMT---KLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF--------VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-NLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPH-RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIES 1345
            C  PC C     VDC  + L  VP+G+S     LD+S N I  L  ++F+    L+ L+L+ N++  I+  A  GL  L+ L L+NN L  +                        PE   +GL++L H++L +N   ++PV   +++     L L  N I S++ D +F   + L  L L  N+IK ++Q  F        ++L    L      + +L ++    F     S+I +    GN LL +  +      F G + F  L                    S LH L +   S+++   N A  G  +L+ L L   KIS  PD        L  L ++ N++ + P      +L+ + LQ N I  I++  F+ LT+L+ L L +N I  I + +F  L ++T+LD+ FN LT   +
Sbjct:   29 CAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLPTLQALTLALNNI-SSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEFPQAIKALPSLKELGFHSNSISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSAFHNL--------------------SDLHSLVIRGASLVQWFPNLA--GTVHLESLTLTGTKISSIPDDLCQNQKMLRTLDLSYNDIRDLPSFNGCRALEEISLQRNQISLIKETTFQGLTSLRILDLSRNLIREIHSGAFAKLGTITNLDVSFNELTSFPT 430          

HSP 2 Score: 88.5817 bits (218), Expect = 3.343e-17
Identity = 85/283 (30.04%), Postives = 135/283 (47.70%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHR----LPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSN--LESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPI--DFAKLKNISLENNQ 1789
            +N+ LK++ ++A RGL  LQ L L    I+  P+  F  + +L HL+++DN L   P R    LP +L+ L L  NNI  I    F +L++L  LHL  N I S+  + FD L +L +LDL +N L      I   +P L  L     +   +++ P+     N  L +I L  N + F   +   F NL  L +L +R   + +   NL +G+V+++ + L+   +   P            D+  N   L T+ + +N    LP       L+ ISL+ NQ
Sbjct:  113 QNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLP-TLQALTLALNNISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEFPQAI-KALPSLKELGFHSNS---ISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSA--FHNLSDLHSLVIRGASLVQWFPNL-AGTVHLESLTLTGTKISSIPD-----------DLCQNQKMLRTLDLSYNDIRDLPSFNGCRALEEISLQRNQ 376          
BLAST of Epiphycan vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 99.7525 bits (247), Expect = 1.457e-20
Identity = 158/643 (24.57%), Postives = 274/643 (42.61%), Query Frame = 2
Query:  176 VFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDS---NKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKS-----CGLTSISGDFLK--------PFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDL---GFNRLTRIES-GIFHRMPKLISLNLEQQNPVLLTIAP---------------------------------NSFVLSNLESIELQGNRIKFDATA----GPIFDNLPK-------LVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID-FNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQIL-CNIPNEKAGK 1894
            V  CP  C C+++ VDCR + L ++P  +   +T + L  N I+ +   +F     L+RL LS+N++ E+  +AF GL +L +L L  N ++ L P++  +GL  L  + L  N+   + V     +  LNL S   NK+++ V   +F     +QT+ L +N         F+   + K     L  N +E   A    P + +   +    +K    +  E   +  +G     F DL       C  T++     +        P + ++L  L+ +E ++L++     F+ L  L+ +N +  KI+D  +  F   + +  + +  N L N  H++     SLK L L+SN I  +  D F  L +++ L L  N I ++   +FD L SL++L+L    FN    +   G + R  ++++ N   Q P  L   P                                 ++ V  + + +++    I  D T     G  F  +PK       L  + L +N+I+ L+   FS    +  + LS N L   P +TF  L S  + + L+ N +S +    FN       D + L ++++  N   C C+ +QWL  + K       I  C  P E A K
Sbjct:  274 VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITEL-PKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQT-VAKGTFSALRAIQTMHLAQNP--------FICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDC---FADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTAEL-RLNNNEFTVLEAT--GIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRL-LSLHGNDISVVPEGAFN-------DLSALSHLAIGANPLYCDCN-MQWLSDWVKSEYKEPGIARCAGPGEMADK 891          

HSP 2 Score: 77.411 bits (189), Expect = 9.174e-14
Identity = 57/170 (33.53%), Postives = 80/170 (47.06%), Query Frame = 2
Query:  185 CPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF 685
            CP  C C+  +VDC   AL+ VP+ I  +   LDL+ N I  ++   F  L +L+ L+L  N +  I   AF  L  L  L L  N+L  L PE    G  KL  + L  N+ + IP      A  +  L LD N+I S + D +F     L+ L L  N I  ++   F
Sbjct:   28 CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQ-LFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQI-SCIEDGAFRALRDLEVLTLNNNNITRLSVASF 195          

HSP 3 Score: 53.1434 bits (126), Expect = 2.978e-6
Identity = 58/230 (25.22%), Postives = 88/230 (38.26%), Query Frame = 2
Query: 1133 PHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWL 1822
            P  +P + + L L  NNI +I + DF  L +L+ L L +N I +IE  +F DL  L  L L  N L      +F    KL  L+L +                                                   NQI  +    F G+V+I+ + L  N +       F  L    + + LN N ++ +S+   S N++P    KL+   L +N   C CH + WL
Sbjct:   50 PRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSE---------------------------------------------------NQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEV-LTLNNNNITRLSV--ASFNHMP----KLRTFRLHSNNLYCDCH-LAWL 220          

HSP 4 Score: 51.2174 bits (121), Expect = 8.933e-6
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 2
Query:  167 CLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNS-FQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI 532
            C     CP  C+C   +VDC +Q L  +P  I      L L+ N    L     F+ L  L+++  S+N++ +I E AF G S +  + L +N L  +  + F KGL  L  + L +N    +
Sbjct:  496 CFADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMF-KGLESLKTLMLRSNRISCV 617          
BLAST of Epiphycan vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 99.7525 bits (247), Expect = 1.584e-20
Identity = 158/643 (24.57%), Postives = 274/643 (42.61%), Query Frame = 2
Query:  176 VFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDS---NKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKS-----CGLTSISGDFLK--------PFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDL---GFNRLTRIES-GIFHRMPKLISLNLEQQNPVLLTIAP---------------------------------NSFVLSNLESIELQGNRIKFDATA----GPIFDNLPK-------LVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID-FNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQIL-CNIPNEKAGK 1894
            V  CP  C C+++ VDCR + L ++P  +   +T + L  N I+ +   +F     L+RL LS+N++ E+  +AF GL +L +L L  N ++ L P++  +GL  L  + L  N+   + V     +  LNL S   NK+++ V   +F     +QT+ L +N         F+   + K     L  N +E   A    P + +   +    +K    +  E   +  +G     F DL       C  T++     +        P + ++L  L+ +E ++L++     F+ L  L+ +N +  KI+D  +  F   + +  + +  N L N  H++     SLK L L+SN I  +  D F  L +++ L L  N I ++   +FD L SL++L+L    FN    +   G + R  ++++ N   Q P  L   P                                 ++ V  + + +++    I  D T     G  F  +PK       L  + L +N+I+ L+   FS    +  + LS N L   P +TF  L S  + + L+ N +S +    FN       D + L ++++  N   C C+ +QWL  + K       I  C  P E A K
Sbjct:  270 VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITEL-PKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQT-VAKGTFSALRAIQTMHLAQNP--------FICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDC---FADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTAEL-RLNNNEFTVLEAT--GIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRL-LSLHGNDISVVPEGAFN-------DLSALSHLAIGANPLYCDCN-MQWLSDWVKSEYKEPGIARCAGPGEMADK 887          

HSP 2 Score: 77.411 bits (189), Expect = 9.324e-14
Identity = 57/170 (33.53%), Postives = 80/170 (47.06%), Query Frame = 2
Query:  185 CPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF 685
            CP  C C+  +VDC   AL+ VP+ I  +   LDL+ N I  ++   F  L +L+ L+L  N +  I   AF  L  L  L L  N+L  L PE    G  KL  + L  N+ + IP      A  +  L LD N+I S + D +F     L+ L L  N I  ++   F
Sbjct:   28 CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQ-LFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQI-SCIEDGAFRALRDLEVLTLNNNNITRLSVASF 195          

HSP 3 Score: 53.1434 bits (126), Expect = 2.952e-6
Identity = 58/230 (25.22%), Postives = 88/230 (38.26%), Query Frame = 2
Query: 1133 PHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWL 1822
            P  +P + + L L  NNI +I + DF  L +L+ L L +N I +IE  +F DL  L  L L  N L      +F    KL  L+L +                                                   NQI  +    F G+V+I+ + L  N +       F  L    + + LN N ++ +S+   S N++P    KL+   L +N   C CH + WL
Sbjct:   50 PRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSE---------------------------------------------------NQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEV-LTLNNNNITRLSV--ASFNHMP----KLRTFRLHSNNLYCDCH-LAWL 220          

HSP 4 Score: 51.6026 bits (122), Expect = 8.633e-6
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 2
Query:  167 CLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNS-FQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI 532
            C     CP  C+C   +VDC +Q L  +P  I      L L+ N    L     F+ L  L+++  S+N++ +I E AF G S +  + L +N L  +  + F KGL  L  + L +N    +
Sbjct:  492 CFADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMF-KGLESLKTLMLRSNRISCV 613          
BLAST of Epiphycan vs. UniProt/SwissProt
Match: sp|P70389|ALS_MOUSE (Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus OX=10090 GN=Igfals PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.063e-23
Identity = 138/504 (27.38%), Postives = 226/504 (44.84%), Query Frame = 2
Query:  185 CPIPCKCTHH------SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFN-----------------------KGLIKLLHVYLGNNEFEKIP--VLKA-THMTKLNLDSNKIRSAVVDKSFLLNTG-LQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLD---LSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHL-FMNDNNLINCPHRLP-------ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLT---IAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQI 1555
            CP+ C C++       SV C  + L  +P GI +    L L  N + S+ + +FQ L +L  L L  + ++ +   A +GL NL +LHLE N L  L    F                        +GL  L  + LG N    +P  V +   ++ +L L  NK+    +  + L   G L+ L L++N ++ +    F++L   +   L    N +  +A  AF+ +K +L  L+L  N++  + ++E     F G  G   L L    +TS     L+P     LH L+   L  N + + +    F GL  L++L L   +I +  ++  A   L ++  MN +   NC   LP         L  LHL+ + + +IR   F  L+ L+ L L+ NSI SIE  S   L+ L  LDL  N+LT +   +F  + +L  L L      +L+   + P    L     ++L  NR++  A    +F +L +L  L+LR+N +
Sbjct:   41 CPVTCTCSYDDYTDELSVFCSSRNLTQLPDGIPVSTRALWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKL--TYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDR--NLITAVAPRAFLGMK-ALRWLDLSHNRV--AGLLEDT---FPGLLGLHVLRLAHNAITS-----LRPRTFKDLHFLEELQLGHNRI-RQLGEKTFEGLGQLEVLTLNDNQIHE--VKVGAFFGLFNVAVMNLSG--NCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNNQLTMLSEDVLGP----LQRAFWLDLSHNRLETPAEG--LFSSLGRLRYLNLRNNSL 518          

HSP 2 Score: 80.4925 bits (197), Expect = 4.877e-14
Identity = 91/313 (29.07%), Postives = 147/313 (46.96%), Query Frame = 2
Query:  731 NSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLA-KCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLP---ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLN-LEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTF 1651
            N+L +I + AF  + +SL  L L+G+ L   ++  QAL G         L L+   L S++    +      L  L L  N++L  ++   FRGL +L  LNL     +  PD  F  +  L  L +  N L      L      L+ L L  N +R ++ + F  L  L++L+L +N I ++   +F  + +L  LDL  NR+  +    F   P L+ L+ L   +  + ++ P +F  L  LE ++L  NRI+        F+ L +L  L+L DNQI ++    F G  N+ +++LS N L   P   F
Sbjct:   84 NNLSSIPSAAFQNL-SSLDFLNLQGSWL--RSLEPQALLGLQN---LYHLHLERNLLRSLAAGLFR--HTPSLASLSLG-NNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTF---PGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIR--QLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVF 382          

HSP 3 Score: 77.7962 bits (190), Expect = 2.835e-13
Identity = 68/231 (29.44%), Postives = 107/231 (46.32%), Query Frame = 2
Query: 1100 LFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATA----------------------GPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI 1711
            L+++ NNL + P       +SL FL+LQ + +R +       L NL  LHL++N + S+    F    SL SL LG N L R+E G+F  +  L  LNL   +   L + P++    L NL  + L GN++ +   A                        +F +LP+L  L L  N IT +    F G   ++ +DLS N + G    TF  L+   + +RL  N ++++
Sbjct:   79 LWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNS---LVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHV-LRLAHNAITSL 305          
BLAST of Epiphycan vs. UniProt/SwissProt
Match: sp|P35859|ALS_RAT (Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus OX=10116 GN=Igfals PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.451e-22
Identity = 145/580 (25.00%), Postives = 235/580 (40.52%), Query Frame = 2
Query:  185 CPIPCKCTHH------SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFN-----------------------KGLIKLLHVYLGNNEFEKIP--VLKA-THMTKLNLDSNKIRSAVVDKSFLLNTG-LQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLD---LSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDI-RFSAMAKLTHLFMNDNNLINCPHRLPASL---KFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSC 1804
            CP+ C C+H       SV C  + L  +P  I +    L L  N + S+ + +FQ L +L  L L  + ++ +   A +GL NL  LHLE N L  L    F                        +GL  L  + LG N    +P  V +   ++ +L L  NK+    +  +     G L+ L L++N ++ +    FV+L   +   L    N +  +A  AF+ +K +L  L+L  N++  + ++E     F G  G   L L    + S     L+P     LH L+   L  N + + +    F GL  L++L L   +I++  +  FS +  +  + ++ N L + P R+   L     LHL+ + +  +R   F  L+ L+ L L+ NSI SIE  S   L+ L  LDL  NRLT +   +F                           L +LE + L  N++     +  +   L +   L +  N +  L E LFS    ++ + L  NSL     +TF P                                  L+ + L+ N W+CSC
Sbjct:   41 CPVACTCSHDDYTDELSVFCSSKNLTHLPDDIPVSTRALWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYYLHLERNRLRNLAVGLFTHTPSLASLSLSSNLLGRLEEGLFQGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKL--TYLQPALFCGLGELRELDLSRNALRSVKANVFVHLPRLQKLYLDR--NLITAVAPGAFLGMK-ALRWLDLSHNRV--AGLMEDT---FPGLLGLHVLRLAHNAIAS-----LRPRTFKDLHFLEELQLGHNRI-RQLGERTFEGLGQLEVLTLNDNQITEVRVGAFSGLFNVAVMNLSGNCLRSLPERVFQGLDKLHSLHLEHSCLGHVRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTTNRLTHLPRQLFQG-------------------------LGHLEYLLLSYNQLT--TLSAEVLGPLQRAFWLDISHNHLETLAEGLFSSLGRVRYLSLRNNSL-----QTFSPQ-------------------------------PGLERLWLDANPWDCSC 541          
BLAST of Epiphycan vs. UniProt/SwissProt
Match: sp|F7D3V9|LGR5_XENTR (Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis OX=8364 GN=lgr5 PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.571e-22
Identity = 138/484 (28.51%), Postives = 210/484 (43.39%), Query Frame = 2
Query:  185 CPIPCKCTHHS----VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLEN------------------------NDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKL---NLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQ--ILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPH----RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKL 1525
            CP PC+C        VDC  +AL  +P+ +SI  + LDLS N I +L +N    L  L+ L+L+ N++  I + AF GL +L+ L L+N                        N +S + P +FN GL  L H++L +N   +IPV     ++ L    L  NKI   + D +F   + L  L L  N I  + +  F       L TL L  N+L+   A A   +KN L  L    N +   +I EQA  G             +  L +I       F+D+ + H           +   AF+ L  L+  ILN A      PD+  +    L  L +    L+  P     +LP +L+ L L  N+I+ +    F     L+++ L+ N +  I + +F  L  L SLDL +N++  I    F  +P LI L+L   +   LT  P +  L  L  ++L GN    D       ++ PKL
Sbjct:   32 CPTPCECEQEGMLVRVDCSDRALTSLPRNLSIFTSYLDLSMNNITNLPSNVMHNLHFLEELRLAGNDLTYIPKGAFAGLGSLKVLMLQNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFN-GLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHH-IPDYAFRNLSSLVVLHLHNNRIYSLGKKCF--DGLHSLETLDLNYNNLDEFPA-AIKTLKN-LKELGFHSNNI--KSIPEQAFIG-------------NPSLITIH------FYDNPIQH-----------VGRSAFQHLPELRTLILNGASQITEFPDL--TGTTSLESLTLTGAQLVYLPSAVCTQLP-NLQVLDLSYNHIKDL--PSFSGCQRLQKIDLRHNEVYEIRSTTFQQLVGLRSLDLAWNKIAVIHPNSFSSLPSLIKLDLSSNH---LTSFPVT-GLHGLTHLKLTGNSALQDLIPS---EHFPKL 465          

HSP 2 Score: 73.559 bits (179), Expect = 9.929e-12
Identity = 86/297 (28.96%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH---LQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGI----------FHRM-------------PKLISLNLE------------QQNPVLLTIA----------PNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI 1711
            +N++L+ + ++A   L +LQ L L    IS  P   F+ +  L HL+++DN+L   P R   SL  L    L  N I  I    F++L++L  LHL  N I S+    FD L SL +LDL +N L    + I          FH               P LI+++              Q  P L T+           P+    ++LES+ L G ++ +  +A  +   LP L  L L  N I  L    FSG   +Q IDL  N +    + TF  L+     + L  NK++ I
Sbjct:  119 QNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFNGLFSLRHLWLDDNSLTEIPVRALESLSALQAMTLALNKIHHIPDYAFRNLSSLVVLHLHNNRIYSLGKKCFDGLHSLETLDLNYNNLDEFPAAIKTLKNLKELGFHSNNIKSIPEQAFIGNPSLITIHFYDNPIQHVGRSAFQHLPELRTLILNGASQITEFPDLTGTTSLESLTLTGAQLVYLPSA--VCTQLPNLQVLDLSYNHIKDLPS--FSGCQRLQKIDLRHNEVYEIRSTTFQQLVGLR-SLDLAWNKIAVI 410          

HSP 3 Score: 56.6102 bits (135), Expect = 1.596e-6
Identity = 56/189 (29.63%), Postives = 95/189 (50.26%), Query Frame = 2
Query: 1094 THLFMNDNNLINCPHRLPASLKFL---HLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAK 1645
            ++L ++ NN+ N P  +  +L FL    L  N++  I +  F  L +LK L L+ N +  + + +  +L SL SL L  N ++ +    F+ +  L  L L+  +   LT  P   +  LS L+++ L  N+I         F NL  LV L L +N+I  L +  F G  +++ +DL+ N+L  +PA 
Sbjct:   66 SYLDLSMNNITNLPSNVMHNLHFLEELRLAGNDLTYIPKGAFAGLGSLKVLMLQNNLLRQVPSEALHNLRSLQSLRLDANHISYVPPSSFNGLFSLRHLWLDDNS---LTEIPVRALESLSALQAMTLALNKIHHIPDYA--FRNLSSLVVLHLHNNRIYSLGKKCFDGLHSLETLDLNYNNLDEFPAA 249          
BLAST of Epiphycan vs. UniProt/SwissProt
Match: sp|F1MLX5|LGR4_BOVIN (Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus OX=9913 GN=LGR4 PE=3 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 2.892e-22
Identity = 120/425 (28.24%), Postives = 189/425 (44.47%), Query Frame = 2
Query:  185 CPIPCKC-THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-----------------------PETFNKGLIKLLHVYLGNNEFEKIPVLKATHMT---KLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF--------VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-NLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAK-LTHLFMNDNNLINCPHRLPA-SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIES 1345
            C  PC C     VDC  + L  VP+G+S    +LD+S N I  L  ++F+    L+ L+L+ N++  I+  A  GL  L+ L L+NN L  +                        PE   +GL +L H++L +N   ++PV   +++     L L  NKI S++ D +F   + L  L L  N+IK + Q  F        ++L    L      + +L ++    F     S+I +   +GN LL +  +      F G + F  L                    S+LH L +   SM++   N    G   L+ L L   KIS          K L  L ++ N++ + P      +L+ + LQ N I QI++D F+ LT+LK L L +N I  I+  +F  L S+T+LD+ FN LT   +
Sbjct:   29 CAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQLLDISMNNITQLPEDAFKNFPFLEELRLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSSLQSLRLDANHITSVPEDSFEGLTQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKI-SSIPDFAFTNLSSLVVLHLHNNKIKSLGQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELLFHSNSISVIPDGAFDGNPLLKTIHLYDNPLSFVGNSAFHNL--------------------SELHSLVIRGASMVQRFPN--LTGTVRLESLTLTGTKISSISNNLCQEQKRLRTLDLSYNSIKDLPSFNGCHALEEISLQRNQIHQIKEDTFQGLTSLKILDLSRNLIHEIDDRAFAKLGSITNLDVSFNELTSFPT 430          

HSP 2 Score: 73.559 bits (179), Expect = 8.819e-12
Identity = 93/358 (25.98%), Postives = 147/358 (41.06%), Query Frame = 2
Query:  824 TIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLK--PFFDS-KLHHLDLS------------------ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP----HRLP-----------------------ASLKFLHLQSNNIRQIRQDDF-----------------------KSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIK---------------FDATAG-----PIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMN 1621
            T V + L+ F      Q LD+    +T +  D  K  PF +  +L   DLS                  +N+ LK++ ++A RGL +LQ L L    I+  P+  F  + +L HL+++DN+L   P      LP                       +SL  LHL +N I+ + Q  F                       K+L +LKEL    NSI  I   +FD    L ++ L  N L+ + +  FH + +L SL +   +  ++   PN      LES+ L G +I                 D +       P F+    L  +SL+ NQI ++ E+ F G  +++++DLS N
Sbjct:   49 TAVPEGLSAFT-----QLLDISMNNITQLPEDAFKNFPFLEELRLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSSLQSLRLDANHITSVPEDSFEGLTQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIKSLGQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELLFHSNSISVIPDGAFDGNPLLKTIHLYDNPLSFVGNSAFHNLSELHSLVIRGAS--MVQRFPNLTGTVRLESLTLTGTKISSISNNLCQEQKRLRTLDLSYNSIKDLPSFNGCHALEEISLQRNQIHQIKEDTFQGLTSLKILDLSRN 399          

HSP 3 Score: 64.6994 bits (156), Expect = 5.262e-9
Identity = 66/230 (28.70%), Postives = 112/230 (48.70%), Query Frame = 2
Query:  956 LDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPH---RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            LD+S N++ + +  DAF+    L+ L LA   +S   P    S + +L  L + +N L   P    R  +SL+ L L +N+I  + +D F+ LT L+ L L  NS+  +  +   +L +L +L L  N+++ I    F  +  L+ L+L   N  + ++  + F  L NLE+++L  N +     A      LP L  L    N I+ + +  F G+  ++ I L  N L
Sbjct:   62 LDISMNNITQ-LPEDAFKNFPFLEELRLAGNDLSFIHPK-ALSGLKELKVLTLQNNQLKTVPSEAIRGLSSLQSLRLDANHITSVPEDSFEGLTQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHL--HNNKIKSLGQHCFDGLDNLETLDLNYNNLGEFPQA---IKALPSLKELLFHSNSISVIPDGAFDGNPLLKTIHLYDNPL 284          

HSP 4 Score: 57.3806 bits (137), Expect = 8.092e-7
Identity = 56/201 (27.86%), Postives = 93/201 (46.27%), Query Frame = 2
Query: 1109 NDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDF---------------------KSLTNLKELH---LKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWP 1639
            +   L   P  L A  + L +  NNI Q+ +D F                     K+L+ LKEL    L+ N + ++ + +   L+SL SL L  N +T +    F  + +L  L L+  +   + + P S  L  L+++ L  N+I   +     F NL  LV L L +N+I  L ++ F G  N++ +DL+ N+L  +P
Sbjct:   44 SGKGLTAVPEGLSAFTQLLDISMNNITQLPEDAFKNFPFLEELRLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSSLQSLRLDANHITSVPEDSFEGLTQLRHLWLDDNSLTEVPVHPLS-NLPTLQALTLALNKIS--SIPDFAFTNLSSLVVLHLHNNKIKSLGQHCFDGLDNLETLDLNYNNLGEFP 241          
BLAST of Epiphycan vs. UniProt/SwissProt
Match: sp|Q9BXB1|LGR4_HUMAN (Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens OX=9606 GN=LGR4 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 3.447e-21
Identity = 116/425 (27.29%), Postives = 188/425 (44.24%), Query Frame = 2
Query:  185 CPIPCKC-THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-----------------------PETFNKGLIKLLHVYLGNNEFEKIPVLKATHMT---KLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF--------VXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-NLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPA-SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIES 1345
            C  PC C     VDC  + L  VP+G+S     LD+S N I  L  ++F+    L+ L+L+ N++  I+  A  GL  L+ L L+NN L  +                        PE   +GL++L H++L +N   ++PV   +++     L L  NKI S++ D +F   + L  L L  N+I+ ++Q  F        ++L    L      + +L ++    F     S+I +   +GN LL +  +      F G + F  L                    S LH L +   SM++   N    G  +L+ L L   KIS  P+        L  L ++ NN+ + P      +L+ + LQ N I QI++  F+ L +L+ L L +N I  I + +F  L  +T+LD+ FN LT   +
Sbjct:   29 CAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKI-SSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNL--------------------SDLHSLVIRGASMVQQFPN--LTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPT 430          

HSP 2 Score: 80.1073 bits (196), Expect = 9.547e-14
Identity = 82/288 (28.47%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP-HRLP--ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQ------------QNPVLLTIA----PNSFV-------LSNLESIELQGNRI--KFDATAG-----------------------------------------PIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMN 1621
            +N+ LK++ ++A RGL  LQ L L    I+  P+  F  + +L HL+++DN+L   P H L    +L+ L L  N I  I    F +L++L  LHL  N I S+  + FD L +L +LDL +N L      I   +P L  L                 NP+L TI     P SFV       LS+L S+ ++G  +  +F    G                                         P F+    L  +SL+ NQI ++ E  F G ++++++DLS N
Sbjct:  113 QNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAI-KALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRN 399          

HSP 3 Score: 63.929 bits (154), Expect = 9.376e-9
Identity = 71/260 (27.31%), Postives = 125/260 (48.08%), Query Frame = 2
Query:  866 GFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPH---RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            G + +D    GLT++  + L  F  +    LD+S N++ + +  DAF+    L+ L LA   +S   P    S + +L  L + +N L   P    R  ++L+ L L +N+I  + +D F+ L  L+ L L  NS+  +  +   +L +L +L L  N+++ I    F  +  L+ L+L   N  + +++ + F  L NLE+++L  N +     A      LP L  L    N I+ + +  F G+  ++ I L  N L
Sbjct:   37 GDRRVDCSGKGLTAVP-EGLSAFTQA----LDISMNNITQ-LPEDAFKNFPFLEELQLAGNDLSFIHPK-ALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHL--HNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQA---IKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPL 284          

HSP 4 Score: 55.0694 bits (131), Expect = 4.689e-6
Identity = 55/201 (27.36%), Postives = 94/201 (46.77%), Query Frame = 2
Query: 1109 NDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFK---------------------SLTNLKELH---LKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWP 1639
            +   L   P  L A  + L +  NNI Q+ +D FK                     +L+ LKEL    L+ N + ++ + +   L++L SL L  N +T +    F  + +L  L L+  +   + + P S  L  L+++ L  N+I   +     F NL  LV L L +N+I  L+++ F G  N++ +DL+ N+L  +P
Sbjct:   44 SGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLS-NLPTLQALTLALNKIS--SIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFP 241          
BLAST of Epiphycan vs. TrEMBL
Match: L1I8L9 (Uncharacterized protein OS=Guillardia theta (strain CCMP2712) OX=905079 GN=GUITHDRAFT_121393 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.834e-41
Identity = 169/563 (30.02%), Postives = 269/563 (47.78%), Query Frame = 2
Query:  197 CKCTHHSVDCRHQALKDVPKGI---SIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVL---KATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTG---------------------FNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGP--IFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLS----TISIDFNSTNYLPIDFAKLKNI 1771
            C  T  SVD  +  ++ + +G+   +  +T + LS N + S+    F  L +L+ L LS N++  I E  F GL+++R L L  N+L+ + PET   GL  L ++YL NN+   +P         +  L L SNK+ S V +  F     L++L L  NE+  + +T F  L + +   L    N L +I A  F  +  SL  L L  NKL  +++ E    G                     F+G    Q+L L S  LTS+          + L  L LS N  L S+    F GL +LQ L L+  K++  P+  F+ +A L  L+++ N L + P  +    ASL++L+L  N +  I    F  LT+L+ L+L  N + S+    FD LASL +L L  N+LT + + +F+ +  L +L L      L +I    F  L++L+++ L  N +    T+ P  +F  L  L  L L  N++T + E +F+G  ++Q + LS N L   P   F  L +S   + L+ N+L+    T+     S  YL +   KL ++
Sbjct:   64 CTTTCTSVDLSYAGIRRIDEGVFNNTWSLTEIRLSGNKLTSVPATVFAGLASLQYLYLSSNKLTSIPETVFAGLASIRVLILSGNELTSV-PETVFAGLASLQYLYLDNNKLTSVPATVFNGLASLQTLYLSSNKLTS-VPETVFNGLASLRSLYLDNNELTSVPETVFAGLASLQTLYLYD--NELTSIPATVFAGLA-SLQTLYLSYNKL--TSVPETVFDGLASLRSLYLSYNELTSVPETVFDGLASLQYLYLSSNKLTSVPATVFAGL--TSLQTLYLSGNE-LTSVPETVFTGLASLQTLYLSSNKLTSVPETVFNGLASLQTLYLSSNKLTSVPATVFAGLASLQYLYLYDNELTSIPATVFAGLTSLQSLYLSSNKLTSVPETVFDGLASLQTLYLSSNKLTSVPATVFNGLASLQTLYLYDNE--LTSIPATGFNGLASLQTLYLSSNEL----TSIPETVFAGLASLQTLYLSGNELTSVPETVFAGLASLQTLYLSGNELTSVPETVFAGL-ASLQTLYLSSNELTSIPETVFAGLASLQYLYLSSNKLTSV 609          

HSP 2 Score: 167.933 bits (424), Expect = 4.530e-38
Identity = 159/514 (30.93%), Postives = 251/514 (48.83%), Query Frame = 2
Query:  212 HSVDCRHQALKDVPKGIS---IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLN---LDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATAGP--IFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI 1711
             S+   +  L  VP+ +      +  L LS N + S+    F  L +L+ L LS NE+  + E  F GL++L+ L+L +N L+ + PET   GL  L  +YL +N+   +P      +  L    L  N++ S +    F   T LQ+L L+ N++  + +T F       L TL L  N L ++ A  F  +  SL  L L  N+L          TGFNG    Q L L S  LTSI          + L  L LS N  L S+    F GL +LQ L L+  +++  P+  F+ +A L  L+++ N L + P  +    ASL++L+L SN +  + +  F  L +L+ L+L  N + S+    F+ LASL +L L +N+LT + + +F  +  L SL L       LT  P +    L++L S+ L  N +    T+ P  +F  L  L  L L DN++T + E +F+G  ++Q + L  N L   P   F  L +S   + L+ N+L+++
Sbjct:  285 RSLYLSYNELTSVPETVFDGLASLQYLYLSSNKLTSVPATVFAGLTSLQTLYLSGNELTSVPETVFTGLASLQTLYLSSNKLTSV-PETVFNGLASLQTLYLSSNKLTSVPATVFAGLASLQYLYLYDNELTS-IPATVFAGLTSLQSLYLSSNKLTSVPETVF--DGLASLQTLYLSSNKLTSVPATVFNGLA-SLQTLYLYDNEL-----TSIPATGFNGLASLQTLYLSSNELTSIPETVFAGL--ASLQTLYLSGNE-LTSVPETVFAGLASLQTLYLSGNELTSVPETVFAGLASLQTLYLSSNELTSIPETVFAGLASLQYLYLSSNKLTSVPETVFAGLASLQTLYLSYNELTSVPETVFNGLASLQTLYLSYNKLTSVPATVFAGLASLRSLGLYDNK---LTSVPATVFAGLASLRSLSLDFNEL----TSIPETVFAGLTSLQTLYLYDNELTSVPETVFNGLASLQYLYLDNNKLTSIPETVFAGL-ASVQTLYLSGNELTSV 777          

HSP 3 Score: 139.043 bits (349), Expect = 3.097e-29
Identity = 161/574 (28.05%), Postives = 242/574 (42.16%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLN----------------------STIVEQALTG---------------------FNGATGFQFLDLKSCGLTSI----------------SGDFLKPFFD------SKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPA---------------------------------------------------SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPA 1642
            L LS N + S+    F  L +L+ L LS NE+  + E  F GL++L+ L+L  N+L+ + PET   GL  L  +YL +NE   IP         +  L L SNK+ S V +  F     LQTL L+ NE+  + +T F       L TL L  N L ++ A  F  +  SL +L L  NKL +                      ++I E    G                     FNG    Q+L L +  LTSI                SG+ L    +      + L +L++S N  L S+    F GL +LQ L+L+  K++  P+  F+ +A L  L++++N L + P  + A                                                   SL+ L+L SN +  I  D F  L++L  L L  N + S+   +F  LA LT+L +  NRLTR+  G F  +  L +L+L   +   LT    +  L  + +++L  N++  D  A  +  NL  L NLSL DNQ+T L+  +      ++ + LS N L   PA
Sbjct:  503 LYLSSNELTSIPETVFAGLASLQTLYLSGNELTSVPETVFAGLASLQTLYLSGNELTSV-PETVFAGLASLQTLYLSSNELTSIPETVFAGLASLQYLYLSSNKLTS-VPETVFAGLASLQTLYLSYNELTSVPETVF--NGLASLQTLYLSYNKLTSVPATVFAGLA-SLRSLGLYDNKLTSVPATVFAGLASLRSLSLDFNELTSIPETVFAGLTSLQTLYLYDNELTSVPETVFNGLASLQYLYLDNNKLTSIPETVFAGLASVQTLYLSGNELTSVPETVFNGLASLQYLNVSSNE-LTSVPETVFDGLASLQTLDLSYNKLTSVPETVFAGLASLRSLYLDNNELTSVPETVFAGLDSLWRLDLHSNRLASLALSLFYDCHDLMELYLNNNLLSGLLPGSLDGLVSLEALYLHSNQLADISSDVFAQLSSLTTLTLHNNRLSSLSPGAFAGLARLTTLSIHHNRLTRLSPGAFQGLSTLATLDLHDNHLTSLTAGALTG-LDAMRALDLSSNKLA-DLPAQAL-HNLTGLRNLSLDDNQLTSLSAGVLEPLAGLEYLWLSHNRLAEVPA 1067          

HSP 4 Score: 130.183 bits (326), Expect = 1.829e-26
Identity = 139/484 (28.72%), Postives = 225/484 (46.49%), Query Frame = 2
Query:  359 LSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI-SIDFNSTNYLPIDFAKLKNISLENNQ 1789
            LS+  ++ I+E  F    +L  + L  N L+ + P T   GL  L ++YL +N+   IP                      +  F     ++ LIL+ NE+  + +T F  L + +   L    N L ++ A  F  +  SL  L L  NKL  +++ E   T FNG    + L L +  LTS+          + L  L L +N  L SI    F GL +LQ L L+  K++  P+  F  +A L  L+++ N L + P  +    ASL++L+L SN +  +    F  LT+L+ L+L  N + S+    F  LASL +L L  N+LT +   +F+ +  L +L L       LT  P +    L++L+ + L  N +   +    +F  L  L +L L  N++T + E +F G  ++Q + LS N L   PA  F  L +S   + L  N+L++I +  FN         A L+ + L +N+
Sbjct:   73 LSYAGIRRIDEGVFNNTWSLTEIRLSGNKLTSV-PATVFAGLASLQYLYLSSNKLTSIP----------------------ETVFAGLASIRVLILSGNELTSVPETVFAGLASLQYLYLDN--NKLTSVPATVFNGLA-SLQTLYLSSNKL--TSVPE---TVFNGLASLRSLYLDNNELTSVPETVFAGL--ASLQTLYLYDNE-LTSIPATVFAGLASLQTLYLSYNKLTSVPETVFDGLASLRSLYLSYNELTSVPETVFDGLASLQYLYLSSNKLTSVPATVFAGLTSLQTLYLSGNELTSVPETVFTGLASLQTLYLSSNKLTSVPETVFNGLASLQTLYLSSNK---LTSVPATVFAGLASLQYLYLYDNELT--SIPATVFAGLTSLQSLYLSSNKLTSVPETVFDGLASLQTLYLSSNKLTSVPATVFNGL-ASLQTLYLYDNELTSIPATGFNG-------LASLQTLYLSSNE 509          
BLAST of Epiphycan vs. TrEMBL
Match: A0A1S3ICW5 (chondroadherin-like protein OS=Lingula unguis OX=7574 GN=LOC106163136 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 8.708e-40
Identity = 166/636 (26.10%), Postives = 299/636 (47.01%), Query Frame = 2
Query:  116 MKTRFTFCLLLVIYNLVCLYVF---PCPIPCKCT--HHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVL-KATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSI-SGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPD-IRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLT-------------------IAPNSFVL------SNLESIELQGNRIKF---DATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLIS-SAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQI---QWLLHFRKLILNRDQILCNIPNEKAGKNLF 1903
            ++ +  F   L+I  +VC        CP  C C   +  VDCR++ L ++P GI + V  L L  N +  +  ++F+ LI+L+ L LS+ ++ +I    F   +N+ +L+L +N L   +  +  +GL  +  ++LG NE   IP L +   +    +D+N++ +A   + F     L  + L+ N+I  +   D  +L+ +K+  L L  N +  I   +  P+ ++L++L L G+  L+ST +   L G   +     LD+ +     + + D  +    + L  L +  NS+   ++   F  + N   ++ + C+I D +   F+ MAKL  L +N+N L   P  LP SL+ L L  N I   +   F  + N++ L L+K+ +  I TNSF  L  + +LDL  NR++ I   +F  + KL +L L      L+                    I  +S  L      S L+ + L  N + +   +   G +F NL KL NL+L  N+I++L    F    +++ + LS N +  + ++ F P+ S  A+++  NM  L       NS++   ++  +L+ + L  + + C+C  +   +W+      +   D   CN P E+ G  L 
Sbjct:    2 VRYKIPFFCALIILAIVCASKSNGQTCPNKCHCKNNYQIVDCRNRGLSEIPSGIPVSVQELRLDHNTLTDIQADAFKGLIHLRVLYLSNCKINKIAPGTFKEPTNITDLYLTSNVLKDFNATSL-QGLQNVQMLHLGGNELTAIPDLGRLRALVSFVIDTNELSNASFPEGFGKLLNLTRITLSNNKITRLADGDLKSLRQSKVAKLYLARNQIAQIGKLSLEPIADTLVSLSL-GHNPLSSTSLRDGLFGLRQSKQLTSLDIPALSFGGVMNSDTFQYLNSTPLLKLKMYCNSV-HQLEPRLFSHVRNADYIDASSCQIRDIEQTVFAGMAKLKELRLNENFLSYVPQNLPNSLRILDLSENQIINFKDFQFAGMRNIETLRLRKSGVERIPTNSFAGLEKIKTLDLSENRISSIGKSVFGMLHKLKTLKLNDNRIGLIQTDIFSSSSALQFLDMSKNYIGRSSIPLDLFKGTSKLKILFLSDNELGYVFKNDPNGMLFKNLYKLENLTLERNRISQLWPAQFQNLTSVKNLSLSDNQVSFFTSQLFAPMTSLRALNLSQNMISL------VNSSSIGGLE-GRLQTLDLSGSPFACTCDLVWFRRWINQTNITLSQLDVYTCNTPAERRGMPLL 627          
BLAST of Epiphycan vs. TrEMBL
Match: A0A0D2WX36 (LRRNT domain-containing protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_007756 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.819e-39
Identity = 177/571 (31.00%), Postives = 264/571 (46.23%), Query Frame = 2
Query:  197 CKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLN---LDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKF---LHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRI-KFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTI-SIDFNSTNYLPIDFAKLKNISLENNQ-WNCSCHQIQWLLHFRKLILNRDQILCNIP 1876
            C CT   V+C  ++L  +P GI    T L L  N I S+S+++F  L  L  ++L  N++  +  NAF GLS L  L L NN LS +    F  GL  L+ + L NN+   +P    T +T L    L +N+I +  ++ +F   T LQTL L  N+I  +    F       L  L L  N +  + A AF  +   L  L+L  N L  S I   A TG    T    L L +  +T++  +       + L +L L  N+ + ++  +AF G   L  L L   +I+  P    + ++ LT L++ +N + + P    + L     L L +N I  I  + F  LT L  L L  N + SI   +F  L +LT L L  N L+ + S  F  +  LI L L   N  + T+A N+F  L+ L  ++L GN+I    A+A   F  L  LV L L  N+IT +  N F+G  ++ L++LS N +   PA  F  L ++   + L  N LS + S  F            L+ + L NNQ    + +    L     L L R+QI   IP
Sbjct:   36 CTCTGTLVNCISRSLTAIPTGIPATTTTLYLQSNQITSISSSAFTGLTALTYMRLDTNQITTVPANAFSGLSTLNTLQLNNNWLSAIPSSAF-TGLTALIQLLLNNNQITTVPSSAFTGLTALQILYLHNNQIATVAIN-AFSGLTALQTLYLYNNQIITVATNAF--SGLAALQVLRLDTNQITTVPANAFSGLSK-LNTLQLNNNWL--SAIPSSAFTGL---TALIQLRLDTNQITTVPANAFSGL--TALIYLYL-YNNQITTVATNAFSGPTALVQLQLYGNQITTIPSSALTGLSALTQLYLYNNQITSVPANGFSGLTALTDLRLSNNTITSILANAFTGLTKLTYLDLSLNQLTSIPAGAFSGLTALTQLLLFNNWLSAVPSSAFTGLTALIYLYLN--NNQITTVAANAFTGLTALVQLQLYGNQITTIPASA---FAGLSALVQLYLYSNRITAIFVNAFTGLTHLSLLELSNNQITSLPANAFAGL-TAMTQLSLYNNSLSAVPSSAFT-------GLTALQALYLYNNQITTVAANAFTGLTALVLLHLYRNQI-TTIP 579          

HSP 2 Score: 139.813 bits (351), Expect = 9.404e-30
Identity = 145/504 (28.77%), Postives = 222/504 (44.05%), Query Frame = 2
Query:  239 LKDVPKGISIDVTILDLSF---NLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPV---LKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLN----------------------STIVEQALTG---------------------FNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLK---FLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRI-KFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSG 1585
            L  VP      +T L   +   N I +++ N+F  L  L +L+L  N++  I  +AF GLS L  L+L +N ++ +    F  GL  L  + L NN+   +P       T MT+L+L +N + SAV   +F   T LQ L L  N+I  +    F  L    L  L    N +  I A AF  +  +L+ L L  N++                        +++   A TG                     F G T  Q L L +  ++S++ +       + L  L L  N ++ +I   AF GL  L +L L    +S  P   F+ +  LT L ++ N +   P    + L    +L L  N I  I    F  LT L+ L+L  N+I +I  N+F  L +L  LDL  +++T I + +F  +P L  LNL   N  L  +  ++F  L+ L  + + GNRI    A A   F  L  LV L L+ NQIT ++ + F+G
Sbjct:  407 LSAVPSSAFTGLTALIYLYLNNNQITTVAANAFTGLTALVQLQLYGNQITTIPASAFAGLSALVQLYLYSNRITAIFVNAF-TGLTHLSLLELSNNQITSLPANAFAGLTAMTQLSLYNNSL-SAVPSSAFTGLTALQALYLYNNQITTVAANAFTGLTALVLLHLYR--NQITTIPASAFAGLS-ALVQLYLNSNRITTIFANAFPSLTKLTYLDISNNQITSLPANAFTGLTAMTQLHLYNNLFSTVPSSAFTGLTALQALFLFNNQISSVAANAFTSL--TALIQLQLYGN-LITTIPAGAFSGLSKLNLLQLYNNWLSAIPSSAFTGLTALTQLRLDTNQITTVPANAFSGLTALIYLSLYGNQITTISASAFAGLTALQALYLNDNTITTIAANAFAGLTALNWLDLSDSQITSIPANVFSSLPALAQLNLY--NNWLSAVPTSAFTGLTALTQLTMYGNRITTISANA---FTGLNALVQLFLQSNQITTISASAFTG 897          

HSP 3 Score: 128.642 bits (322), Expect = 3.079e-26
Identity = 140/476 (29.41%), Postives = 216/476 (45.38%), Query Frame = 2
Query:  272 VTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPV---LKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIK-FDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTF--LPLIS 1666
            +T LDLS N + S+   +F  L  L +L L +N +  +  +AF GL+ L  L+L NN ++ +    F  GL  L+ + L  N+   IP       + + +L L SN+I +A+   +F   T L  L L+ N+I  +    F  L      +L    NSL  + + AF  +        L+   L N+ I   A   F G T    L L    +T+I          S L  L L+ N +  +I  +AF  L  L  L+++  +I+  P   F+ +  +T L + +N     P        +L+ L L +N I  +  + F SLT L +L L  N I +I   +F  L+ L  L L  N L+ I S  F  +  L  L L+     + T+  N+F  L+ L  + L GN+I    A+A   F  L  L  L L DN IT +  N F+G   +  +DLS + +   PA  F  LP ++
Sbjct:  373 LTYLDLSLNQLTSIPAGAFSGLTALTQLLLFNNWLSAVPSSAFTGLTALIYLYLNNNQITTVAANAF-TGLTALVQLQLYGNQITTIPASAFAGLSALVQLYLYSNRI-TAIFVNAFTGLTHLSLLELSNNQITSLPANAFAGLTAMTQLSLYN--NSLSAVPSSAFTGLT------ALQALYLYNNQITTVAANAFTGLTALVLLHLYRNQITTIPASAFAGL--SALVQLYLNSNRI-TTIFANAFPSLTKLTYLDISNNQITSLPANAFTGLTAMTQLHLYNNLFSTVPSSAFTGLTALQALFLFNNQISSVAANAFTSLTALIQLQLYGNLITTIPAGAFSGLSKLNLLQLYNNWLSAIPSSAFTGLTALTQLRLDTNQ--ITTVPANAFSGLTALIYLSLYGNQITTISASA---FAGLTALQALYLNDNTITTIAANAFAGLTALNWLDLSDSQITSIPANVFSSLPALA 830          

HSP 4 Score: 89.7373 bits (221), Expect = 2.900e-14
Identity = 104/359 (28.97%), Postives = 152/359 (42.34%), Query Frame = 2
Query:  272 VTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDS--NKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRI 1339
            +T LD+S N I SL  N+F  L  + +L L +N    +  +AF GL+ L+ L L NN +S +    F   L  L+ + L  N    IP    + ++KLNL    N   SA+   +F   T L  L L  N+I                            + A AF  +  +LI L L GN++  +TI   A   F G T  Q L L    +T+I+ +       + L+ LDLS+ S + SI  + F  L  L  LNL    +S  P   F+ +  LT L M                       N I  I  + F  L  L +L L+ N I +I  ++F   + LT L L  N++T +
Sbjct:  613 LTYLDISNNQITSLPANAFTGLTAMTQLHLYNNLFSTVPSSAFTGLTALQALFLFNNQISSVAANAFTS-LTALIQLQLYGNLITTIPAGAFSGLSKLNLLQLYNNWLSAIPSSAFTGLTALTQLRLDTNQITT--------------------------VPANAFSGLT-ALIYLSLYGNQI--TTISASA---FAGLTALQALYLNDNTITTIAANAFAGL--TALNWLDLSD-SQITSIPANVFSSLPALAQLNLYNNWLSAVPTSAFTGLTALTQLTM---------------------YGNRITTISANAFTGLNALVQLFLQSNQITTISASAFTGPSLLTQLYLSNNQITTM 914          
BLAST of Epiphycan vs. TrEMBL
Match: A0A2H4HHW4 (Toll-like recptor 11 OS=Oncomelania hupensis OX=56141 GN=TLR11 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.954e-37
Identity = 180/639 (28.17%), Postives = 294/639 (46.01%), Query Frame = 2
Query:  185 CPIPCKC--THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNK-GLIKLLHVYLGNNEFEKIPVLKA-THMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLS----ENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLES---IELQGNR---IKFDATAGPIFDNLPKLVNLSLRDNQITKL-----NENLFSGSVNIQL------------------------IDLSMNSLIGWPAKTFL---PLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKL-------ILNRDQILCNIPNEKAGKNLFLV---MVNCSD 1927
            CP  C+C     SV+C  + L D+P+GI   V  L L  N    L   + +    L ++ L   +++ ++  AF  LS L+ L+L NN++  L PE F K G + LL+  L  N    +P L     +T L L++N+I++    + +     L T++L+ N + E+    F  L N  L  L +  ++++ + A A  P+   L +L++ G   ++   +   L G +  +G   LD++   +  + G      F S L H  L      N+ + +I   AF  L  L  L+L  CKIS  DP   FS +  L  LF+N+N L   P  LP+SL  L+LQ N++  ++  DF +L  L+EL+L  + I  +  +SF  L +L  L L  N+L+ I   +F   PKL  LNL   N  + ++ PN   +++L S   +++  N    I FD      F +L  L NL L  N++  L     +  L SG VN+Q                         I+L  N +  W  K F     L  +   + L++N ++ +    N T+   + F ++ N+S   N + C+C  ++W   FR         + N+ +  CN P E   K L+      +NC+D
Sbjct:   96 CPAKCQCGKAGTSVNCVGKGLTDIPEGIPSQVETLYLDRNNFGVLKPGALENFQFLSKVYLRSCKIQTVSPGAFHNLSLLQELYLGNNNIDQLQPEAFQKAGALYLLN--LQANRLTSVPDLHTLPGLTNLVLEANRIQNGTFPEGYSSLQKLSTVVLSNNNLTELTNGTFTTLANCSLRRLEISRSNIKRVEAGALTPLV-MLQSLKI-GYNPIDGEQLHNLLEGLSADSGLVSLDIR---MIDLRGSLPSVSF-SILAHTPLITLHFRNNEVGTIPAKAFANLPKLTTLDLQICKISVVDPQA-FSDLPALQLLFLNNNALTTVPKTLPSSLTKLYLQFNSLSALKGGDFSNLGKLQELYLSTSGITEVNEDSFLGLNNLVILHLNQNKLSNIPKKLFSYTPKLRILNLRNNN--IQSLKPNPGAMASLTSLLTLDMSHNNCGYIPFD-----YFTDLTSLENLDLSYNRLGGLMAGDVSGRLLSGMVNLQRLSLESNNINFIYDAQFQNLHKLANINLKNNRISSWGPKLFYTPGTLRKTLKTVDLSINTIALV----NETSVRDLQFVQMLNLS--TNPFACTC-DLRW---FRAWLENTTINVANKTKYTCNSPAEWEHKLLWTFGADKINCTD 708          
BLAST of Epiphycan vs. TrEMBL
Match: A0A2I7NB23 (Tool like receptor 3 OS=Octopus vulgaris OX=6645 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.785e-36
Identity = 170/640 (26.56%), Postives = 299/640 (46.72%), Query Frame = 2
Query:  164 VCLYVFPCPIPCKCTHHS--VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKA-THMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSI---SGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKF------------------------LHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRI-KFDAT--AGPIFDNLPKLVNLSLRDNQITK-LNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKL----ILNRDQILCNIPNEKAGKNLF---LVMVNCSDVILSRILS 1951
            +C+    CP  C+C      V C+ Q+L  VPK +     +L L +NL++ ++  SF+ L+ LK L L+ N++  I +N+F   S L +L+L NN +  +   +F  G I L  +YL +N+ + +P L     +  L +++N+I        +     L  + L+ N+I  +     +NL  + +  ++   N + NI  E F  + N + +L L  N    + +++ +L        F    L   GL  I   + +  +   ++ L  L LS +S +  + ++ F+ LD+L++L L  C+I+   +  F+ +  L  LF+N N +       P+ L +                        LHLQ N I Q  +D F  L NLK L L+ N I  I    F  LA L+ L LG N +T I   IF R+  L  L+L   +   ++  P SF   L+ +  + L  N++ KF +T   G +   L  L  + L  N+I   L++ +F  + +++ I    N + GW   TF   +++   + L+++    I+ D +S  Y  I+  K  NI+L  N + C C+ ++W   +       I++++ ++CN P +  GK L       ++C+D  L  IL+
Sbjct:   14 ICIVNTTCPESCQCNKEQTKVSCKRQSLTSVPKSLPTTTEVLSLEYNLLREITAESFKNLVKLKELVLTSNKISVIRKNSFKYQSKLVSLYLINNIIHTIENGSF-VGAISLASIYLNSNQLKDVPCLYGLISLKHLLINTNQISEVFFPAEYRQIKNLTYINLSNNKINRLTVNSLMNLNESNIKKISFSRNQITNIEPETFRVLSN-INSLNLAENP-FTADVLKNSLYAMR---NFNLRSLDLSGLKKINVLADNIFEALQNTSLQTLILS-HSNISRVSSNTFKLLDSLEVLKLDFCQIASLEESTFTNLTHLRRLFLNGNYISKLTAVFPSKLLYLYLNSNKIQKVPSKVFDELFHLIELHLQYNKIVQFDKDAFIGLENLKTLKLQHNHINVIPGGLFSTLAGLSDLQLGSNDITTIPEEIFIRLKSLSFLDLSNNH---ISKMPKSFSKELTRIRKLYLDSNKLGKFLSTDKKGFLLSGLKNLERIDLSYNEIQGHLSKKIFQNNKHLKYIYFRGNKITGWENNTF--EVTNLTLMELDVSNNFIITFDSDSLKY--INRKKKFNITL--NPFACDCN-LRWFRDWLNTTTVDIVDKNDLMCNSPPDWQGKKLLDFSRSKIDCTDYTLYYILA 636          
BLAST of Epiphycan vs. Ensembl Cavefish
Match: igfals (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:103036545])

HSP 1 Score: 107.842 bits (268), Expect = 1.481e-23
Identity = 142/514 (27.63%), Postives = 223/514 (43.39%), Query Frame = 2
Query:  188 PIPC--KCT--------HHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKN--------------EIKEI----NQTDFVXXXXXXXXXXXXXM----NSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLP-------ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPK----LISLNLEQQNP--VLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSG 1585
            PIPC  +CT          SV C  + L   P  +      L L  NL  +L  +SF+ L NL  L L   ++  ++   F  L NL +LHLE N L +L P    +    L  + L NN+  +I        +HM  LNL  N + S + +  F    GL+ L+L+ N              E+KE+    NQ   +            K+    N +  +A  AFV +K SL  L+L  N+L   TI+      F G      L L +  + S+     +      L  LD+  N + +++    F GL +L++L+L   K+ D   R      L+HL +      +C   LP       + L  +HL    + ++    F  L +L+ L L+ N+I +++  SF +L  L  LD+ FN L  + S  F+ +      L+S NL +  P  VLL        L  L  ++L GN+++    A      LP+L  L+L+DN +T L  ++ +G
Sbjct:   30 PIPCSKRCTCLLDDYTSELSVYCSSRNLTQAPPDLPASTRSLWLDGNLFATLPADSFKNLTNLDFLNLQSGQLTSLDSQVFKRLHNLAHLHLERNSLRIL-PAAIFQNTPNLATLNLHNNQLSRIEERLFAGLSHMWLLNLGWNSL-SVLPETGFHDLHGLRELVLSGNRLAYLQPQLFQGLTELKELDLSGNQLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMK-SLRWLDLSRNRL---TILHDE--TFLGLHSLHVLRLSNNSINSLRPGTFRDL--QYLEELDMCHNQI-RALGERVFEGLGHLEVLSLEYNKLQD--ARSGTFMGLSHLAVIKLT-GSCFRSLPDQVFKGLSKLHSMHLDKGCLTKVSTQGFIGLASLRRLFLQHNNISAVDRQSFVELQGLQQLDMRFNNLASLTSHTFYGLKALEYLLLSKNLIRHFPSEVLLP-------LQQLSWLDLSGNKLEVLINA--TLYMLPRLRYLNLKDNFLTTLPSSVPNG 520          

HSP 2 Score: 73.9442 bits (180), Expect = 5.370e-13
Identity = 82/295 (27.80%), Postives = 129/295 (43.73%), Query Frame = 2
Query:  851 FNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSM-----------------------LKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTF 1651
            F   T   FL+L+S  LTS+     K   +  L HL L  NS+                       L  I+   F GL ++ +LNL    +S  P+  F  +  L  L ++ N L     +L      LK L L  N +R I+ + F  L  L++L+L +N I ++   +F  + SL  LDL  NRLT +    F  +  L  L L   N  + ++ P +F  L  LE +++  N+I+  A    +F+ L  L  LSL  N++       F G  ++ +I L+ +     P + F
Sbjct:   86 FKNLTNLDFLNLQSGQLTSLDSQVFKRLHN--LAHLHLERNSLRILPAAIFQNTPNLATLNLHNNQLSRIEERLFAGLSHMWLLNLGWNSLSVLPETGFHDLHGLRELVLSGNRLAYLQPQLFQGLTELKELDLSGNQLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRLS--NNSINSLRPGTFRDLQYLEELDMCHNQIR--ALGERVFEGLGHLEVLSLEYNKLQDARSGTFMGLSHLAVIKLTGSCFRSLPDQVF 374          

HSP 3 Score: 70.4774 bits (171), Expect = 6.570e-12
Identity = 65/206 (31.55%), Postives = 97/206 (47.09%), Query Frame = 2
Query: 1100 LFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTIS 1714
            ++ +  NL   P  LPAS + L L  N    +  D FK+LTNL  L+L+   + S+++  F  L +L  L L  N L  + + IF   P L +LNL   N  L  I    F  LS++  + L  N +      G  F +L  L  L L  N++  L   LF G   ++ +DLS N L    A  FL L      + L  N+++T++
Sbjct:   50 VYCSSRNLTQAPPDLPASTRSLWLDGNLFATLPADSFKNLTNLDFLNLQSGQLTSLDSQVFKRLHNLAHLHLERNSLRILPAAIFQNTPNLATLNL--HNNQLSRIEERLFAGLSHMWLLNLGWNSLSVLPETG--FHDLHGLRELVLSGNRLAYLQPQLFQGLTELKELDLSGNQLRVIKANVFLKL-PKLQKLYLAQNQITTVA 250          
BLAST of Epiphycan vs. Ensembl Cavefish
Match: ENSAMXT00000052087.1 (toll-like receptor 13 [Source:NCBI gene;Acc:103042013])

HSP 1 Score: 106.686 bits (265), Expect = 7.677e-23
Identity = 175/706 (24.79%), Postives = 287/706 (40.65%), Query Frame = 2
Query:  206 THHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI---PVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLE--NIAAEAF-------VPVKNSLINLELEG-------NKL------LNSTIVEQALTGFN-----------GATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLP--ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDD------------------------LASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNEN------------------------------------------LFSGSVNI--------------QLIDLSMNSLIGWPAKTFLPL--------ISSAID-----IRLNMNKLSTISIDFNSTNYLPID----FAKLKNISLENNQWNCSCHQ---IQWLLHFRKL-ILNRDQILCNIPNEKAGKNL 1900
            T+  V C  + L+ VP  I      LD+S+N I  +  N  + L NL+ L +S N + E+ + AF GL+ L  L+LE N L  +    F + L  L  + L  N   +I     L    +  LNL  N + S    +   L   +Q L + KN          V+  + +L  L L  N L+   I A+ F       + + N+ I  E++        N+L      L +   ++ L  FN           G    + L   +C +TS++              L L  N  + SI  +  +   NL +L+LA+  +++   + F +M KL  L +  N L   P  +   +SLK L L  N+I  +   D  +LT L  LH+ +N + S+E  +F D                        L SL  LD   N+L+ I+ GIF  +  L   +LE Q+  +  +   +F  L NL  ++LQ N++   + +  IF  LP L  L L +N+I+  +++                                          L++G++NI               L+D S N+LI   A  F PL        I + I      I+ N+N++  + +  NS   +  +    F+KL ++ L+ N+++C C     I W +H     +L+ D+  CN P+   G  L
Sbjct:   53 TNLKVLCYKRQLQAVPDSIPSRSRALDISYNKISLIKRNDLRDLSNLQHLNISKNMIVEVEDGAFRGLAALEELNLEFNKLKTISDGLF-QNLFNLTFLRLNENRISEISSSAFLPLRSLVMLNLSGNHLHSIHKAQPAFLMPNIQELHIGKNGFASFESLQ-VSNTSIQLKALDLSHNPLQLFRITADIFPHLETLDLALINTSIKWEVQNKDYFRNVNRLNISGIQLATEETKELLRTFNSTLDNLRLYYFGEEKAKSLVKDACLITSLTS-------------LRLESNG-INSISENELKHCKNLILLDLAENHLTNISPLTFKSMGKLNTLSLTHNKLKKVPKAIRNLSSLKVLDLGYNSITTVACSDLTNLTGLITLHIYRNPLSSVEHCAFQDLQNLKVLLIGSARLFTLKGYFMRGLQSLQRLDTSHNKLSTIQKGIFKGLLNLT--HLEFQDNQIQILEEGAFEGLDNLIILDLQSNKLTKSSISASIFSGLPNLKELVLNNNRISYTSQSSLSVPPFKNLNSLHSLIIFSQGTDGMKYFPSNLLEGLANLKKLWAGNININSLHPETFTYTPNLWLVDFSKNNLISISADIFQPLKKLSALTMIQTGIQSLDFVIQANINEVQVLLVRKNSIAVINENLINAFSKLSHLDLQGNEFSCDCDNAWFIDWAVHNNDTQVLSLDKFTCNYPSNLRGSRL 740          
BLAST of Epiphycan vs. Ensembl Cavefish
Match: ENSAMXT00000025596.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:16543202:16552825:-1 gene:ENSAMXG00000024870.2 transcript:ENSAMXT00000025596.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 4.538e-21
Identity = 162/581 (27.88%), Postives = 251/581 (43.20%), Query Frame = 2
Query:  104 LKNFMKTR---FTFCLLLVIYNLVCLYVFPCPIPCKCTHHS--VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKE--INENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFD-SKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH---LQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPI----DFAKLKNISLENNQ 1789
            ++ +MK R    T   LL +   +      C   CKC  ++  + C ++ L + P+ +      L ++ NLI++L     + L+    L L++N + E          +S+L  L L  N +S L    F + L  L  + L  N  + +P   +   T++  L L  N+I S     +F   + L+ + L KN IK I +  F N        L+   N+L ++    F+ + + L +L+L  N+L  ST+    L      T    L L   G+T +  +    F+  S L  L+L+ N  LK I   A RGL  L  L+L+  K+   P   F  + KL HL + D  L + P  L  +L  L    L  N I  I  D F  L+ LK LH+  N I  + +++F  L  L  +DL  N+LT I SG+F    KL  L+L +    +LT  P                           F  +P+L  L L+ N I+ + EN FSG   ++ +DLS N           PL     D    +  L+ + + FN    LP     D  KLKN++L NN+
Sbjct:   18 VQKYMKLRSKCGTMLGLLSVVMTLTAAAGACIKSCKCVDNATIITCSNKNLLEFPQ-LPPGTKNLYVTHNLIRALPREGLEELL---VLDLTNNRLSEWLTGTTTLPNMSSLTELFLRGNGISSLKTGKFQE-LTNLTLLDLSENNIKILPQKFLQGLTNLKILVLSLNEILSLSYG-AFEGGSDLEEIHLNKNHIKIIEKGVFENCTYLNKLVLSN--NNLSSVEEGTFLGL-HGLRHLDLSKNRL--STVPTGTLKDTPNLTS---LYLHQNGITRVPEN---AFYSLSSLQMLNLNNNP-LKVIHAAALRGLRKLHDLDLSSSKLQVLPPSVFQDVGKLKHLCLFDIALTSLPQGLFNNLTLLQELQLDKNKIHIIPPDLFHPLSKLKHLHMDSNLISELNSSTFRTLRRLVHIDLSNNQLTNISSGLFKGTRKLAHLDLSKN---MLTAVPTE------------------------AFKEIPRLNRLFLQKNAISSVPENAFSGLAGLKKLDLSNN-----------PLEILDEDSLRGLFMLAELDLSFNQLQDLPSCVFQDLGKLKNLNLYNNE 542          

HSP 2 Score: 99.7525 bits (247), Expect = 8.184e-21
Identity = 153/539 (28.39%), Postives = 236/539 (43.78%), Query Frame = 2
Query:  218 VDCRHQALKDVPKGISID---VTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMT---KLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIF----------------HRMPKLISLNLEQQNPVLL------------------------------TIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLIS 1666
            +D     L  VP G   D   +T L L  N I  +  N+F +L +L+ L L++N +K I+  A  GL  L +L L ++ L VL P  F + + KL H+ L +     +P     ++T   +L LD NKI     D    L + L+ L +  N I E+N + F  L+      L+   N L NI++  F   +  L +L+L  N L  + +  +A   F        L L+   ++S+  +       + L  LDLS N  L+ +D D+ RGL  L  L+L+  ++ D P   F  + KL +L + +N L   P RL      LK L L SNNI  I  + F  LT L++L L  N+IL +  + F +L  L SL L  N L+RI   +F                H +PKL   +L+    + L                              ++    F L NL +++L  N +  +  +   F +L  L  + L  N++  L  ++FS   N+Q + L  N L   P   F  L S
Sbjct:  248 LDLSKNRLSTVPTGTLKDTPNLTSLYLHQNGITRVPENAFYSLSSLQMLNLNNNPLKVIHAAALRGLRKLHDLDLSSSKLQVLPPSVF-QDVGKLKHLCLFDIALTSLPQGLFNNLTLLQELQLDKNKIHIIPPDLFHPL-SKLKHLHMDSNLISELNSSTFRTLRRLVHIDLSN--NQLTNISSGLFKGTR-KLAHLDLSKNML--TAVPTEA---FKEIPRLNRLFLQKNAISSVPENAFSGL--AGLKKLDLSNNP-LEILDEDSLRGLFMLAELDLSFNQLQDLPSCVFQDLGKLKNLNLYNNELDTIPERLFNNLTQLKVLQLDSNNISVIFPETFNPLTELRDLQLDNNNILQLNASLFKNLKHLHSLYLNNNALSRIPKYLFQTTRHLKELQLTNNHIHNIPKLSFKSLKMLRALRLNDNHLSDLHKELLAGLDDLRELSLNRNRIESLPVEFFTLPNLRTLDLSNNNL--NTLSSEDFKHLTTLREIHLSFNKLKALPHSIFSSQGNLQKLFLQNNYLSHLPLNVFYKLNS 771          

HSP 3 Score: 87.8113 bits (216), Expect = 4.701e-17
Identity = 112/358 (31.28%), Postives = 171/358 (47.77%), Query Frame = 2
Query:  281 LDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPV-----LKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP----HRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFN 1324
            LDLSFN ++ L +  FQ L  LK L L +NE+  I E  F  L+ L+ L L++N++SV+ PETFN  L +L  + L NN   ++       LK  H   LN   N   S +    F     L+ L LT N I  I +  F                SL+ + A            L L  N L  S + ++ L G +     + L L    + S+  +F   F    L  LDLS N+ L ++ ++ F+ L  L+ ++L+  K+   P   FS+   L  LF+ +N L + P    ++L  SLK L L++N++  +    F SL NL++LHLK N + S+   +F+ L SL ++ L  N
Sbjct:  512 LDLSFNQLQDLPSCVFQDLGKLKNLNLYNNELDTIPERLFNNLTQLKVLQLDSNNISVIFPETFNP-LTELRDLQLDNNNILQLNASLFKNLKHLHSLYLN---NNALSRIPKYLFQTTRHLKELQLTNNHIHNIPKLSF---------------KSLKMLRA------------LRLNDNHL--SDLHKELLAGLD---DLRELSLNRNRIESLPVEF---FTLPNLRTLDLSNNN-LNTLSSEDFKHLTTLREIHLSFNKLKALPHSIFSSQGNLQKLFLQNNYLSHLPLNVFYKL-NSLKQLDLENNHLHHLANKQFHSLKNLEQLHLKSNRLRSLSNGTFEALTSLRAIYLSEN 828          

HSP 4 Score: 86.2705 bits (212), Expect = 1.342e-16
Identity = 121/456 (26.54%), Postives = 207/456 (45.39%), Query Frame = 2
Query:  218 VDCRHQALKDVPKGI---SIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKL---NLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLS-ENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRF-SAMAKLTHLFMNDNNLINCP---HRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDN 1549
            +D  +  L ++  G+   +  +  LDLS N++ ++   +F+ +  L RL L  N +  + ENAF GL+ L+ L L NN L +L  ++  +GL  L  + L  N+ + +P      + KL   NL +N++   + ++ F   T L+ L L  N I  I                            E F P+       EL   +L N+ I++   + F        L L +  L+ I     K  F +  H  +L   N+ + +I   +F+ L  L+ L L    +SD      + +  L  L +N N + + P     LP +L+ L L +NN+  +  +DFK LT L+E+HL  N + ++  + F    +L  L L  N L+ +   +F+++  L  L+LE  N  L  +A   F  L NLE + L+ NR++  + +   F+ L  L  + L +N
Sbjct:  416 IDLSNNQLTNISSGLFKGTRKLAHLDLSKNMLTAVPTEAFKEIPRLNRLFLQKNAISSVPENAFSGLAGLKKLDLSNNPLEILDEDSL-RGLFMLAELDLSFNQLQDLPSCVFQDLGKLKNLNLYNNEL-DTIPERLFNNLTQLKVLQLDSNNISVI--------------------------FPETFNPLT------ELRDLQLDNNNILQLNASLFKNLKHLHSLYLNNNALSRIP----KYLFQTTRHLKELQLTNNHIHNIPKLSFKSLKMLRALRLNDNHLSDLHKELLAGLDDLRELSLNRNRIESLPVEFFTLP-NLRTLDLSNNNLNTLSSEDFKHLTTLREIHLSFNKLKALPHSIFSSQGNLQKLFLQNNYLSHLPLNVFYKLNSLKQLDLE--NNHLHHLANKQFHSLKNLEQLHLKSNRLR--SLSNGTFEALTSLRAIYLSEN 828          
BLAST of Epiphycan vs. Ensembl Cavefish
Match: tlr3 (toll-like receptor 3 [Source:ZFIN;Acc:ZDB-GENE-040219-7])

HSP 1 Score: 98.2117 bits (243), Expect = 2.657e-20
Identity = 167/699 (23.89%), Postives = 291/699 (41.63%), Query Frame = 2
Query:  161 LVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-PETFNKGLIKLLHVYLGNNEF----EKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSL--ENIAAEAFVPVKNSLINLELEG---NKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSM-----------------------LKSIDNDAFRGLDNLQILNL----AKCKISDP---DIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH-----LQSNNIRQIRQDDFKSL--TNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESG----------------------IFHR----MPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSG--------SVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKL----STISIDFNSTNYL---------------PIDFAKLKNISLENNQWNCSCHQIQWLLHF-----RKLILNRDQILCNIPNEKAGKNLFLVMVN-CSDVIL 1936
            ++C   FP    C       DC H  L +VP G+  D++ LD+S N +K L   +     +L+ L +S+N +  +       L  L++L ++ N   VLH   T  +   +L H+ L +N      E   VLK+  +T L++  NK+ +A +     L + L TLIL+ N+   + +TD  +  ++  +   L ++SL  + +    F PV ++L +L L+G   N LL     E +       T  + L L+S   T +     K    + L  LDLS N +                       +K +  D F GL ++  LNL     K K + P   D  F  + KL HLFM D +  +    + A L  L           ++ I    F SL  + L+ L+L + ++  ++  +F  L +LT+L L +N +++  +G                      + HR    +P L  L L +     L + P+ F  L+NL  ++L  N I  +  +G + + L  L  L ++ N + +L ++   G        + N+ +++L  N L   P K    L     ++ L+ N L     +I  D  +  YL                +  + L  + +E+N ++C+C  IQW   +       +       +CN P     +++     N C D++L
Sbjct:   14 VLCCDSFPHKTTCTIKEGKADCSHMNLNNVPPGLPPDISTLDMSHNRLKVLDPGALSRYPSLEHLDVSYNSIMGLGPGLCDALPRLQHLSVQRNQ--VLHLTATELRNCSRLTHLDLSDNRLKLIGEPFSVLKS--LTWLDVSRNKLITAGLGTKPQLPS-LVTLILSGNDFTTL-KTDDFSFLSSSPSFRVLGLSSLPLKKVEHGCFKPV-SALTDLVLDGCNLNTLLTKVCDELS------DTSVRNLTLRSTLQTVLKNITFKGLLKTNLTMLDLSSNKISKIDDGTFQWLPLLESLSLENNNIKHLTKDTFMGLKSVTQLNLQKALVKTKAAYPIIDDFSFQPLVKLEHLFMRDTSFRDITENMFAGLPSLRTLDLSWSKAGLKTISNTTFASLQGSPLQVLNLTRMALTKLDPGAFSCLGNLTTLVLKYNFISQDLTGEEFRGLNSIREIYLSLNQQKISLTHRSFIHVPTLRVLMLGRALTGTLDMEPSPFRPLTNLTVLDLSNNNIA-NFNSG-LLEGLYHLKVLKMQHNNLARLWKDANPGGPVLFLKDTQNLSVLELDYNGLDEIPLKALRGLFHLN-ELSLSGNLLNYMHGSIFNDLQALRYLRMEKNLLTSVLMGTFSVPLSNLSELHMEHNPFDCTCESIQWFSDWLNSTNTSVPERTSSYICNTPAAYFNRSVLDFQTNSCKDLLL 696          
BLAST of Epiphycan vs. Ensembl Cavefish
Match: tlr3 (toll-like receptor 3 [Source:ZFIN;Acc:ZDB-GENE-040219-7])

HSP 1 Score: 95.9005 bits (237), Expect = 1.113e-19
Identity = 166/693 (23.95%), Postives = 288/693 (41.56%), Query Frame = 2
Query:  179 FPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-PETFNKGLIKLLHVYLGNNEF----EKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSL--ENIAAEAFVPVKNSLINLELEG---NKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSM-----------------------LKSIDNDAFRGLDNLQILNLAKC----KISDP---DIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLH-----LQSNNIRQIRQDDFKSL--TNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESG----------------------IFHR----MPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSG--------SVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKL----STISIDFNSTNYL---------------PIDFAKLKNISLENNQWNCSCHQIQWLLHF-----RKLILNRDQILCNIPNEKAGKNLFLVMVN-CSDVIL 1936
            FP    C       DC H  L +VP G+  D++ LD+S N +K L   +     +L+ L +S+N +  +       L  L++L ++ N   VLH   T  +   +L H+ L +N      E   VLK+  +T L++  NK+ +A +     L + L TLIL+ N+   + +TD  +  ++  +   L ++SL  + +    F PV ++L +L L+G   N LL     E +       T  + L L+S   T +     K    + L  LDLS N +                       +K +  D F GL ++  LNL K     K + P   D  F  + KL HLFM D +  +    + A L  L           ++ I    F SL  + L+ L+L + ++  ++  +F  L +LT+L L +N +++  +G                      + HR    +P L  L L +     L + P+ F  L+NL  ++L  N I  +  +G + + L  L  L ++ N + +L ++   G        + N+ +++L  N L   P K    L     ++ L+ N L     +I  D  +  YL                +  + L  + +E+N ++C+C  IQW   +       +       +CN P     +++     N C D++L
Sbjct:   25 FPHKTTCTIKEGKADCSHMNLNNVPPGLPPDISTLDMSHNRLKVLDPGALSRYPSLEHLDVSYNSIMGLGPGLCDALPRLQHLSVQRNQ--VLHLTATELRNCSRLTHLDLSDNRLKLIGEPFSVLKS--LTWLDVSRNKLITAGLGTKPQLPS-LVTLILSGNDFTTL-KTDDFSFLSSSPSFRVLGLSSLPLKKVEHGCFKPV-SALTDLVLDGCNLNTLLTKVCDELS------DTSVRNLTLRSTLQTVLKNITFKGLLKTNLTMLDLSSNKISKIDDGTFQWLPLLESLSLENNNIKHLTKDTFMGLKSVTQLNLQKALVKTKAAYPIIDDFSFQPLVKLEHLFMRDTSFRDITENMFAGLPSLRTLDLSWSKAGLKTISNTTFASLQGSPLQVLNLTRMALTKLDPGAFSCLGNLTTLVLKYNFISQDLTGEEFRGLNSIREIYLSLNQQKISLTHRSFIHVPTLRVLMLGRALTGTLDMEPSPFRPLTNLTVLDLSNNNIA-NFNSG-LLEGLYHLKVLKMQHNNLARLWKDANPGGPVLFLKDTQNLSVLELDYNGLDEIPLKALRGLFHLN-ELSLSGNLLNYMHGSIFNDLQALRYLRMEKNLLTSVLMGTFSVPLSNLSELHMEHNPFDCTCESIQWFSDWLNSTNTSVPERTSSYICNTPAAYFNRSVLDFQTNSCKDLLL 701          
BLAST of Epiphycan vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005066.1 (pep scaffold:Pmarinus_7.0:GL476584:229611:317338:-1 gene:ENSPMAG00000004069.1 transcript:ENSPMAT00000005066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 1.927e-20
Identity = 70/231 (30.30%), Postives = 104/231 (45.02%), Query Frame = 2
Query: 1133 PHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPID-FAKLKNISLENNQWNCSCHQIQWL 1822
            P  +P + ++L+L  N I ++    F SL  L E  L+   + S+ T  FD L  LT L+L  N+L  +  G+F R                         L NL+ + L GN++   A    + D+L +L  L+LR+NQ+T L E +F   VN+Q + L +N L   PA  F        D   N+ +L   S    S      D    L +I L NN W+C+C  I +L
Sbjct:   24 PAGIPTTTQYLYLLVNQITKLEPGVFHSLAALVETRLRSEELASLPTGVFDKLTQLTRLELQTNQLKGVPRGLFDR-------------------------LVNLQQLYLGGNQL--SALPDGVLDSLTQLTYLTLRNNQLTALPEGVFDRLVNLQQLYLHLNRLSSIPAGMF--------DKLTNLKELKLYSNQLKSIPRGAFDNLKSLTHIWLLNNPWDCACTDIMYL 219          

HSP 2 Score: 68.9366 bits (167), Expect = 3.568e-13
Identity = 53/169 (31.36%), Postives = 77/169 (45.56%), Query Frame = 2
Query:  188 PIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP--VLKA-THMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF 685
            P  C C+  SVDCR +    VP GI      L L  N I  L    F +L  L   +L   E+  +    F  L+ L  L L+ N L  +    F++ L+ L  +YLG N+   +P  VL + T +T L L +N++ +A+ +  F     LQ L L  N +  I    F
Sbjct:    3 PSQCSCSGTSVDCRSRRHASVPAGIPTTTQYLYLLVNQITKLEPGVFHSLAALVETRLRSEELASLPTGVFDKLTQLTRLELQTNQLKGVPRGLFDR-LVNLQQLYLGGNQLSALPDGVLDSLTQLTYLTLRNNQL-TALPEGVFDRLVNLQQLYLHLNRLSSIPAGMF 169          

HSP 3 Score: 58.151 bits (139), Expect = 1.746e-9
Identity = 50/134 (37.31%), Postives = 70/134 (52.24%), Query Frame = 2
Query:  935 FD--SKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPH----RLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDL 1315
            FD  ++L  L+L  N  LK +    F  L NLQ L L   ++S  PD    ++ +LT+L + +N L   P     RL  +L+ L+L  N +  I    F  LTNLKEL L  N + SI   +FD+L SLT + L
Sbjct:   73 FDKLTQLTRLELQTNQ-LKGVPRGLFDRLVNLQQLYLGGNQLSALPDGVLDSLTQLTYLTLRNNQLTALPEGVFDRL-VNLQQLYLHLNRLSSIPAGMFDKLTNLKELKLYSNQLKSIPRGAFDNLKSLTHIWL 204          

HSP 4 Score: 48.9062 bits (115), Expect = 1.848e-6
Identity = 35/112 (31.25%), Postives = 53/112 (47.32%), Query Frame = 2
Query: 1061 PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNL 1387
            P   F  + +LT L +  N L   P  L     +L+ L+L  N +  +      SLT L  L L+ N + ++    FD L +L  L L  NRL+ I +G+F ++  L  L L
Sbjct:   69 PTGVFDKLTQLTRLELQTNQLKGVPRGLFDRLVNLQQLYLGGNQLSALPDGVLDSLTQLTYLTLRNNQLTALPEGVFDRLVNLQQLYLHLNRLSSIPAGMFDKLTNLKELKL 180          
BLAST of Epiphycan vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010345.1 (pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1 gene:ENSPMAG00000009370.1 transcript:ENSPMAT00000010345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 9.530e-17
Identity = 81/289 (28.03%), Postives = 136/289 (47.06%), Query Frame = 2
Query:  968 ENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV-LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCH---QIQWL 1822
             N+ + +I  +AF+ L++L+ ++L    IS  D R  A AK                    SL+ ++L  NNIR ++   F+ + +LK L L KNSILS  +++F  L+ L+ LD+  N +T + +  F   P L+ L+L      +  I+P +FV L NL+ + L  N+I     A     +L  L  L L +N I ++  + F G  N++ +  S N+++    K           + ++ NK+  I     ST       + L+ I L  N ++C C     +QWL
Sbjct:   67 ANNEITNIGANAFQNLNHLKNIHLESNHISGFDSRAFAGAK--------------------SLQMINLYGNNIRSLQSKAFQGVPSLKYLILGKNSILSFTSSTFQGLSELSDLDMPMNNITSLPALAFQHTPSLVILDLAYNK--IQQISPKAFVGLKNLDYLNLDNNKIT--TIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLTNLRELYFS-NNMVSVLTKDAFNSNIKLTQLTISDNKIKVIEAGTFST------LSGLQMIYLHGNPYHCDCKLNPLVQWL 324          

HSP 2 Score: 77.7962 bits (190), Expect = 1.862e-15
Identity = 95/337 (28.19%), Postives = 155/337 (45.99%), Query Frame = 2
Query:  131 TFCLLLVIYNLVCLYVFPCPIPCKCTHHS------VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNN---EFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDS--KLHHLDLSENSMLKSIDNDAFRGLDNLQILNL------AKCKISDPDIRFSAMAK 1090
            + C ++++   V   V  CP  CKC   S      VDC  Q +K VP  I  D + + L+ N I ++  N+FQ L +LK + L  N +   +  AF G  +L+ ++L  N++  L  + F +G+  L ++ LG N    F        + ++ L++  N I S +   +F     L  L L  N+I++I+   FV LKN     L    N +  IA         SL NLE+    L N+ I     + F G T  + L   +  ++ ++ D     F+S  KL  L +S+N  +K I+   F  L  LQ++ L        CK+ +P +++ A  K
Sbjct:    8 SVCWVVLVLVGVSRQVLGCPSGCKCAKQSQQDGLDVDCGDQRMKSVPSKIPSDASTIKLANNEITNIGANAFQNLNHLKNIHLESNHISGFDSRAFAGAKSLQMINLYGNNIRSLQSKAF-QGVPSLKYLILGKNSILSFTSSTFQGLSELSDLDMPMNNITS-LPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDN--NKITTIAPGTL----QSLQNLEML--VLNNNNIKRVTSSTFKGLTNLRELYFSNNMVSVLTKD----AFNSNIKLTQLTISDNK-IKVIEAGTFSTLSGLQMIYLHGNPYHCDCKL-NPLVQWLATTK 328          
BLAST of Epiphycan vs. Ensembl Sea Lamprey
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 82.8037 bits (203), Expect = 2.118e-16
Identity = 95/409 (23.23%), Postives = 166/409 (40.59%), Query Frame = 2
Query:  134 FCLLLVIYNLVCLYVFPCPIPCKCTH--HSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIF 1354
              L+ V+  ++      CP  C C+    SV C  + L  +P+GI  +  +LDLS N +++LS   F +   L+ L+L+ N +  +   AF GL +LR L +  N + ++ P  F           LGN             +T+L++  NKI   ++D +F     L  L +  NE+  + +  F                    +AA         L  L LE   L  + +  +AL   +   G   L L+  G+ ++     +     +L  L++    +L+++   +F  L NL  L++    I+   +   A+  L H                  L+ L L  N I  +    F +LT L+EL +++  +L +E  +   +  L  L+L  N L  +E G  
Sbjct:   28 LALITVVLPVLESSAMGCPARCDCSAPLRSVVCHRRKLVSIPEGIPTETRLLDLSKNRLRALSAGDFASHGQLEELQLNENVIAGVEPGAFGGLPHLRALGMRGNRIKLIPPGVF---------AGLGN-------------LTRLDVSENKI-VVLLDFAFRDLRRLLELRVGDNELVYVTRHAFA------------------GLAA---------LRELALERCNL--TAVPTEALAQLH---GLSSLRLRHLGIAAVKPHAFQRL--PRLRSLEIDHWPLLETLGAGSFSSL-NLTSLSVTNTNIT--RVPRLALQTLVH------------------LRTLDLSFNAIASVEAGAFATLTRLRELRMERTGLLVVEPRALQGVEQLGLLNLSGNGLRTLEEGAL 358          

HSP 2 Score: 59.3066 bits (142), Expect = 4.133e-9
Identity = 35/124 (28.23%), Postives = 57/124 (45.97%), Query Frame = 2
Query: 1040 AKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLL 1411
            A+C  S P         L  +  +   L++ P  +P   + L L  N +R +   DF S   L+EL L +N I  +E  +F  L  L +L +  NR+  I  G+F  +  L  L++ +   V+L
Sbjct:   47 ARCDCSAP---------LRSVVCHRRKLVSIPEGIPTETRLLDLSKNRLRALSAGDFASHGQLEELQLNENVIAGVEPGAFGGLPHLRALGMRGNRIKLIPPGVFAGLGNLTRLDVSENKIVVL 161          
BLAST of Epiphycan vs. Ensembl Sea Lamprey
Match: tlr21 (toll-like receptor 21 [Source:ZFIN;Acc:ZDB-GENE-040220-4])

HSP 1 Score: 82.4185 bits (202), Expect = 3.740e-16
Identity = 141/527 (26.76%), Postives = 240/527 (45.54%), Query Frame = 2
Query:  203 CTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI------------------------PVLKATH----MTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEIN-QTDFVXXXXXXXXXXXXXMN--SLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALT----------------GFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDN-LQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFN--RLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKL-NENLFSGSVNIQLIDLSMNSLI 1630
            C H ++    +A+ D+ +G  +   IL+LS N +  + NNSF  L +L  L++  N +  I   AF GLS L++L+L  N++S L P  FN GL+ L  + + NN  E                           V++A +    +  LNL+SN++   +V K   L   ++ + L+ N I+ ++ + DF+N   +     +   N   L  +   + + ++ S+ NL +   + LN+ I  + LT                  N       L L +  ++++S  F       ++  LDLS N  +KS++   F   +N L+ L L K +I   ++  S + K       DN++      LP  L+ + ++ NNI Q+    F  + NL++L L  N IL +    F  L +L+ L L  N  R   ++S  F  +  L SL L      +L  +  S  L+NLE ++L GN + +    G  F  L  L NL L  N I  L N  +F+G  +++++DL  N ++
Sbjct:   40 CVHRNIHELEEAISDL-RGAPV---ILNLSNNALTVIRNNSFIRLGSLIHLRMDINHIYVIEAGAFNGLSQLQHLNLSFNNISRLIPGAFN-GLVDLKQLIIDNNRLEPTLEMFKPLKNVIQLSLTNNGLSNFSQVVEAIYELPLLQSLNLESNRLTKIIVGKDLRLQETVELMFLSNNSIESLSLERDFLNHITSLDLFNSSLTNVSELAGLNMSSLLQLRLSMRNLNVSKLQTLNN-IFPKTLTFAYFPLGSLPNLHLVCRLNVTRQVMSLTLTNSYISNVSESFCNC---REIQSLDLSFNR-IKSVEKYNFLSPNNTLRNLTLNKNQI---EVLESCVKK-------DNSISVICTPLPY-LENVFIKYNNIFQLESYAFVHMKNLRKLDLTGNDILRLSKRPFHGLHNLSHLVLANNVIRSLNVQSP-FSPLENLKSLMLRNNRLKILNRSVFS-NLTNLEILDLGGNALSY--LHGETFSELSNLKNLYLDRNAIRSLDNRAVFAGLHSLRVLDLVKNMIV 541          

HSP 2 Score: 67.0106 bits (162), Expect = 2.055e-11
Identity = 84/304 (27.63%), Postives = 137/304 (45.07%), Query Frame = 2
Query:  947 LHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIR--FSAMAKLTHLFMNDNNLINCPHRLPASL---KFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNS-FDDLASLTSLDLGFNRLTR----IESGIFHRMPKLISLNLEQQNPVLLTIAPNSFV--LSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRD--NQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNY----LPIDFAKLKNISLENNQWNCSC 1804
            L  LDL+ N +L+ +    F GL NL  L LA   I   +++  FS +  L  L + +N L      + ++L   + L L  N +  +  + F  L+NLK L+L +N+I S++  + F  L SL  LDL  N +      I +  F  +  LI+L L  Q P  +   P +    L  LE ++L GN++ F    G  FD +  L  L + D  + +  +N+ +F     +  +DL  + L     + F            N+  L T+ ++ N+  Y    L      LK + L NN  +C+C
Sbjct:  408 LRKLDLTGNDILR-LSKRPFHGLHNLSHLVLANNVIRSLNVQSPFSPLENLKSLMLRNNRLKILNRSVFSNLTNLEILDLGGNALSYLHGETFSELSNLKNLYLDRNAIRSLDNRAVFAGLHSLRVLDLVKNMIVYNSPTIRNPPFVELNNLINLKLSAQQPYGMKSIPKNLFKGLYALEKLQLGGNKLLFHG--GHPFDGMHNLKYLDIHDVCSGLQIMNKTMFYKLKKLSSLDLGNDGLGSINNQQFQ-----------NLTHLETLYLNDNAIRYVTEELITPMTNLKYLDLRNNPIDCTC 697          
BLAST of Epiphycan vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001020.1 (pep scaffold:Pmarinus_7.0:GL477382:11904:26610:1 gene:ENSPMAG00000000923.1 transcript:ENSPMAT00000001020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 8.280e-16
Identity = 44/130 (33.85%), Postives = 71/130 (54.62%), Query Frame = 2
Query:  212 HSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVL---KATHMTKLNLDSNKIRS 592
            + VDC+ + L+ VP GI +D  +L L FN  KSL   +F+ L ++  L L    ++ ++E  F    NL++L L  N L+ L    F++ L +L  +YLG N+   +P     + T + KL L +N+I S
Sbjct:    1 NEVDCQSKGLQAVPPGIPVDTAMLRLDFNKFKSLDATAFEDLGSVTYLGLESAGIESLSEGVFDHFPNLQSLWLNRNVLATLPLGVFDR-LTQLDKLYLGTNQITSLPTTVFDRLTQLDKLYLGTNQITS 129          
BLAST of Epiphycan vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 85.1149 bits (209), Expect = 1.239e-16
Identity = 143/541 (26.43%), Postives = 224/541 (41.40%), Query Frame = 2
Query:  131 TFCLLLVIYNLVCLYVFPCPI---------PCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRL----KLSHNEMKEINENAFVG--------------------LSNLRNLHLENNDLSVLHP-ETFNKGLIKLLHVYLGNNEFEKIPVLKATH---MTKLNLDSNKIRSAVVDKSFLLNTGLQTLI----LTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLI 1630
            TF  L++   ++C++V              PC C  + V+C  + L  +P GI  D+T L+L +N I  L          LK L      S N +   + N   G                    ++++ + HL +N++  + P ++F   L+ L    L +N+   IP L  T    +  L L+SNKI S++   +F   + LQ L     L    + E  + D +              N L ++ ++A   ++ SL  L+L  N    ++I+  A   FN  +  + L L    +++I G F   +  +KL  L L  N+   +I   +F GL +LQ L L   +IS           +T  F +  +           L+ L+L+ N +  I+   FK L  LK L+L  N I  I   SF DL SL  LDL  N                IS  +E+ N            L+NL S+ L GNRI   A A   F  L  +  L+L  N IT + EN F G   +Q + L+ + L+
Sbjct:    7 TFSWLVLYIWILCVFVSSQQTEGTACLEIKPCYCLGNRVNCEGKHLTAIPVGIPSDITALNLGYNNIVDLDPKQLLKFTALKELFNPIPGSFNPIPG-SFNPIPGGFNPIPGGFNPILVASIPFLVASILSCHLHHNNIRGIPPWDSFPSTLMTLT---LHHNKIVAIPSLNTTKQHALRNLYLNSNKI-SSIGHHAFTNLSNLQNLYSIAYLRYTSLTEYKKEDCIKKLGK---------NRLTSVPSDALSQLQ-SLKRLDLSRN--FFTSILASA---FNRLSSLEVLKLSKNRISTIRGAF---WGQNKLQQLYLDRNN-FTAIQTSSFFGLRDLQNLYLQSNQIS---------TIITTKFADWRSF--------PVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNND---------------ISWTVEEMNGPFRG-------LTNLASLRLDGNRIT--AIAATAFLGLENIKYLNLSANIITSIQENSFQGMDKLQKLWLNTSQLM 482          
BLAST of Epiphycan vs. Ensembl Nematostella
Match: EDO43258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZD5])

HSP 1 Score: 61.2326 bits (147), Expect = 2.020e-9
Identity = 97/358 (27.09%), Postives = 152/358 (42.46%), Query Frame = 2
Query:  320 NSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRS----AVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKL 1372
            +  + L  L+ L L+ N + ++  NAF  L  L  L L+ NDL+V+ P+   K L +L H+ L  N   K+P     K   + +LNL  NK++S    A+ D   L+   LQ L L  N I+ I   D       +LT + L    LE +   AF   +  L+     GN  L      +      G    Q L L+S  +  +  +F   F   KL+  + + N + +  D     G  ++++L L   +IS        MA+L                     K L L+ N I ++  + FK + +L+ L L KN I  I  N+F     L +LDL  N   R+ S    ++ +L
Sbjct:   53 DGLKALSRLQHLNLNFNRISKVPRNAFNKLRLLVELFLDYNDLTVV-PDGL-KALSRLQHLNLNFNRISKVPRNAFNKLRLLVELNLRGNKLKSIPTSAIND---LMR--LQQLELDGNPIRVIK--DHAFKGLFRLTEIALGWEKLEEVYHNAFT--ELPLLRRLPLGNVKL------KHFPNLTGTHSLQILTLESNYIEYLPRNFCGMF--PKLYDFNANMNKIKRIPD---MSGCKSMELLKLVHNQISSIGSSLQGMARL---------------------KDLTLEGNRITEVNDNTFKGVKSLETLDLAKNQIKHISKNAFSHFERLQTLDLSENLFVRLPSAGMQQIRRL 367          

HSP 2 Score: 54.299 bits (129), Expect = 2.904e-7
Identity = 70/277 (25.27%), Postives = 115/277 (41.52%), Query Frame = 2
Query:  998 DAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPA--SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDL--------------GFNRLTRIESG------IFH-RMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKF-------------------------------------------DATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSL 1627
            D  + L  LQ LNL   +IS  P   F+ +  L  LF++ N+L   P  L A   L+ L+L  N I ++ ++ F  L  L EL+L+ N + SI T++ +DL  L  L+L              G  RLT I  G      ++H    +L  L       V L   PN     +L+ + L+ N I++                                            ++ G     + +L +L+L  N+IT++N+N F G  +++ +DL+ N +
Sbjct:   53 DGLKALSRLQHLNLNFNRISKVPRNAFNKLRLLVELFLDYNDLTVVPDGLKALSRLQHLNLNFNRISKVPRNAFNKLRLLVELNLRGNKLKSIPTSAINDLMRLQQLELDGNPIRVIKDHAFKGLFRLTEIALGWEKLEEVYHNAFTELPLLRRLPLGNVKLKHFPNLTGTHSLQILTLESNYIEYLPRNFCGMFPKLYDFNANMNKIKRIPDMSGCKSMELLKLVHNQISSIGSSLQGMARLKDLTLEGNRITEVNDNTFKGVKSLETLDLAKNQI 329          

HSP 3 Score: 53.5286 bits (127), Expect = 5.217e-7
Identity = 103/378 (27.25%), Postives = 157/378 (41.53%), Query Frame = 2
Query:  365 HNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLP-----ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNR 1474
            H + + I  N F          L+ NDL+V+ P+   K L +L H+ L  N   K+P     K   + +L LD N +   VV       + LQ L L  N I ++ +  F   K   L  L L+ N L++I   A   +   L  LEL+GN +    I + A  G      F+  ++ + G   +   +   F +  L       N  LK   N    G  +LQIL L    I      F  M    + F  + N I    R+P      S++ L L  N I  I     + +  LK+L L+ N I  +  N+F  + SL +LDL  N++  I    F    +L +L+L +   V L  A     +  +  + L+GNR
Sbjct:   21 HRDQQSIFRNTFFPYCCTLFRFLDYNDLTVV-PDGL-KALSRLQHLNLNFNRISKVPRNAFNKLRLLVELFLDYNDL--TVVPDGLKALSRLQHLNLNFNRISKVPRNAF--NKLRLLVELNLRGNKLKSIPTSAINDLMR-LQQLELDGNPI--RVIKDHAFKGL-----FRLTEI-ALGWEKLEEVYHNAFTELPLLRRLPLGNVKLKHFPN--LTGTHSLQILTLESNYIEYLPRNFCGMFPKLYDFNANMNKIK---RIPDMSGCKSMELLKLVHNQISSI-GSSLQGMARLKDLTLEGNRITEVNDNTFKGVKSLETLDLAKNQIKHISKNAFSHFERLQTLDLSENLFVRLPSAG----MQQIRRLYLRGNR 373          
BLAST of Epiphycan vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 58.5362 bits (140), Expect = 4.268e-9
Identity = 69/258 (26.74%), Postives = 116/258 (44.96%), Query Frame = 2
Query: 1154 LKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIK--FDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNIS---LENNQWNCSCHQ---IQWLLHFRKLILNRDQILCNIPNEKAGKNL 1900
            LK+L L +N+I  I+   F++L  LK+L+L +N I ++  + F  L SL  LDL FN L  +  G+F  +  L  L L     +   I   +F  L NL  + +    +K     T G +  +L  L  L + +N +T +  +       ++ +DLS N LI + + T     S    + L+ N +  I  D          F++LK +    L  N + C C       WL + + L+     + C  P++  G++L
Sbjct:   20 LKWLDLSNNDISDIQDGTFENLRYLKQLNLGENKIRTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLM-SLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSAN-LISYVSSTAFANNSKLQKLLLHNNTIRLIHED---------AFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNNQYLVNFNGHMYCMTPDKLTGRDL 266          

HSP 2 Score: 54.6842 bits (130), Expect = 7.754e-8
Identity = 50/151 (33.11%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  254 KGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKL--SHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGL-IKLLHV-YLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDF 685
            KG+ + +  LDL FN +K+L    F+ L +L+ L L  + N    I E AF GL NLR LH+    +  +   TF   + ++ L V ++ NN    +P   + K   + +L+L +N I S V   +F  N+ LQ L+L  N I+ I++  F
Sbjct:   63 KGL-VSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSANLI-SYVSSTAFANNSKLQKLLLHNNTIRLIHEDAF 211          
BLAST of Epiphycan vs. Ensembl Nematostella
Match: EDO44877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUM0])

HSP 1 Score: 55.4546 bits (132), Expect = 5.167e-9
Identity = 33/104 (31.73%), Postives = 53/104 (50.96%), Query Frame = 2
Query:  185 CPIPCKCTHHS----VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGL 484
            CP  C+C   S    ++C       +P  I ++ T L  S   I +L  N+FQ L NL+ +++S+N+++ I +  F GL+ L  L L  N +  +    F KGL
Sbjct:   30 CPSVCQCGERSLVKYIECSRANFTVLPNDIPVETTELYFSRTQISNLVENAFQQLPNLEIIEISNNQIENITDGVFRGLTKLTELRLPENGIKRISVNAF-KGL 132          
BLAST of Epiphycan vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 59.3066 bits (142), Expect = 6.687e-9
Identity = 78/278 (28.06%), Postives = 131/278 (47.12%), Query Frame = 2
Query:  221 DCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKI---PVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGF-QFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLA 1042
            DC +  L+ +P  +  ++  L L+ N I++L   +F   ++L+ L LS+NE+  I    F  L  L+ L L +N L V++ ETF +GL  L ++ L +N    I       +  +  L++  N++     +    L++ L  L L  N ++ +        +   +T L L  N LE    +AF  +  SL  L L+GNKL      ++    F     F Q LD+    L  I+ D L       +  LDL+EN++ K I   A RG+  L+ ++L+
Sbjct:   57 DCSNATLQTIPTSLPRNLGSLFLNTNHIRALQAKAFANYLSLRVLDLSNNELSVIANGTFKSLGKLKTLTLNSNRLEVVYAETF-RGLRDLRYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLSEFKTETLRGLSSTLTELRLRSNILRRV-----AIKRRFNITLLDLGDNLLEVFEVDAFDGL--SLRKLRLDGNKL------DEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDLH--AIERLDLNENNISK-IRIGALRGMKKLRQISLS 317          

HSP 2 Score: 55.4546 bits (132), Expect = 9.633e-8
Identity = 66/229 (28.82%), Postives = 106/229 (46.29%), Query Frame = 2
Query: 1148 ASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIK-FDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAID-IRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLH 1828
              LK L L SN +  +  + F+ L +L+ L L+ NSI +I   +F   A L  LD+ FNRL+  ++     +   ++  L  ++ +L  +A       N+  ++L  N ++ F+  A   FD L  L  L L  N++ ++ E        +Q +D+S N L    +   L L   AI+ + LN N +S I I             KL+ ISL  N  +C C  + WL H
Sbjct:  120 GKLKTLTLNSNRLEVVYAETFRGLRDLRYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLSEFKTETLRGLSSTLT-ELRLRSNILRRVAIKRRF--NITLLDLGDNLLEVFEVDA---FDGL-SLRKLRLDGNKLDEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDL--HAIERLDLNENNISKIRIG------ALRGMKKLRQISLSGNPLSCDCRLV-WLKH 332          
BLAST of Epiphycan vs. Ensembl Medaka
Match: lgr6 (leucine rich repeat containing G protein-coupled receptor 6 [Source:NCBI gene;Acc:101156653])

HSP 1 Score: 102.064 bits (253), Expect = 1.797e-21
Identity = 121/441 (27.44%), Postives = 183/441 (41.50%), Query Frame = 2
Query:  185 CPIPCKCTHH----SVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-----------------------PETFNKGLIKLLHVYLGNNEFEKIPVL----------------KATH-----------MTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRLPAS-LKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRI 1339
            CP  C C       +VDC    L  VP  +S   T LDLS N I  +   +F  L  L  L++S N+++ I+  A  GL NLR L L+NN L  L                        P    +G+  L H++L +N   +IPV+                + TH           +  L+L +N I+S +  + F     L+TL L  N+++E           +KL  L    N+++ I   AFV            GN  L +    +    F G + FQFL                     KLH L L+  + ++   +   +G  +L+IL L +  +S  P      + +L  L ++ N + + P     S L+ + LQ N IR+I    F+ LT+LK L L  N + SI  ++F  L SL  LDL  NRL+ +
Sbjct:   37 CPFHCHCEEDGIFLTVDCSEIGLSSVPSNLSPFTTYLDLSMNNISEIQPRAFHHLHLLSELRISGNQLRYISGQALQGLHNLRVLMLQNNQLERLPDDAPWDLPNLLSLRLDANLLSDVPSEAFEGVRSLRHLWLDDNSLTEIPVMALDSLPSLQAMTLALNQITHIPDYAFANLSALVVLHLHNNHIQS-MGSRCFEGLQSLETLDLNYNDLQEF---PVAVRTLSKLQELGFHNNNIKAIPERAFV------------GNPQLQTIHFYENPIQFVGKSAFQFL--------------------PKLHTLSLNGATQIQEFPD--LKGTTSLEILTLTRAGLSALPLDLCEQLPRLRVLELSHNQIEDLPSFYHCSALQEIGLQHNKIRRIESSTFQQLTSLKALDLSWNVLESIHPDAFVSLHSLIKLDLSENRLSSV 439          
BLAST of Epiphycan vs. Ensembl Medaka
Match: lgr4 (leucine rich repeat containing G protein-coupled receptor 4 [Source:NCBI gene;Acc:101167435])

HSP 1 Score: 95.9005 bits (237), Expect = 1.555e-19
Identity = 119/428 (27.80%), Postives = 174/428 (40.65%), Query Frame = 2
Query:  185 CPIPCKCTH-HSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLH-----------------------PETFNKGLIKLLHVYLGNNEFEKIPVLKATH---MTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVK---------NSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQS-----NNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIES 1345
            C   C C      DC  + L  VP G+S     LDLS N I  L  N F++   ++ L+L+ N++  I+  A  GL  L+ L L+NN L  +                        P+   +GL +L H++L +N   ++PV   TH   +  L L  N+I + +   +F   T L  L L  N I+EI    F  L N +   L      +     EA   +K         +S+       N LL +  +      F G T FQ L                    S+LH L L   + ++  D     G  NL+ L L+  KIS   +      +L        N I    +LP+    +H+Q      N I+QI +D F+SL+ L  L L +N I  I  ++F  L SL +LDL  N L  I S
Sbjct:   28 CSPSCSCDEDGGADCSGRGLTAVPTGLSTFTYYLDLSMNNITELPANVFKSFPYMEELRLAGNDLTFIHPEALSGLHQLKVLMLQNNQLKSVPSAALKNLQSLQSLRLDANHITTVPDESFQGLQQLRHLWLDDNHLTQVPVGSLTHQANLQALTLALNRI-TYIPANAFANLTSLVVLHLHNNRIREIASNSFAGLVNLETLDLNFNNLMVFPKPIEALPKLKELGFHSNGISSIPEGAFHNNPLLRTIHLYDNPLSFVGTTAFQNL--------------------SELHSLILRGANKMR--DFPVLTGTKNLESLTLSGTKISSLPMDLCENLRLLRTLDLSYNEIE---QLPSFQGCIHIQEISFQHNKIQQIDRDTFQSLSALHLLDLSRNQIQVIHRDAFLTLTSLNNLDLSMNSLATIPS 429          

HSP 2 Score: 70.4774 bits (171), Expect = 8.261e-12
Identity = 92/339 (27.14%), Postives = 137/339 (40.41%), Query Frame = 2
Query:  920 FLKPFFDSKLHHLD--LSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCP-----HRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGF-----------------------NRLTRIESGIFHRMPKLISL----------------NLEQQNPVLLTIA------PNSFVLSNLESIELQGNRI-------------------------KFDATAGPI-------------------FDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAK 1645
            F+ P   S LH L   + +N+ LKS+ + A + L +LQ L L    I+  PD  F  + +L HL+++DN+L   P     H+  A+L+ L L  N I  I  + F +LT+L  LHL  N I  I +NSF  L +L +LDL F                       N ++ I  G FH  P L ++                NL + + ++L  A      P      NLES+ L G +I                         +  +  G I                   F +L  L  L L  NQI  ++ + F    ++  +DLSMNSL   P++
Sbjct:   94 FIHPEALSGLHQLKVLMLQNNQLKSVPSAALKNLQSLQSLRLDANHITTVPDESFQGLQQLRHLWLDDNHLTQVPVGSLTHQ--ANLQALTLALNRITYIPANAFANLTSLVVLHLHNNRIREIASNSFAGLVNLETLDLNFNNLMVFPKPIEALPKLKELGFHSNGISSIPEGAFHNNPLLRTIHLYDNPLSFVGTTAFQNLSELHSLILRGANKMRDFPVLTGTKNLESLTLSGTKISSLPMDLCENLRLLRTLDLSYNEIEQLPSFQGCIHIQEISFQHNKIQQIDRDTFQSLSALHLLDLSRNQIQVIHRDAFLTLTSLNNLDLSMNSLATIPSR 430          

HSP 3 Score: 58.5362 bits (140), Expect = 4.132e-8
Identity = 58/204 (28.43%), Postives = 94/204 (46.08%), Query Frame = 2
Query: 1109 NDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSIL------------------------SIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVL--SNLESIELQGNRIKF-DATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWP 1639
            +   L   P  L     +L L  NNI ++  + FKS   ++EL L  N +                         S+ + +  +L SL SL L  N +T +    F  + +L  L L+  +   LT  P   +   +NL+++ L  NRI +  A A   F NL  LV L L +N+I ++  N F+G VN++ +DL+ N+L+ +P
Sbjct:   43 SGRGLTAVPTGLSTFTYYLDLSMNNITELPANVFKSFPYMEELRLAGNDLTFIHPEALSGLHQLKVLMLQNNQLKSVPSAALKNLQSLQSLRLDANHITTVPDESFQGLQQLRHLWLDDNH---LTQVPVGSLTHQANLQALTLALNRITYIPANA---FANLTSLVVLHLHNNRIREIASNSFAGLVNLETLDLNFNNLMVFP 240          
BLAST of Epiphycan vs. Ensembl Medaka
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:101171324])

HSP 1 Score: 93.9745 bits (232), Expect = 6.040e-19
Identity = 112/396 (28.28%), Postives = 179/396 (45.20%), Query Frame = 2
Query:  128 FTFCLLLVIYNLVCL---------YVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPV--LKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS----DPDIRFSAMAKLTHLFMNDNNLINCPHRLPA---SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSIL 1261
            F F   LV+Y ++ +            PC   C C   SVDC    L   P  + +    + L  N I+S+     + L++++ L LS+NE+ E+  + F     +R+L+L NN +SVL     ++    L  + L  N   +IP+   +   +T+L L+ N+IR  +   +F   + L+ L L +N I ++  TD       K+  L L+ N+L  + + +   +  SL  L L      N++I      G       + L+L    LT +    L    D  LH L L  NS +  I+  AFRGL  ++IL L    IS    D +  FS + +L  L +  N + +      +   SL+ L+L  N IR I+ D F  + NLK L +  NS L
Sbjct:    8 FGFVCRLVLYLMLSMGERNSSGLGSELPCAQNCTCDGDSVDCSRLELTATP--LDLPARTVSLHHNNIRSIDGRRIRELVSVETLDLSNNEITELRGHCFPAGLQIRDLYLSNNKISVLELGALDRLGSSLQVLRLSRNRISQIPIRAFQLPRLTQLELNRNRIRQ-IEGLTFQGLSSLEVLKLQRNSISKL--TDGAFWDLAKMKVLHLEYNNLTEVNSGSLYGL-TSLTQLFLS-----NNSIARINPDGLKFCQRLRELNLSYNNLTRLDEGSLAMLGD--LHTLRLGHNS-ISQINEGAFRGLKAVRILELDHNDISGTIEDTNGAFSGLDRLNKLTLFGNKIKSVAKEAFSGLESLEHLNLGENPIRSIQPDAFSKMRNLKNLIMDSNSFL 389          

HSP 2 Score: 67.3958 bits (163), Expect = 7.621e-11
Identity = 82/293 (27.99%), Postives = 132/293 (45.05%), Query Frame = 2
Query: 1019 NLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRI-KFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNM-----NKLSTISID-FNSTNYL--------------PIDFAK---LKNISLENNQWNCSCHQIQWL 1822
            +LQ+L L++ +IS   IR   + +LT L +N                      N IRQI    F+ L++L+ L L++NSI  +   +F DLA +  L L +N LT + SG  + +  L  L L   N  +  I P+       L  + L  N + + D  +      L  L  L L  N I+++NE  F G   +++++L  N + G    T      S +D RLN      NK+ +++ + F+    L              P  F+K   LKN+ +++N + C C Q+QWL
Sbjct:  135 SLQVLRLSRNRISQIPIRAFQLPRLTQLELN---------------------RNRIRQIEGLTFQGLSSLEVLKLQRNSISKLTDGAFWDLAKMKVLHLEYNNLTEVNSGSLYGLTSLTQLFLS--NNSIARINPDGLKFCQRLRELNLSYNNLTRLDEGS---LAMLGDLHTLRLGHNSISQINEGAFRGLKAVRILELDHNDISGTIEDTNGAF--SGLD-RLNKLTLFGNKIKSVAKEAFSGLESLEHLNLGENPIRSIQPDAFSKMRNLKNLIMDSNSFLCDC-QLQWL 397          
BLAST of Epiphycan vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 92.8189 bits (229), Expect = 7.884e-19
Identity = 111/409 (27.14%), Postives = 172/409 (42.05%), Query Frame = 2
Query:  185 CPIPCKCTH--HSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPV 1405
            CP  C C      V C  + L  VP+G S D   LDLS N IK++    F  L+ L+ L LS N +  I   AF+GL NL+ L ++NN L +L    F+ GL  L  + L  NE                          +D +F     LQTL   +N++  I+Q                           AF  ++N L  L L+ + L  ++I  +ALT     T  +   L    ++S+  +  +     +L  L +     L +I +++  GL NL  L ++ C ++   + ++A+  L +L                  +FL L  N I  I+ +    L  L+ELHL   S+L IE  +F  L+    L++  N LT +E   FH +  L  L L+  NP+
Sbjct:   28 CPSRCACRPEVREVICSGKYLNSVPEGFSNDARRLDLSRNKIKTVGRRQFSGLVQLQDLDLSDNLISMIEVEAFLGLKNLKTLRIKNNRLKILPVGVFS-GLYSLRLLDLSQNEI----------------------LVFLDYTFKEVANLQTLEAGENDLVFISQ--------------------------RAFFGLQN-LQELNLDRSNL--TSIPTEALTQLQSLTVIRMFRLT---ISSLPNNAFRRL--PRLRTLQILNWPALDTIASNSLIGL-NLTSLTISSCNLT--AVPYAALRHLVYL------------------RFLDLSYNPITVIQGNLLGDLLRLQELHLAGASLLRIEPGAFKGLSFFRMLNVTSNMLTTLEESAFHSVGNLQVLRLD-GNPL 357          

HSP 2 Score: 71.633 bits (174), Expect = 3.174e-12
Identity = 91/321 (28.35%), Postives = 156/321 (48.60%), Query Frame = 2
Query:  944 KLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLI---NCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRD---NQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID-FNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFR-KLILNRDQILCNIPN 1879
            +L  LDLS+N ++  I+ +AF GL NL+ L +   ++   P   FS +  L  L ++ N ++   +   +  A+L+ L    N++  I Q  F  L NL+EL+L ++++ SI T +   L SLT + +    ++ + +  F R+P+L +L +    P L TIA NS +  NL S+ +    +    TA P +  L  LV L   D   N IT +  NL    + +Q + L+  SL+      F  L S    + +  N L+T+    F+S          L+ + L+ N   C C ++ W++  R +L  +  Q  C+ P+
Sbjct:   82 QLQDLDLSDN-LISMIEVEAFLGLKNLKTLRIKNNRLKILPVGVFSGLYSLRLLDLSQNEILVFLDYTFKEVANLQTLEAGENDLVFISQRAFFGLQNLQELNLDRSNLTSIPTEALTQLQSLTVIRMFRLTISSLPNNAFRRLPRLRTLQILNW-PALDTIASNSLIGLNLTSLTISSCNL----TAVP-YAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAGASLLRIEPGAFKGL-SFFRMLNVTSNMLTTLEESAFHSV-------GNLQVLRLDGNPLACDC-RLLWVMRRRQRLNFDGHQPTCSSPD 386          
BLAST of Epiphycan vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 92.8189 bits (229), Expect = 7.884e-19
Identity = 111/409 (27.14%), Postives = 172/409 (42.05%), Query Frame = 2
Query:  185 CPIPCKCTH--HSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPV 1405
            CP  C C      V C  + L  VP+G S D   LDLS N IK++    F  L+ L+ L LS N +  I   AF+GL NL+ L ++NN L +L    F+ GL  L  + L  NE                          +D +F     LQTL   +N++  I+Q                           AF  ++N L  L L+ + L  ++I  +ALT     T  +   L    ++S+  +  +     +L  L +     L +I +++  GL NL  L ++ C ++   + ++A+  L +L                  +FL L  N I  I+ +    L  L+ELHL   S+L IE  +F  L+    L++  N LT +E   FH +  L  L L+  NP+
Sbjct:   28 CPSRCACRPEVREVICSGKYLNSVPEGFSNDARRLDLSRNKIKTVGRRQFSGLVQLQDLDLSDNLISMIEVEAFLGLKNLKTLRIKNNRLKILPVGVFS-GLYSLRLLDLSQNEI----------------------LVFLDYTFKEVANLQTLEAGENDLVFISQ--------------------------RAFFGLQN-LQELNLDRSNL--TSIPTEALTQLQSLTVIRMFRLT---ISSLPNNAFRRL--PRLRTLQILNWPALDTIASNSLIGL-NLTSLTISSCNLT--AVPYAALRHLVYL------------------RFLDLSYNPITVIQGNLLGDLLRLQELHLAGASLLRIEPGAFKGLSFFRMLNVTSNMLTTLEESAFHSVGNLQVLRLD-GNPL 357          

HSP 2 Score: 71.633 bits (174), Expect = 3.174e-12
Identity = 91/321 (28.35%), Postives = 156/321 (48.60%), Query Frame = 2
Query:  944 KLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLI---NCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRD---NQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISID-FNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFR-KLILNRDQILCNIPN 1879
            +L  LDLS+N ++  I+ +AF GL NL+ L +   ++   P   FS +  L  L ++ N ++   +   +  A+L+ L    N++  I Q  F  L NL+EL+L ++++ SI T +   L SLT + +    ++ + +  F R+P+L +L +    P L TIA NS +  NL S+ +    +    TA P +  L  LV L   D   N IT +  NL    + +Q + L+  SL+      F  L S    + +  N L+T+    F+S          L+ + L+ N   C C ++ W++  R +L  +  Q  C+ P+
Sbjct:   82 QLQDLDLSDN-LISMIEVEAFLGLKNLKTLRIKNNRLKILPVGVFSGLYSLRLLDLSQNEILVFLDYTFKEVANLQTLEAGENDLVFISQRAFFGLQNLQELNLDRSNLTSIPTEALTQLQSLTVIRMFRLTISSLPNNAFRRLPRLRTLQILNW-PALDTIASNSLIGLNLTSLTISSCNL----TAVP-YAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAGASLLRIEPGAFKGL-SFFRMLNVTSNMLTTLEESAFHSV-------GNLQVLRLDGNPLACDC-RLLWVMRRRQRLNFDGHQPTCSSPD 386          
BLAST of Epiphycan vs. Planmine SMEST
Match: SMESG000057458.1 (SMESG000057458.1)

HSP 1 Score: 1513.05 bits (3916), Expect = 0.000e+0
Identity = 824/824 (100.00%), Postives = 824/824 (100.00%), Query Frame = 2
Query:  116 MKTRFTFCLLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQILCNIPNEKAGKNLFLVMVNCSDVILSRILSHVEQXXXXXXXXXXXXXXXXXXXXXXXXCRHRKRLKFCKRMSSPSYDILHNSSFENTLGEDIXXXXXXXXXXXGSLCLKDYENEQHCEINSKEEPIYDLELDFDVLYVTDNVNDRDFVRLTVKFVNELTESKVKKQILHCEVLAIDYRFKKMENXXXXXXXXXXXXXNFFLYESAICEEELINEMKLYCDCRIFDSDINQMFYDLIDMNYSS 2587
            MKTRFTFCLLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVNLKNTKLTTLTLKMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQILCNIPNEKAGKNLFLVMVNCSDVILSRILSHVEQKSKVKSIVISFVVVIIIVVILVLICRHRKRLKFCKRMSSPSYDILHNSSFENTLGEDINNNNDTRGNFNGSLCLKDYENEQHCEINSKEEPIYDLELDFDVLYVTDNVNDRDFVRLTVKFVNELTESKVKKQILHCEVLAIDYRFKKMENLKEILKERGKKKKNFFLYESAICEEELINEMKLYCDCRIFDSDINQMFYDLIDMNYSS
Sbjct:    1 MKTRFTFCLLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVNLKNTKLTTLTLKMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQGNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLKNISLENNQWNCSCHQIQWLLHFRKLILNRDQILCNIPNEKAGKNLFLVMVNCSDVILSRILSHVEQKSKVKSIVISFVVVIIIVVILVLICRHRKRLKFCKRMSSPSYDILHNSSFENTLGEDINNNNDTRGNFNGSLCLKDYENEQHCEINSKEEPIYDLELDFDVLYVTDNVNDRDFVRLTVKFVNELTESKVKKQILHCEVLAIDYRFKKMENLKEILKERGKKKKNFFLYESAICEEELINEMKLYCDCRIFDSDINQMFYDLIDMNYSS 824          
BLAST of Epiphycan vs. Planmine SMEST
Match: SMESG000044588.1 (SMESG000044588.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.752e-21
Identity = 98/308 (31.82%), Postives = 160/308 (51.95%), Query Frame = 2
Query:  218 VDCRHQALKDVPKGIS-IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGATGFQFLDL----KSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNL 1123
            +DC+   L+ +P   +  +V I  L FN ++ L N+SFQ    LK L+L +N+MK + EN F+GL NL  L+L NN L  L P +    L KL  +YL +NEF KIP + +  +  L L +NKI S    KS+L    ++T+ L  N I+++++    NLK +++ +  L  NS  N+  E F  ++  +  +++  N  L+    ++ +  FN     +   L     + GLT +S   L    +     LDLSEN  ++ +  D FR  ++L  L+L + KI      +F  + KL  L M+ N++
Sbjct:   19 LDCQRLQLRLIPSCKNQKNVKIFLLGFNQLEILHNSSFQMYSKLKELRLYNNKMKILQENTFIGLINLEILYLNNNFLKQL-PASLLSELPKLRKIYLHHNEFVKIPEISSRSLVNLYLGNNKIYSLYFPKSYLNCKKMRTIDLKHNLIEKLDKNHLYNLKKSQIESFILLSNSFRNVTTEIFYHIRKRIRKIDVSYNPHLSDYGFQKMIASFNHERHKKRWHLDIFASNIGLTKLSNFTLFTLTNVSTQKLDLSEN-FIEDLLTD-FRETNDLLELSLNRNKIFKIAKYQFVNLRKLRKLDMSYNSI 323          
BLAST of Epiphycan vs. Planmine SMEST
Match: SMESG000015729.1 (SMESG000015729.1)

HSP 1 Score: 77.0258 bits (188), Expect = 7.860e-14
Identity = 109/375 (29.07%), Postives = 175/375 (46.67%), Query Frame = 2
Query:  236 ALKDVP---KGISIDVTILDLSFNLIK------SLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKLNLDSNKIRSAVVDKS-FLLNTGLQTLILTKNEIK----EINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLINLELEGNKL---LNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFF---DSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISD-PDIRFSAMAKLTHLFMNDNNLINCPHRL---PASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDD 1288
             LKD P   + I+  V I++ S NLI       SL  + F+ L  L+ L LS N++K++ +  F   + L  L+L++N +  L P TF      L  +YL NN+F  +  +K   +T        IR   +D S  L+ T  Q     ++++     E N  + +  + + L  L L  N ++ +    F+ ++N L+ L L GN+L   + ST +E                 K+C   +       PF+    + L HLDLS+N  L  I +    GL N+QIL ++ C I+   D  F  M  ++ L ++ NNL   P  L    ++L+ L+L  NNI Q+R  +   L NL+ L+L  N   ++ T S  D
Sbjct:   93 GLKDPPFIQESIN-SVEIINFSNNLIDEGSQFYSLGMHFFKRLPKLRVLNLSKNKLKDLPKVWFECPNQLEILNLDDNMIGGLDP-TFASCFANLKQLYLRNNKFSYLKKIKDVDVT---FSGIPIRPVELDNSDHLIRTPNQLPFNVRHKVSKSSNEPNSHNNIIPQFSTLEILDLSFNKIQALEQIPFIGLQN-LVKLSLRGNRLKSYVKSTSLE-----------------KNCDFGT------APFYIKSPTSLIHLDLSDNIGLTRIHSCWIFGLQNIQILEISNCSINTIGDSTFHKMKNISRLDLSYNNLNELPKELVSISSTLRDLNLARNNISQLRSGNLIRLINLRALNLSHNRFQTLLTFSSKD 438          
BLAST of Epiphycan vs. Planmine SMEST
Match: SMESG000068721.1 (SMESG000068721.1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.103e-12
Identity = 146/607 (24.05%), Postives = 242/607 (39.87%), Query Frame = 2
Query:  185 CPIPCKCTHHS-VDCRHQALKDVPKGISIDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIP---VLKATHMTKLNLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIAAEAFVPVKNSLI-----NLELEGN-KLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKIS--DPDIRFSAMAKLTHLFMNDNNLI---NCPHRLPASLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSI-LSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLN------------------LEQQNPV--LLTIAPNSFVLSNLESIELQGNRIKFDATA---GPIFDNLPK-LVNLSLRDNQITKLNENLFSGSVNIQLIDLSMNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDF--------------NSTNYLPI----DFAKLKNISLENNQWNCSCHQIQWLLHF 1831
            C   C C+H   V C  + L ++P+ +  +V  LDL  N I  L          LK++ L+ N M +I   AF+GL+ L +++L  N+L  +    F  GL+ L+ +YL  N+ E +P   +  +  +  L+L  NK+ +++  ++F     L+ L L  N +    +  ++        T T     L+    +   P++N  I     N E E   +  +   V +             ++  + GL S+       F  +K   L +S N++ K     +     NL  L+L+  +I   +PD+ F+  +KL  + +N N L    N   +    L+ L L  N I  I  D FK+  NLK L L KN      +     + +      LG +RL   +S I  +   +  L+                    + N V    +I       S     + +    K D +      I + +PK    L L  N +  LNE  F   +N++ + LS N +         PL  S   + L+ NKL  I  D               N  + +P     D   L NI+L  N ++C C+ I+WL  F
Sbjct:  266 CSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFG-GLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKL-TSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETNTPVAACLQPRNLQG-TPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESI---FPSTKT--LIMSHNNLKKLTPIYSIHEAPNLMKLDLSFNQIETLEPDV-FTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVDHSVDSCHETNSVKTCCSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPL-KSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCN-IKWLNQF 861          

HSP 2 Score: 68.5514 bits (166), Expect = 2.823e-11
Identity = 122/486 (25.10%), Postives = 204/486 (41.98%), Query Frame = 2
Query:  185 CPIPCKCTHHSVDCRHQALKDVPK------------GISIDV------------TILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNK-GLIKLLHVYLGNNEF---EKIPVLKATHMTKLNLDSNKIRSA---------VVDKSFLLNTGLQTLI------LTKNEIKEINQTDFVXXXXXXXXXXXXXMNSLENIA-AEAFVPVKNSLIN----LELEGNKLLNSTIVEQALTGFNGATGFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGLDNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPA---SLKFLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISL--NLEQQNPVLLTIAPNSF---VLSNLESIELQGNR 1474
            CP  C+C ++SV+C+H+   +VP             G  I+V             +L LS N I S+   +F  L+NL +L+L+ N ++ + ++ F  L+ L+ L L +N L  ++   FNK G++K L +  GN  F   E I  LK  H+ +L +  NK+            +  KS ++  G  +++      L+   I  ++  +F      K         +LEN+  ++  V  K    +    ++  G +L N   + Q L      T    LDLK   +T +   +L  +    L  + L+ N M+  I+  AF GL                        +LT +++N+NNL            SL FL+LQ N+I  + +D  +S   L  LHL +N + S++  +F    +L  L L  N L         RM  ++    + E   PV   + P +     L NL+    Q N+
Sbjct:   39 CPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYL-LLEGNKIFWISEAISKLK--HLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKA--------NLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSN---IPQDL-----PTNVVELDLKDNNITILQQGYLSKY--KFLKKIILTRNGMV-DIEPGAFLGL-----------------------TQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLN-----CDCRMSWIVDYIKDKETNTPVAACLQPRNLQGTPLRNLQIYNFQCNK 474          

HSP 3 Score: 55.4546 bits (132), Expect = 2.746e-7
Identity = 49/137 (35.77%), Postives = 69/137 (50.36%), Query Frame = 2
Query: 1112 DNNLINCPHRL----PASLK----FLHLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDLGFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSF-VLSNLESIELQGNRIKFDATA 1495
            +N  + C HRL    P  L+     L+L  N I  IR+ DF  L NLK L L  N I SIE  +FD+L +L  L L  N +  +   +F ++ KL  L+L      L  I  N F  L  L+ + L+GN+I + + A
Sbjct:   46 ENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQ--LQCINDNIFNKLGMLKYLLLEGNKIFWISEA 180          
BLAST of Epiphycan vs. Planmine SMEST
Match: SMESG000012091.1 (SMESG000012091.1)

HSP 1 Score: 58.151 bits (139), Expect = 3.315e-8
Identity = 50/170 (29.41%), Postives = 83/170 (48.82%), Query Frame = 2
Query:  197 CKCTHHSVDCRHQ-ALKDVPKGISID--------------------------VTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSNLRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPV--LKATHMTKLNLDSNKIRSAVVDKSFLL 619
            C+CT  +VDC +Q A+  +P  I  D                          +T L + ++ ++S+ NN+F ++  L  + LSHN    I   AFVGL+ L+NL+LE N   +   +    GL  +  +YL NN   +I V  ++   ++KL L +N I++  +D+ F L
Sbjct:   46 CQCTSKTVDCNYQDAISFIPSDIKEDYDQLHVSHAEFQDPRLMKANFSTIIHLTSLKIVYSKLRSIDNNTFTSMDRLVYMDLSHNNFSVIGSRAFVGLT-LKNLYLEQNLGGLQLGQDMFYGL-TVTDLYLKNNGISQISVGIIEKLQISKLYLFNNSIKT--LDRRFKL 211          
The following BLAST results are available for this feature:
BLAST of Epiphycan vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LGR43.139e-2228.11leucine rich repeat containing G protein-coupled r... [more]
LGR47.178e-2227.29leucine rich repeat containing G protein-coupled r... [more]
IGFALS1.096e-2026.72insulin like growth factor binding protein acid la... [more]
SLIT21.307e-2024.57slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT21.473e-2024.57slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Epiphycan vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lron-153.399e-1827.59ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
slt-17.019e-1624.20Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
sma-101.955e-1422.57Leucine-rich repeats and immunoglobulin-like domai... [more]
sma-101.955e-1422.57Leucine-rich repeats and immunoglobulin-like domai... [more]
sma-104.640e-1422.57Leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of Epiphycan vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Toll-63.211e-2027.51gene:FBgn0036494 transcript:FBtr0075614[more]
Toll-63.211e-2027.51gene:FBgn0036494 transcript:FBtr0306307[more]
Toll-63.211e-2027.51gene:FBgn0036494 transcript:FBtr0306308[more]
atk1.113e-1925.33gene:FBgn0036995 transcript:FBtr0331569[more]
atk1.113e-1925.33gene:FBgn0036995 transcript:FBtr0331570[more]
back to top
BLAST of Epiphycan vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-182i3.117.776e-2528.10si:dkey-182i3.11 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
igfals9.289e-2327.78insulin-like growth factor binding protein, acid l... [more]
igfals9.289e-2327.78insulin-like growth factor binding protein, acid l... [more]
lgr42.869e-2026.88Danio rerio leucine-rich repeat containing G prote... [more]
tlr5a3.190e-2026.02toll-like receptor 5a [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Epiphycan vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl243.442e-2530.92ribosomal protein L24 [Source:Xenbase;Acc:XB-GENE-... [more]
IGFALS2.188e-2429.68insulin like growth factor binding protein acid la... [more]
rpl242.013e-2329.79ribosomal protein L24 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl242.966e-2328.51ribosomal protein L24 [Source:Xenbase;Acc:XB-GENE-... [more]
ENSXETT00000011039.11.009e-2225.17toll like receptor 3 [Source:NCBI gene;Acc:1004862... [more]
back to top
BLAST of Epiphycan vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Igfals1.336e-2327.18insulin-like growth factor binding protein, acid l... [more]
Lgr42.776e-2128.11leucine-rich repeat-containing G protein-coupled r... [more]
Lgr44.861e-2127.29leucine-rich repeat-containing G protein-coupled r... [more]
Slit21.457e-2024.57slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit21.584e-2024.57slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Epiphycan vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70389|ALS_MOUSE1.063e-2327.38Insulin-like growth factor-binding protein complex... [more]
sp|P35859|ALS_RAT1.451e-2225.00Insulin-like growth factor-binding protein complex... [more]
sp|F7D3V9|LGR5_XENTR1.571e-2228.51Leucine-rich repeat-containing G-protein coupled r... [more]
sp|F1MLX5|LGR4_BOVIN2.892e-2228.24Leucine-rich repeat-containing G-protein coupled r... [more]
sp|Q9BXB1|LGR4_HUMAN3.447e-2127.29Leucine-rich repeat-containing G-protein coupled r... [more]
back to top
BLAST of Epiphycan vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L1I8L92.834e-4130.02Uncharacterized protein OS=Guillardia theta (strai... [more]
A0A1S3ICW58.708e-4026.10chondroadherin-like protein OS=Lingula unguis OX=7... [more]
A0A0D2WX364.819e-3931.00LRRNT domain-containing protein OS=Capsaspora owcz... [more]
A0A2H4HHW44.954e-3728.17Toll-like recptor 11 OS=Oncomelania hupensis OX=56... [more]
A0A2I7NB231.785e-3626.56Tool like receptor 3 OS=Octopus vulgaris OX=6645 P... [more]
back to top
BLAST of Epiphycan vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfals1.481e-2327.63insulin like growth factor binding protein acid la... [more]
ENSAMXT00000052087.17.677e-2324.79toll-like receptor 13 [Source:NCBI gene;Acc:103042... [more]
ENSAMXT00000025596.24.538e-2127.88pep primary_assembly:Astyanax_mexicanus-2.0:1:1654... [more]
tlr32.657e-2023.89toll-like receptor 3 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
tlr31.113e-1923.95toll-like receptor 3 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Epiphycan vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005066.11.927e-2030.30pep scaffold:Pmarinus_7.0:GL476584:229611:317338:-... [more]
ENSPMAT00000010345.19.530e-1728.03pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1... [more]
LINGO22.118e-1623.23leucine rich repeat and Ig domain containing 2 [So... [more]
tlr213.740e-1626.76toll-like receptor 21 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ENSPMAT00000001020.18.280e-1633.85pep scaffold:Pmarinus_7.0:GL477382:11904:26610:1 g... [more]
back to top
BLAST of Epiphycan vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epiphycan vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481791.239e-1626.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432582.020e-927.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354074.268e-926.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448775.167e-931.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471096.687e-928.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epiphycan vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgr61.797e-2127.44leucine rich repeat containing G protein-coupled r... [more]
lgr41.555e-1927.80leucine rich repeat containing G protein-coupled r... [more]
lrig16.040e-1928.28leucine rich repeats and immunoglobulin like domai... [more]
lingo4b7.884e-1927.14leucine-rich repeat and immunoglobulin-like domain... [more]
lingo4b7.884e-1927.14leucine-rich repeat and immunoglobulin-like domain... [more]
back to top
BLAST of Epiphycan vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057458.10.000e+0100.00SMESG000057458.1[more]
SMESG000044588.11.752e-2131.82SMESG000044588.1[more]
SMESG000015729.17.860e-1429.07SMESG000015729.1[more]
SMESG000068721.12.103e-1224.05SMESG000068721.1[more]
SMESG000012091.13.315e-829.41SMESG000012091.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003556 ID=SMED30003556|Name=Epiphycan|organism=Schmidtea mediterranea sexual|type=transcript|length=3437bp
GTTATGTTTTAATAATTAATTTCTTAGAATTATTATATTTTTAGAATAAT
ATTTTTTTTTAAAATTTTATAGTTGTATTAAACGATTTGTAAATTACTAT
TAATTGAAGAATTTTATGAAAACTAGATTTACTTTTTGTTTACTTCTTGT
AATTTATAATCTTGTTTGCTTATATGTGTTTCCATGTCCAATACCATGTA
AATGCACTCATCATTCTGTTGATTGTCGACATCAAGCTTTAAAAGATGTG
CCAAAAGGTATTTCAATTGATGTTACTATATTAGATCTATCATTCAATTT
GATCAAGTCGTTATCGAATAATTCCTTTCAAACTTTAATAAATTTGAAGC
GTTTAAAATTATCTCACAATGAAATGAAAGAAATTAATGAAAATGCTTTT
GTTGGATTATCTAATTTACGAAATTTGCATCTTGAAAATAATGATCTATC
GGTTTTGCATCCAGAAACATTCAATAAAGGATTAATTAAATTGCTTCATG
TTTATTTGGGTAACAATGAATTCGAAAAAATTCCGGTTTTGAAAGCCACA
CACATGACAAAATTAAACCTGGACAGTAATAAAATCCGAAGTGCAGTTGT
CGATAAATCTTTTCTATTAAATACCGGTTTACAAACTTTGATTTTAACGA
AAAATGAAATTAAAGAAATAAACCAAACTGATTTTGTCAATTTGAAAAAT
ACAAAATTAACGACATTGACATTAAAAATGAATAGTTTAGAAAATATAGC
TGCCGAAGCATTTGTGCCGGTGAAAAATTCACTAATCAATCTCGAGTTAG
AGGGAAATAAATTGTTGAATTCCACAATAGTAGAACAAGCTTTGACTGGA
TTTAATGGAGCAACGGGATTTCAATTTCTGGATTTAAAAAGCTGTGGGCT
AACATCGATTTCCGGGGATTTTCTGAAGCCTTTTTTCGACTCAAAATTGC
ACCATTTGGATTTAAGCGAAAATTCCATGTTGAAATCCATCGACAATGAT
GCATTTCGTGGTCTCGACAATCTGCAAATACTCAACTTGGCCAAATGCAA
AATCTCCGATCCCGATATCCGATTCAGCGCCATGGCAAAATTAACACATT
TATTCATGAATGACAACAACCTGATTAATTGCCCGCATCGATTGCCGGCC
AGCTTGAAATTTCTCCATCTCCAGTCGAACAATATTCGACAGATCCGCCA
GGACGACTTCAAAAGTCTAACAAACCTCAAAGAGCTCCACCTGAAAAAGA
ACTCAATTCTCTCTATCGAAACGAATTCGTTTGACGATTTGGCGAGTTTG
ACGAGTTTAGATCTCGGCTTCAATCGATTGACACGAATCGAATCGGGAAT
TTTCCACCGAATGCCGAAATTGATTTCATTGAATTTGGAACAGCAAAATC
CAGTTCTGCTGACAATCGCGCCGAATTCGTTCGTGCTCTCGAATCTCGAA
TCGATCGAATTGCAGGGAAATCGAATCAAATTCGATGCGACTGCCGGCCC
GATTTTCGATAATTTGCCGAAATTGGTGAATTTGTCTCTGAGAGACAATC
AAATTACGAAATTGAATGAGAATCTATTTTCCGGTAGTGTAAATATTCAA
TTAATCGATTTGTCAATGAACAGTTTGATTGGTTGGCCGGCAAAAACATT
CCTGCCGTTGATTTCATCTGCCATCGATATCCGACTCAATATGAATAAGC
TCTCGACGATTTCGATCGATTTCAATAGCACAAATTATCTGCCGATCGAT
TTTGCCAAACTGAAGAATATCTCATTGGAAAATAATCAATGGAACTGCTC
GTGTCACCAGATCCAATGGCTGCTCCATTTTCGAAAATTGATATTGAATC
GCGACCAAATTTTATGCAATATTCCGAATGAGAAGGCCGGGAAAAATTTG
TTCTTAGTAATGGTTAATTGTTCCGATGTAATACTGAGCCGGATATTGTC
ACATGTGGAGCAGAAATCAAAAGTCAAATCGATCGTCATTAGCTTTGTGG
TTGTCATAATAATCGTGGTTATTTTGGTATTGATATGTAGGCATCGAAAA
AGATTGAAATTTTGCAAGAGAATGTCTAGTCCATCTTACGATATACTCCA
TAATTCTTCTTTCGAAAACACCTTGGGAGAGGATATTAATAACAATAATG
ATACCAGGGGAAATTTTAATGGTTCTCTTTGTTTAAAAGATTATGAAAAT
GAACAGCATTGTGAAATTAATTCAAAAGAAGAACCGATTTATGATTTGGA
ACTGGATTTCGATGTATTATATGTTACTGACAACGTAAATGATAGAGACT
TTGTCAGATTGACTGTGAAATTTGTTAATGAATTAACTGAATCGAAAGTT
AAAAAGCAAATTTTGCACTGTGAAGTGCTAGCTATCGATTATCGATTCAA
AAAAATGGAAAATTTAAAGGAAATATTAAAAGAAAGAGGAAAGAAAAAGA
AGAACTTTTTCCTCTATGAATCTGCGATTTGCGAAGAAGAATTAATTAAT
GAAATGAAGCTTTATTGTGATTGTAGGATTTTTGATTCAGATATTAACCA
AATGTTTTACGACCTGATTGATATGAATTACAGTTCATGATAAGAGTGGC
GGTGTTTATTTATACATTCCATTATTATATATCATTTTTTCTCAATATTA
TGCTCTCTCGTTGCTGTGGAGATGCGCTTTCTTTTCATTTTGTAAGTAAT
TGCTGGTTTGGAAATATATTGGGATTGTAATCAAAGGTTGGGAAATTTTT
GAGATGTTCAGATACATTTTGAGTTTACTCAAGCTTCACATATTTATTGA
TTGTTTTAAAATAAATTTATTTATGTCTCTGTGTGTGTGTGGTTAAAATA
AAAGTGAAATTTATGTACAAATAATTAACCGATGGATCTACACTATTGGT
TGGCCAAAATAGATAAATAGCAAAACTGATTAATTACATTATTATAAATA
TCATTCGTATTTATAATAATTACAAAATGTAATTTGTTTAAATAATCAAA
TAAATGGAAGAAATAGAAATTCATAAACGGGTTTTCTAATTTATTCATTT
ATATTAAAATCTAATAAATATTTGTTATCGACGATATTGAAGGAGCCAAC
ATTTGTGTCAGAATTGTTCTATAATTCTTTTACCGTATAACAACTTGGTT
CAATCTGGTAGATGAGTCATTCAAGTTAACATCCATTAAAAATGAGAAGA
CGAAATATTTACGATTTCTAACCAACCTTCACCACTCATTCCTCATGAAT
ATTCCAATTTACAAAGACCAAACACTAAGACAATTGTATTTCGCAAATTT
AGTGTGTCGAAATATATATGTATGTTTAATTGGCTCTTTCTTTTAATTAT
TCTATGTAAATGTGTGACCTTTTTATCAATTTGAAAGTGTTACTTCGTTT
GTTCAAGTATTCAAGAGAAGGTTTTTGGAATTGAGGG
back to top

protein sequence of SMED30003556-orf-1

>SMED30003556-orf-1 ID=SMED30003556-orf-1|Name=SMED30003556-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=825bp
MKTRFTFCLLLVIYNLVCLYVFPCPIPCKCTHHSVDCRHQALKDVPKGIS
IDVTILDLSFNLIKSLSNNSFQTLINLKRLKLSHNEMKEINENAFVGLSN
LRNLHLENNDLSVLHPETFNKGLIKLLHVYLGNNEFEKIPVLKATHMTKL
NLDSNKIRSAVVDKSFLLNTGLQTLILTKNEIKEINQTDFVNLKNTKLTT
LTLKMNSLENIAAEAFVPVKNSLINLELEGNKLLNSTIVEQALTGFNGAT
GFQFLDLKSCGLTSISGDFLKPFFDSKLHHLDLSENSMLKSIDNDAFRGL
DNLQILNLAKCKISDPDIRFSAMAKLTHLFMNDNNLINCPHRLPASLKFL
HLQSNNIRQIRQDDFKSLTNLKELHLKKNSILSIETNSFDDLASLTSLDL
GFNRLTRIESGIFHRMPKLISLNLEQQNPVLLTIAPNSFVLSNLESIELQ
GNRIKFDATAGPIFDNLPKLVNLSLRDNQITKLNENLFSGSVNIQLIDLS
MNSLIGWPAKTFLPLISSAIDIRLNMNKLSTISIDFNSTNYLPIDFAKLK
NISLENNQWNCSCHQIQWLLHFRKLILNRDQILCNIPNEKAGKNLFLVMV
NCSDVILSRILSHVEQKSKVKSIVISFVVVIIIVVILVLICRHRKRLKFC
KRMSSPSYDILHNSSFENTLGEDINNNNDTRGNFNGSLCLKDYENEQHCE
INSKEEPIYDLELDFDVLYVTDNVNDRDFVRLTVKFVNELTESKVKKQIL
HCEVLAIDYRFKKMENLKEILKERGKKKKNFFLYESAICEEELINEMKLY
CDCRIFDSDINQMFYDLIDMNYSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007605sensory perception of sound
GO:0060348bone development
GO:0001649osteoblast differentiation
GO:0002376immune system process
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
GO:0007275multicellular organism development
GO:0007283spermatogenesis
GO:0016055Wnt signaling pathway
GO:0030154cell differentiation
GO:0030282bone mineralization
GO:0032922circadian regulation of gene expression
GO:0034122negative regulation of toll-like receptor signaling pathway
GO:0045087innate immune response
GO:0046849bone remodeling
GO:0048511rhythmic process
GO:0050710negative regulation of cytokine secretion
GO:0090263positive regulation of canonical Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0031012extracellular matrix
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR000372LRRNT
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004871signal transducer activity
GO:0004888transmembrane signaling receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000372Leucine-rich repeat N-terminal domainSMARTSM00013lrrnt1coord: 23..55
e-value: 0.0021
score: 27.3
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 392..414
e-value: 24.0
score: 12.5
coord: 467..489
e-value: 35.0
score: 11.1
coord: 368..389
e-value: 400.0
score: 2.5
coord: 344..365
e-value: 320.0
score: 3.3
coord: 50..71
e-value: 74.0
score: 8.5
coord: 441..461
e-value: 100.0
score: 7.4
coord: 323..339
e-value: 460.0
score: 2.0
NoneNo IPR availablePANTHERPTHR45712FAMILY NOT NAMEDcoord: 283..503
NoneNo IPR availablePANTHERPTHR45712:SF22coord: 189..409
coord: 18..265
NoneNo IPR availablePANTHERPTHR45712FAMILY NOT NAMEDcoord: 189..409
coord: 18..265
NoneNo IPR availablePANTHERPTHR45712:SF22coord: 283..503
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.736
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 27..335
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 276..590
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 622..641
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 368..391
e-value: 1.4
score: 18.0
coord: 467..490
e-value: 0.052
score: 22.7
coord: 54..73
e-value: 110.0
score: 4.7
coord: 347..367
e-value: 95.0
score: 5.2
coord: 196..218
e-value: 140.0
score: 3.9
coord: 276..299
e-value: 190.0
score: 2.8
coord: 392..415
e-value: 0.001
score: 28.4
coord: 323..346
e-value: 110.0
score: 4.6
coord: 123..144
e-value: 180.0
score: 3.0
coord: 74..97
e-value: 0.6
score: 19.2
coord: 98..121
e-value: 0.0079
score: 25.4
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 248..338
e-value: 5.1E-14
score: 53.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 431..604
e-value: 1.6E-19
score: 71.1
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 23..247
e-value: 3.1E-41
score: 143.2
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 339..430
e-value: 5.1E-21
score: 76.5
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 276..336
e-value: 1.3E-8
score: 34.5
coord: 346..405
e-value: 6.0E-14
score: 51.6
coord: 53..111
e-value: 5.4E-14
score: 51.7
coord: 442..504
e-value: 2.6E-6
score: 27.1
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 197..218
score: 6.203
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 370..391
score: 6.711
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 443..455
score: 4.562
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 302..322
score: 5.494
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 346..367
score: 7.05
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 52..73
score: 7.25
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 100..121
score: 7.042
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 171..192
score: 6.172
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 76..97
score: 6.772
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 277..299
score: 6.626
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 493..514
score: 5.255
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 147..168
score: 5.009
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 469..490
score: 6.934
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 394..415
score: 7.604
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 125..146
score: 5.825