DDE_3 domain-containing protein

Overview
NameDDE_3 domain-containing protein
Smed IDSMED30003554
Length (bp)1326
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DDE_3 domain-containing protein (SMED30003554) t-SNE clustered cells

Violin plots show distribution of expression levels for DDE_3 domain-containing protein (SMED30003554) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DDE_3 domain-containing protein (SMED30003554) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DDE_3 domain-containing protein (SMED30003554) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003554

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30003554 dd_Smed_v4_5882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003554 dd_Smed_v4_5882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003554 dd_Smed_v4_5882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Match: CU929414.1 (pep chromosome:GRCz11:24:15670013:15671038:1 gene:ENSDARG00000110114.1 transcript:ENSDART00000185826.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929414.1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.669e-10
Identity = 70/288 (24.31%), Postives = 128/288 (44.44%), Query Frame = 1
Query:  340 ISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYVRRLLEEE----WNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGEN-----FSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRK 1146
            +SQ  +  +V+   +G  +  + R + +  +TV +II K+ K          G   K+P   VQ+++  V Q    T  ++++ L   G  +SK TIS  L  H I  +  R  P +  ++ E+ L+  K ++ + ++      W+D   I   E + +  T+    R          +PTV   G +I +       G     ++ G ++ E Y+  +++    +T KL+   G+    DN P H        F    + ++K P  SP LNPIE+++ ++K  V K
Sbjct:    8 LSQDLRSLIVEKHFDGNGYRRISRMLNVPVSTVGAIIRKWKKHKFTINRPRSGAPRKIPVRGVQRIIRRVLQEPRTTRAELQEDLASAGTIVSKKTISNALNHHGIHARSPRKTPLLNKKHVEARLKFAKQHLEKPVDYWVTIVWSDESKI---ELFGSHSTHHVWRRNGTAHHPKNTIPTVKFGGGSIMVWGCFSARGTGRLHIIEGRMNGEMYRDILDKNLLPSTRKLKIKRGWTFQQDNDPKHKAKETMKWFQRKKIKLLKWPSQSPDLNPIENLWRELKIKVHK 292          
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Match: CT990567.1 (pep chromosome:GRCz11:4:61995745:61997189:1 gene:ENSDARG00000100384.2 transcript:ENSDART00000171539.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT990567.1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.314e-10
Identity = 69/288 (23.96%), Postives = 129/288 (44.79%), Query Frame = 1
Query:  340 ISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYVRRLLEEE----WNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGEN-----FSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRK 1146
            +SQ  +  +V+   +G  +  + R + +  +TV +II K+ K          G   K+P   VQ+++  V Q    T  ++++ L   G  +SK TIS+ L  H I  +  R  P +  ++ E+ L+  K ++ + ++      W+D   I   E + +  T+    R          +PTV   G +I +       G     ++ G ++ E Y+  +++    +T KL+   G+    DN P H        F    + +++ P  SP LNPIE+++ ++K  V K
Sbjct:    8 LSQDLRSLIVEKHFDGNGYRRISRMLNVPVSTVGAIIRKWKKHKFTINRPRSGAPRKIPVRGVQRIIRRVLQEPRTTRAELQEDLASAGTIVSKKTISKALNHHGIHARSPRKTPLLNKKHVEARLKFAKQHLEKPVDYWETIVWSDESKI---ELFGSHSTHHVWRRNGTAHHPKNTIPTVKFGGGSIMVWGCFSARGTGRLHIIEGRMNGEMYRDILDKNLLPSTRKLKMKRGWTFQQDNDPKHKAKETMKWFQRKKIKLLEWPSQSPDLNPIENLWRELKIKVHK 292          
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Match: CR855320.2 (pep chromosome:GRCz11:1:7988052:7989314:1 gene:ENSDARG00000103767.2 transcript:ENSDART00000167552.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.2)

HSP 1 Score: 61.2326 bits (147), Expect = 8.316e-10
Identity = 69/288 (23.96%), Postives = 128/288 (44.44%), Query Frame = 1
Query:  340 ISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYVRRLLEEE----WNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGEN-----FSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRK 1146
            +SQ  +  +V+   +G  +  + R + +  +TV  II K+ K          G   K+P + VQ+++  V Q    T  ++++ L   G  +SK TIS  L  H I  +  R  P +  ++ E+ L+  K ++ + ++      W+D   I   E + +  T+    R          +PTV   G +I +       G     ++ G ++ E Y+  +++    +T KL+   G+    DN P H        F    + +++ P  SP LNPIE+++ ++K  V K
Sbjct:    8 LSQDLRSLIVEKHFDGNGYRRISRMLNVPVSTVGPIIRKWKKHKFTINRPRSGAPRKIPVQGVQRIIRRVLQEPRTTRAELQEDLASAGTIVSKKTISNALNHHGIHARSPRKTPLLNKKHVEARLKFAKQHLEKPVDYWETIVWSDESKI---ELFGSHSTHHVWRRNGTAHHPKNTIPTVKFGGGSIMVWGCFSARGTGRLHIIEGRMNGEMYRDILDKNLLPSTRKLKMKRGWTFQQDNDPKHKAKETMKWFQRKKIKLLEWPSQSPDLNPIENLWRELKIKVHK 292          
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Match: BX897685.1 (pep chromosome:GRCz11:3:36170943:36171968:-1 gene:ENSDARG00000110352.1 transcript:ENSDART00000193083.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX897685.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.203e-9
Identity = 69/288 (23.96%), Postives = 128/288 (44.44%), Query Frame = 1
Query:  340 ISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYVRRLLEEE----WNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGEN-----FSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRK 1146
            +SQ  +  +V+   +G  +  + R + +  +TV +II K+ K          G   K+P   VQ+++  V Q    T  ++++ L   G  +SK TIS  L  H I  +  R  P +  ++ E+ L+  K ++ + ++      W+D   I   E + +  T+    R          +PTV   G +I +       G     ++ G ++ E Y+  +++    +T KL+   G+    DN P H        F    + +++ P  SP LNPIE+++ ++K  V K
Sbjct:    8 LSQDLRSLIVEKQFDGNGYRRISRMLNVPVSTVGAIIRKWKKHKFTINRPRSGAPRKIPVRGVQRIIRRVLQEPRTTRAELQEDLASAGTIVSKKTISNALNHHGIHARSPRKTPLLNKKHVEARLKFAKQHLEKPVDYWETIVWSDESKI---ELFGSHSTHHVWRRNGTAHHPKNTIPTVKFGGGSIMVWGCFSARGTGRLHIIEGRMNGEMYRDILDKNLLPSTRKLKMKRGWKFQQDNDPKHKAKETMKWFQRKKIKLLEWPSQSPDLNPIENLWRELKIKVHK 292          
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-77f5.3 (si:dkey-77f5.3 [Source:ZFIN;Acc:ZDB-GENE-030131-5102])

HSP 1 Score: 50.8322 bits (120), Expect = 1.735e-6
Identity = 59/226 (26.11%), Postives = 103/226 (45.58%), Query Frame = 1
Query:  508 KLPEEMVQKLLTYVEQNYWCTLEDMRKYL-DDQGFHISKVTISRCLKKHLITFKK--VRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFN--TWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQ-AFINETTEK-LR---GTGFILVHDNVPIH---GENFSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVR 1143
            K+ +++V  +   + QN   T+  ++K++  D G  +S+ +I R  +K    +KK  +RP +AD + E+ L+         L ++W D K ++ D  + +  T T        K ER   +        + +  AI   GP    +    LD+  ++   I ET    +R   G     + DN P H   G+  +  ++  VK P  SP LNPIE V+ ++K  +R
Sbjct:   57 KMKQDIVAAIDQMMSQNQKTTVSSVKKHIWRDNGVSVSERSIRRIKQKLGWRYKKNLLRPTIADTDKEARLQ---------LAQKWIDEKEMFHDVIFSDEITLTLDHFSSVCKTERREFEPKRKRCVKVHVWAAISRLGPGPIVIFDRILDRTFFEDTIIRETAAPYIRENFGVHHRFIQDNDPKHTAAGKVIAAEDINWVKTPAESPDLNPIEMVWHELKEYLR 273          
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000051187.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:68173928:68174929:-1 gene:ENSXETG00000018584.1 transcript:ENSXETT00000051187.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 7.676e-11
Identity = 72/300 (24.00%), Postives = 130/300 (43.33%), Query Frame = 1
Query:  319 VKLNRNTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYV-------RRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHG-----ENFSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRKSLSS 1158
            +K  ++T    DK+  ++  + G  +  + + + I R+TV++II K+ + G        G+ PKL     + L+    +    TL D+++     G  + + TISR L K  +  +  R  P + + + +S L+   ++V       +++L  +    +L   +   +  W   T       E   + V    G +I L       G      + G +D   Y+A + E    + + LR G  F    DN P H      E F T ++ V++ P +SP LNPIE+++  +K  V K   S
Sbjct:    1 MKSKKHTRQVRDKV--IEKFKAGLGYKKISKALNIPRSTVQAIIQKWKEYGTTVNLPRQGRPPKLTGRTRRALIRNAAKRPMVTLGDLQRSTAQVGESVHRTTISRALHKVGLYGRVARRKPLLTENHKKSRLQFATSHVGDTANMWKKVLWSDETKMELFGQNAKRYVWWKTNT---AHHSEHTISTV-RYGGGSIMLWGCFSSAGTGKLVRVDGKMDGAKYRAILEENLLESAKDLRLGRRFTFQQDNDPKHKVRATMEWFKTKHIHVLEWPSHSPDLNPIENLWQDLKTAVHKRCPS 294          
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Match: dnm2 (dynamin 2 [Source:Xenbase;Acc:XB-GENE-959257])

HSP 1 Score: 63.5438 bits (153), Expect = 1.916e-10
Identity = 70/286 (24.48%), Postives = 128/286 (44.76%), Query Frame = 1
Query:  361 RLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKV---RPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTW-TNKTMGRCKKGERLYAKVPTV-----AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHG-----ENFSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRKSLSS 1158
            ++++  + G  +  + + + I R+TV++II K+ + G        G+ PKL     + L+    +    TL +++      G  + + TISR L K +  +++V   +P + + + +S L+   ++V       W   K+++ DE     +  N  +   +K    +   PTV      G +I L       G      + G +D   Y+A + E    + E LR G  F    DN P H      E F T ++ V++ P +SP LNP+E+++  +K  V K   S
Sbjct:   13 KVIEKFKAGLGYKKISKALNIPRSTVQAIIQKWKEYGTTVNLPRQGRPPKLTGRTRRALIRNAAKRPMVTLGELQGSTAQVGESVHRTTISRALHK-VGLYRRVARRKPLLTENHKKSRLQFATSHVGDT-ANMWK--KVLWSDETKTELFGQNAKLYVWRKTNTAHHSEPTVPTVTYGGGSIMLWGGFSSAGIGKLVRVDGKMDGAKYRAILEENLLESAEDLRLGRRFTFQQDNDPKHKARATMEWFKTKHIHVLEWPSHSPDLNPMENLWQDLKTAVPKRCPS 294          
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000001260.1 (glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Source:Xenbase;Acc:XB-GENE-5871034])

HSP 1 Score: 62.3882 bits (150), Expect = 4.210e-10
Identity = 68/290 (23.45%), Postives = 125/290 (43.10%), Query Frame = 1
Query:  361 RLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYV-------RRLLEEEWND--NKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHG-----ENFSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRKSLSS 1158
            ++++  + G  +  + + + I R+TV++I  K+ + G        G+ PKL     + L+    +    TL ++++     G  + + TISR L K  +  +  R  P + + + +S L+   ++V       +++L   W+D  N  ++        W      +          +PTV   G +I L       G      + G +D   Y+A + E    + + LR G  F    DN P H      E F T ++ V++ P +SP LNPIE+++  +K  V K   S
Sbjct:   13 KVIEKFKAGLGYKKISKALNIPRSTVQAIFQKWKEYGTTVNLPRQGRPPKLTGRTRRALIRNAAKRPMVTLAELQRSTAQVGESVHRTTISRALHKVGLYGRVARRKPLLTENHKKSRLQFATSHVGDTANMWKKVL---WSDETNMELFGQNAKRYVWR-----KTNTAHHSEHTIPTVKYGGGSIMLWGCFSSAGTGKLVRVDGKMDGAKYRAILEENLLESAKDLRLGQRFTFQQDNDPKHKARATMEWFKTKHIHVLEWPSHSPDLNPIENLWQDLKTAVHKRCPS 294          
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Match: cnih3 (cornichon family AMPA receptor auxiliary protein 3 [Source:Xenbase;Acc:XB-GENE-958010])

HSP 1 Score: 61.6178 bits (148), Expect = 7.578e-10
Identity = 69/282 (24.47%), Postives = 122/282 (43.26%), Query Frame = 1
Query:  340 ISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWND-NKLIYMDECYFNTW-TNKTMGRCKKGERLYAK---VPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIK 1131
            +S+  + ++V   + G  +  + +++G    TV +I+ K+ +          G   K+    V  +L  V+++   T E++   L   G  ++K TI   L  H    K  RPC      ++ ++ R  +    L +  +D  K+++ DE     +  N T    +K    Y     VPTV   G NI L       G      + G +D   Y+  +N+    +  KL+ G G++  HDN P H    +   L      V++ P  SP LNPIE+++ ++K
Sbjct:    7 LSKDVRDKIVDLHKAGMGYKTISKKLGEKVTTVGAIVRKWKEHKMTINRPRSGAPRKISPHGVSMILRKVKKHPRTTQEELVNDLKLAGTTVTKKTIGNTL--HRNGLKSCRPCKVPLLKKAHVQARLKFANEHLNDSVSDWEKVLWSDETKIELFGINSTRCVWRKKNAAYDPQNTVPTVKHGGGNILLWGCFSAKGTGQLIRINGKMDGAMYREILNDNLLPSARKLKMGRGWVFQHDNDPKHTAKATKEWLKKKHIKVMEWPSQSPDLNPIENLWRELK 286          
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000022225.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:91690864:91692046:1 gene:ENSXETG00000011018.1 transcript:ENSXETT00000022225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 8.735e-10
Identity = 67/286 (23.43%), Postives = 126/286 (44.06%), Query Frame = 1
Query:  361 RLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKV---RPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKT----MGRCKKGERLYAKVPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHG-----ENFSTNNL-VVKLPPYSPFLNPIESVFSKIKGNVRKSLSS 1158
            ++++  + G  +  + + + I R+TV++II K+ + G        G+ PKL     + L+    +    TL+++++     G  + + TISR L K +  + +V   +P + + + +S L+   ++V       W   K+++ DE     +          +          +PTV   G +I L       G      + G +D   Y+A + E    + + LR G  F    DN P H      E F T ++ V++ P +SP LNP+E+++  +K  V K   S
Sbjct:   13 KVIEKFKAGLGYKKISKVLNIPRSTVQAIIQKWKEHGTTVNLPRQGRPPKLTGRTRRALIRNAAKRPMVTLDELQRSTAQVGESVHRTTISRALHK-VGPYGRVARRKPLLTENHKKSHLQFATSHVGDT-ANMWK--KVLWSDETKMELFGQNAKRYVWRKTNTAHHSEHTIPTVKYGGGSIMLWGCFSSAGIGKLVRVDGKMDGAKYRAILEENLLESAKDLRLGRRFTFQQDNDPKHKVRATIEWFKTKHIHVLEWPSHSPDLNPMENLWQDLKTAVHKRCPS 294          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A267DQJ8 (DDE_3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002000g2 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.074e-37
Identity = 103/351 (29.34%), Postives = 170/351 (48.43%), Query Frame = 1
Query:  331 RNTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPK-LPEEMVQKLLTYVEQNYWCTLEDMRKYL-----DDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIG-VTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGFILVHDNVPIHGE--NFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLSSIQ---------GFSSMNIN---SRFTILSDIIVNEIKKEDYSNLENFYRHIRKFFPKSLLKEEIYG 1320
            R  +SQ D+ RLV A    +D+  L  Q+ I R + +++I K+ +TG +   K GG KPK L +EM++ L+ +V      TL+DMR++L     D Q   I   TISR L   LIT K +R      N++ +   R+ + + L+ E      L++ DE   N WT +T GR  +G R    V    G N+ + LA+  + G ++ K++ G + +E +  F  E    L    F L+HDN   H +            LPPYSPFLN  E   + +K ++++SLS ++           +++ I     R  IL   + + +      + E ++R   ++ P+ +  E+I  
Sbjct:    9 RVAVSQQDRRRLVNAFVLNEDWLNLAEQLNIPRQSARNVIVKFERTGRVEAEKRGGNKPKALSDEMIEALVGFVADTPAATLQDMRRHLMQAFPDWQACTIQ--TISRALDGQLITVKLLRTIPNAWNADRIKHERREFAKWLMTEGMG-KLLVFCDEMGCNVWTARTQGRAAEGVRAVRIVANQRGRNVTMCLAVSPMRGLVYWKIVRGGMTRELFAEFFAELA-ALVDEPFCLLHDNARAHWDPPAMGEEQEYRPLPPYSPFLNMTERAIAAVKASLKRSLSRVELQRQIGDRNAAAALGITLQEHRARILERELEDCMSAVTQLHCEAWHRESLRYVPRCIAMEDIVA 355          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: W4XP44 (DDE_3 domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.245e-35
Identity = 103/355 (29.01%), Postives = 165/355 (46.48%), Query Frame = 1
Query:  340 ISQTDKIRLVQALE-NGQDFFLLGRQMGITRNTVKSIIYKYNKTGAIS-FGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDD---QGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAI-GVTGPIHHKLLIGSLDKESYQAFINETTEKLR-----GTGFILVHDNVPIH-----GENFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLS-----------SIQGFSSMNINS-RFTILSDIIVNEIKKEDYSNLENFYRHIRKFFPKSLLKEEIYG 1320
            IS  D+ RLV+A E NGQD+  L   +GI R+T +SI+  Y  +G I    + G +  K+ EEM   L   ++ N   TL  M+  L +   Q   +S  TI+R L   L+T K        RN+  VL+ R+ Y    LE     N  +++DEC +N WT +T GR  +G      V    G N  +  A+    G +HH++   ++ + S++ F+  T  +           +L++DN   H      E+ ++     +LPPYSPFLN  E   S  K  V+++L+              G + +N+   R   L ++ V  I     +    +Y H + + P+ L ++EI G
Sbjct:   10 ISNVDRRRLVEAFEGNGQDYLELADNLGIKRSTARSIVATYLDSGRIEKLPRGGARNSKIDEEMKNYLQDIIDTNPLLTLRQMKDKLREDLPQKPEVSTTTIARALDAMLMTLKLAEDVPDARNAPRVLQQREEYAEWFLEHGVLAN-CVFIDECGYNIWTRRTQGRAPRGVPARRVVHGQRGRNCNVSFAVSAAVGLVHHEMAFETVTRASFERFLAATVAECNEMFPDDAPVVLIYDNARPHVRAELPEDVNSLIETKRLPPYSPFLNMTEMAHSSFKSAVKRTLALPAWQRRVGDRVAAGRAGVNLQQWRCDALREVAVQCIDTVTPAKCTQWYNHSQTYMPRCLARQEIDG 363          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A1I8GL13 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.099e-34
Identity = 99/291 (34.02%), Postives = 150/291 (51.55%), Query Frame = 1
Query:  331 RNTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGF----HISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIG-VTGPIHHKLLIGSLDKESYQAFINETTEKLRG----TGFILVHDNVPIH--GENFSTNNLVV--KLPPYSPFLNPIESVFSKIKGNVRKSLSSIQ 1164
            R  +S  D+ RL+ A + G+DF LL  Q+GI R T  SI+ +  +   +S G  G K  K   EM + L   VEQN   TL++M   L  Q F    H+S+ T+S  L   L T K  R   A+RNS  V+  R+ + + +   E +D + I++DE  FNTW  ++ GR  +G+R+Y +V    G  I + LA+    G +H +     + KE +  F+  T          +   +V DNV  H   E++   + V   +LPPYSPFL P+E+  S  K  +++ LS+IQ
Sbjct:  889 RQPVSNHDRQRLLSAYQKGEDFILLASQLGIKRTTAYSIV-RSGRVEKLSCG--GAKNVKWDGEMQEYLCAIVEQNPLLTLKEMNTMLR-QAFPEKQHVSEKTLSIKLDGALFTTKLARDLPAERNSPRVVAAREQFAQWMCSPEASDTEKIFIDEFGFNTWMRRSYGRSLRGQRVYRQVSGQKGQRITVCLAVSPAAGIVHFQSYDSGMTKERFGEFLTITIANFHSVFPDSSISVVIDNVSSHNDAESYEVEDAVEVRRLPPYSPFLTPVENAISCWKAALKRRLSAIQ 1175          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A0C2JI12 (DDE_3 domain-containing protein OS=Thelohanellus kitauei OX=669202 GN=RF11_01522 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.326e-33
Identity = 99/340 (29.12%), Postives = 172/340 (50.59%), Query Frame = 1
Query:  334 NTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKP-KLPEEMVQKLLTYVEQNYWCTLEDM-RKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLE--EEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGF---ILVHDNVPIHG-ENFS-----TNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLSSIQGFSSMNINSRFTILSDIIVNEIKKEDYSNLENFYRHIRKFFPKSLLKEEI 1314
            N +S  D+ R+V A + GQ    +   +G+ R+T+ S+I  ++++G I   K G  +P KL E+  +++ ++V+ N    L  +  K  ++    + K TI R L++   ++K+V      RN+ES L +R+ Y  R LE  + + +++ I++DEC  N     + GR K G      VP +   NI +  A+ V G + HK    + +++ +  +I+E  EK+R        +V DNV  H  E  S       + ++ LPPYSPF+NPIE++FSK K  +R   S     +S  +    T  S +I +       S+   +Y H+ ++  + L +E I
Sbjct:    4 NKLSDLDRKRIVDAYQKGQKASEISLVLGVARSTINSVIKIFHQSGRIDSNKRGYIQPEKLNEDQKERIKSWVDDNAGIPLRTIVTKVQEEMDISVGKSTIDRILQRFHYSWKRVSIIPERRNNESTLNIRERYATRYLELLQSFREHQFIFIDECGVNISMRTSHGRSKIGSPAIHVVPNLRSRNISICAAMNVNGMLLHKWHDRAFNRDLFGNYIDELLEKIRALNIEHATIVMDNVSFHHCEEISQQISEAGHTLLFLPPYSPFMNPIENMFSKWKREIRYRRSE----NSEELYQNITAASSLITS-------SDCSGYYSHMFRYINRCLRREVI 332          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: W4Z6F7 (DDE_3 domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.280e-33
Identity = 104/355 (29.30%), Postives = 163/355 (45.92%), Query Frame = 1
Query:  340 ISQTDKIRLVQALE-NGQDFFLLGRQMGITRNTVKSIIYKYNKTGAIS-FGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDD---QGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAI-GVTGPIHHKLLIGSLDKESYQAF----INETTEKLRGTG-FILVHDNVPIH-----GENFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLS-----------SIQGFSSMNINS-RFTILSDIIVNEIKKEDYSNLENFYRHIRKFFPKSLLKEEIYG 1320
            IS  D+ RLV+A E NGQD+  L   +GI R+T +SI+  Y  +G I    + G +  K+ EEM   L   ++ N   TL  M+  L +   Q   +S  TI+R L   L+T K        RN+  VL+ R  Y    LE     N  +++DEC +N WT +T GR  +G      V    G N  +  A+    G +HH++   ++ + S++ F    + E  E        +L++DN   H      E+ ++     +LPPYSPFLN  E   S  K  V+++L+              G   +N+   R   L ++ V  I     +    +Y H + + P+ L ++EI G
Sbjct:   10 ISNVDRRRLVEAFEGNGQDYLELADNLGIKRSTARSIVATYLDSGRIEKLPRGGARNSKIDEEMKNYLQDIIDTNPLLTLRQMKDKLREDLPQKPEVSTTTIARALDVMLMTLKLAEDVPDARNAPRVLQQRGEYAEWFLEHGVLAN-CVFIDECGYNIWTRRTQGRAPRGVPARRVVHGQRGRNCNVSFAVSAAVGLVHHEMAFETVTRASFERFLAAKVAECNEMFPDDAPVVLIYDNARPHVRAELPEDVNSLIETKRLPPYSPFLNMTEMAHSSFKSAVKRTLALPAWQRRVGDRVAAGREGVNLQQWRCDTLREVAVQCIDTVTPAKCTQWYNHSQTYMPRCLERQEIDG 363          
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035600.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000368.1:79720:80742:-1 gene:ENSAMXG00000029746.1 transcript:ENSAMXT00000035600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.960e-13
Identity = 75/286 (26.22%), Postives = 132/286 (46.15%), Query Frame = 1
Query:  355 KIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELR-------KTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAK--VPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIKGNV 1140
            K R++   ++G+    + +Q+ + R TV++II KY   GA+      G+K KL     ++L+  V+     T + + K L+  G  +S  T+ R L +H +   + R  P +  R+ ++ L+         KT+ R++L   W+D   I +    F   T + + R +KGE    +  +PTV   G +I L      +G    + + G + KE Y   + E    +  +L  G  ++   DN P H        L      V++ P  SP LNPIE++++ +K  V
Sbjct:   12 KKRIIDLNKSGKSLGAISKQLQVPRATVQTIIRKYKVHGAVVSLPRSGRKRKLSHAAERRLVRMVKSQPRITKKQVCKDLEADGTQVSVSTVKRVLHRHGLRGCRARKKPLLQKRHLKTRLKFAVDHMDKDKTFWRKVL---WSDETKIEL----FGHNTQQYVWR-RKGEAFNPRNTMPTVKHGGGSIMLWGCFAASGTGSLQKVNGIMKKEDYLQILQENLKPSARRLGLGRSWVFQQDNDPKHTSKVVKEWLNQARIKVLEWPSQSPDLNPIENMWTVLKKRV 289          
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035367.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:11492005:11493027:-1 gene:ENSAMXG00000032039.1 transcript:ENSAMXT00000035367.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 3.587e-13
Identity = 75/286 (26.22%), Postives = 132/286 (46.15%), Query Frame = 1
Query:  355 KIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELR-------KTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAK--VPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIKGNV 1140
            K R++   ++G+    + +Q+ + R TV++II KY   G +      G+K KL     ++L+  V+     T + + K L+  G  +S  T+ R L +H +   + R  P +  R+ ++ L+         KT+ R++L   W+D   I +    F   T + + R +KGE    +  +PTV   G +I L      +G    + + G + KE Y   + E    +  +L  G  ++L  DN P H        L      V++ P  SP LNPIE++++ +K  V
Sbjct:   12 KKRIIDLNKSGKSLGAISKQLQVPRATVQTIIRKYKVHGTVVSLPRSGRKRKLSHAAERRLVRMVKSQPRITKKQVCKDLEADGTQVSVSTVKRVLHRHGLRGCRARKKPLLQKRHLKTRLKFAADHMDKDKTFWRKVL---WSDETKIEL----FGHNTQQYVWR-RKGEAFNPRNTMPTVKHGGGSIMLWGCFAASGTGSLQKVNGIMKKEDYLQILQENLKPSARRLGLGRSWVLQQDNDPKHTSKVVKEWLNQARIKVLEWPSQSPDLNPIENMWTVLKKRV 289          
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048019.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:17920963:17922346:1 gene:ENSAMXG00000033329.1 transcript:ENSAMXT00000048019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 7.052e-13
Identity = 74/286 (25.87%), Postives = 131/286 (45.80%), Query Frame = 1
Query:  355 KIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELR-------KTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAK--VPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIKGNV 1140
            K R++   ++G+    + +Q+ + R TV++II KY   G +      G+K KL     ++L+  V+     T + + K L+  G  +S  T+ R L +H +   + R  P +  R+ ++ L+         KT+ R++L   W+D   I +    F   T + + R +KGE    +  +PTV   G +I L      +G    + + G + KE Y   + E    +  +L  G  ++   DN P H        L      V++ P  SP LNPIE++++ +K  V
Sbjct:   12 KKRIIDLNKSGKSLGAISKQLQVPRATVQTIIRKYKVHGTVVSLPRSGRKRKLSHAAERRLVRMVKSQPRITKKQVCKDLEADGTQVSVSTVKRVLHRHGLRGCRARKKPLLQKRHLKTRLKFAADHMDKDKTFWRKVL---WSDETKIEL----FGHNTQQYVWR-RKGEAFNPRNTMPTVKHGGGSIMLWRCFAASGTGSLQKVNGIMKKEDYLQILQENLKPSARRLGLGRSWVFQQDNDPKHTSKVVKEWLNQARIKVLEWPSQSPDLNPIENMWTVLKKRV 289          
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000056445.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:14505415:14506497:1 gene:ENSAMXG00000033383.1 transcript:ENSAMXT00000056445.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 8.270e-13
Identity = 75/286 (26.22%), Postives = 131/286 (45.80%), Query Frame = 1
Query:  355 KIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELR-------KTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAK--VPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIKGNV 1140
            K R++   ++G+    + +Q+ + R TV++II KY   G +      G+K KL     ++L+  V+     T + + K L+  G  +S  T+ R L +H +   + R  P +  R+ ++ L+         KT+ R++L   W+D   I +    F   T + + R +KGE    K  +PTV   G +I L      +G    + + G + KE Y   + E    +  +L  G  ++   DN P H        L      V++ P  SP LNPIE++++ +K  V
Sbjct:   12 KKRIIDLNKSGKSLGAISKQLQVPRATVQTIIRKYKVHGTVVSLPRSGRKRKLSHAAERRLVRMVKSQPRITKKQVCKDLEADGTQVSVSTVMRVLHRHGLRGCRARKKPLLQKRHLKTRLKFAADHMDKDKTFWRKVL---WSDETKIEL----FGHNTQQYVWR-RKGEAFNPKNTMPTVKHGGGSIMLWGCFAASGTGSLQKVNGIMKKEDYLQILQENLKPSARRLGLGRSWVFQQDNDPKHTSKVVKEWLNQARIKVLEWPSQSPDLNPIENMWTVLKKQV 289          
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051384.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:18701749:18702759:1 gene:ENSAMXG00000030782.1 transcript:ENSAMXT00000051384.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.033e-12
Identity = 74/286 (25.87%), Postives = 131/286 (45.80%), Query Frame = 1
Query:  355 KIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELR-------KTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAK--VPTV--AGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINE----TTEKLR-GTGFILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIKGNV 1140
            K R++   ++G+    + +Q+ + R TV++II KY   G +      G+K KL     ++L+  V+     T + + K L+  G  +S  T+ R L +H +   + R  P +  R+ ++ L+         KT+ R++L   W+D   I +    F   T + + R +KGE    +  +PTV   G +I L      +G    + + G + KE Y   + E    +  +L  G  ++   DN P H        L      V++ P  SP LNPIE++++ +K  V
Sbjct:   12 KKRIIDLNKSGKSLGAISKQLQVPRATVQTIIRKYKVHGTVVSLPRSGRKRKLSHAAERRLVRMVKSQPRITKKQVCKDLEADGTQVSVSTVKRVLHRHGLRGCRARKKPLLQKRHLKTRLKFAADHMDKDKTFWRKVL---WSDETKIEL----FGHNTQQYVWR-RKGEAFNPRNTMPTVKHGGGSIMLWGCFAASGTGSLQKVNGIMKKEDYLQILQENLKPSARRLGLGRSWVFQQDNDPKHTSKVVKEWLNQARIKVLEWPSQSPDLNPIENMWTVLKKRV 289          
BLAST of DDE_3 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020393.2 (pep primary_assembly:ASM223467v1:14:19460905:19462254:-1 gene:ENSORLG00000016291.2 transcript:ENSORLT00000020393.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.828e-8
Identity = 67/289 (23.18%), Postives = 129/289 (44.64%), Query Frame = 1
Query:  328 NRNTISQTD-KIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTW--TNKTMGRCKKGERLYAK--VPTVA-GPNICLVLAIGVTGPIHH-KLLIGSLDKESYQAFINETT-EKLRGTG-----FILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIK 1131
            NRN   + D + +++     G+ +  + +Q+ +   TV  II K+   G ++     G+K K+ +++ ++++  V +    T +D++  L DQG  +S  TI  CL +  +  ++ R  P +   + ++ LE  K +V +  +  W +  +++ DE     +   ++   R  K E    K  VPTV  G    L         I   +++ G +  + YQ  ++      +R  G     ++   DN P H        L      + K P  SP LNPIE +++++K
Sbjct:    3 NRNRRRELDIRNKIIDNHRKGKGYKTISKQLEVPVTTVAHIIQKFKTHGTVANLPGRGRKRKIEDKLRRRIVGTVSKELITTSKDIKGELLDQGTSVSDRTIRCCLSQSGLHGRRSRRSPLLKVNHKKARLEFAKMHVDK-PQSFWEN--VLWTDETKLELFGKAHQLYVRRLKNEAYNQKNTVPTVKHGRGSVLFWGCSAASGIGCLEIVQGKMKSQDYQGILDRNVLPSVRKLGLSPRSWVFQQDNDPKHTAKNIQEWLREKRWTIRKWPSMSPDLNPIEHLWTELK 288          
BLAST of DDE_3 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000705.2 (pep primary_assembly:ASM223467v1:6:9076892:9077941:1 gene:ENSORLG00000000574.2 transcript:ENSORLT00000000705.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.191e-7
Identity = 69/300 (23.00%), Postives = 132/300 (44.00%), Query Frame = 1
Query:  331 RNTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAK------------VPTV--AGPNI----CLVLAIGVTGPIHHKLLIGSLDKESYQAFINETT-EKLRGTGF-----ILVHDNVPIHGENFSTNNL------VVKLPPYSPFLNPIESVFSKIKGNV 1140
            R  +SQ  + +++     G+ +  + +Q+ +   TV  II K+   G ++     G+K K+ +++ ++++  V +    T +D++  L D+G  +S  T  RCL +  +  ++ R     R S   LE  K +V +  +  W +  +++ DE        K +    K  +LY +            VPTV   G ++    C V +   TG +  +++ G +    YQ+ ++      +R  GF     +   DN P H        L      ++K P  SP LNPIE ++ ++K  +
Sbjct:   20 RRELSQDIRNKIIDK-HKGKGYKTISKQLEVPVMTVAHIIQKFQTHGTVADLPGRGRKRKIDDKLRRRIVGTVSKEPRTTSKDIKGELLDKGTSVSDRTSRRCLSQSGLHGRRPR-----RTSLLRLEFAKMHVDK-PQSFWEN--VLWTDE--------KKLELFGKAHQLYVRRLKHEAHNKKNTVPTVKHGGGSVLFWGCFVAS--ATGCL--EVVQGKMKSPDYQSILDRNVLPSVRKLGFSRRSWVFQQDNDPKHTAKKPQEWLREKPWTILKWPSMSPDLNPIEHLWKELKHAI 298          
BLAST of DDE_3 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000032070.1 (pep primary_assembly:ASM223467v1:23:23735603:23736916:-1 gene:ENSORLG00000027947.1 transcript:ENSORLT00000032070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 2.689e-7
Identity = 63/289 (21.80%), Postives = 128/289 (44.29%), Query Frame = 1
Query:  364 LVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTG-AISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICL---------VLAIGV-----TGPIHHKLLIGSLDKESYQAFINE---TTEKL--RGTGFILVHDNVPIHGENFSTN------NLVVKLPPYSPFLNPIESVFSKIKGNVRK 1146
            +V     G  +  + + + +  +T+ +II K+ + G  I+  + G  + K+    V+ +L  V Q    T  +++K L+  G  +SK TIS  L +H +  +  R  P +  ++ E+ LE    ++         D  + + ++  ++  T   +  C K + ++ K  T   P   +         ++A G      TG +H  ++ G +  E Y   +++   ++ +L     G+I   DN P H    + N        +++ P  SP LNPIE+++ ++K  V +
Sbjct:   16 IVAKHTEGIGYRRISKLLKVPVSTIGAIIRKWKEHGITINLPRPGAPR-KISNRGVRTILRRVLQQPRTTPGELQKDLESAGTGVSKKTISNALNRHGLHARTPRKTPFLKKKHVEARLEFATQHL---------DKPVTFWEKILWSDETKIELFGCHKTQHVWRKNGTAHSPQNTIPTVKFGGGSIMAWGCFSACGTGRLH--IIEGIMTGEKYGDILDQNLLSSARLLKMKRGWIFQQDNHPKHTAKVTLNWLKKKKRKLLEWPSQSPDLNPIENLWKELKIRVHR 292          
BLAST of DDE_3 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000016717.2 (pep primary_assembly:ASM223467v1:18:7175091:7176236:-1 gene:ENSORLG00000013337.2 transcript:ENSORLT00000016717.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 2.203e-6
Identity = 61/282 (21.63%), Postives = 124/282 (43.97%), Query Frame = 1
Query:  385 GQDFFLLGRQMGITRNTVKSIIYKYNKTG-AISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVR--PCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICL---------VLAIGV-----TGPIHHKLLIGSLDKESYQAFINE---TTEKL--RGTGFILVHDNVPIHGENFSTN------NLVVKLPPYSPFLNPIESVFSKIKGNVRK 1146
            G  +  + + + +  +T+ +II K+ + G  I+  + G  + K+ +  V+ ++  V Q    T  +++K  +  G  +SK TIS  L +H +  +     PC+  ++ E+ LE    ++         D  + + ++  ++  T   +  C K + ++ K  T   P             ++A G      TG +H   L G +  E Y   +++   ++ +L     G+I   DN P H    + N        +++ P  SP LNPIE+++ ++K  V +
Sbjct:   23 GIGYRRISKLLKVPVSTIGAIIRKWKEHGITINLPRPGSPR-KISDRGVRTIIGRVLQQPSTTRGELQKDQESAGTVVSKKTISNALNRHGLHARTPHKTPCLKKKHVEARLEFATQHL---------DKPMTFWEKILWSDETKIELFGCHKTQHVWRKNGTAHHPQNTTPTVKFGGGSIMAWGCFSACGTGRLH--FLEGIMTGEKYGDILDQNLLSSARLLKMKRGWIFQQDNDPKHTAKVTLNWLKKKKIKLLEWPSQSPDLNPIENLWKELKIRVHR 292          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000041908.1 (SMESG000041908.1)

HSP 1 Score: 390.963 bits (1003), Expect = 1.972e-123
Identity = 187/327 (57.19%), Postives = 243/327 (74.31%), Query Frame = 1
Query:  316 KVKLNRNTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGFILVHDNVPIHGENFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLSSIQGFSSMNINSRFTILSDIIVNEIKKEDYSNLENFYRHIRKFFPKS 1296
            +++ +R  IS+ DKIR++ A+ENG+D+F  G+ +GI RN++K+IIYKY K G +S GKIGG   K+ EE   KLL +VE+N + +LE+M+ +L  +   +S  TISR L+ HLIT K++RP VA+RNS+ VL+LR  Y  R LEE W D++LIY+DEC FNTWT++ +GR KKGERLYA +PT  G N+ L LAIGV GP+HHKL++GS  K++YQ FINE T KL GTGF L+HDN  IHG   S NN++  LPPYSPFLNPIESVFSKIK N+RKS+S   G SSMN  SRF  L D + NE+ KEDY +L N++ HIR+FFPKS
Sbjct:  500 QLQSDRKKISEIDKIRIINAMENGEDYFHFGKLLGIARNSIKTIIYKYRKFGKLSQGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAIGVNGPVHHKLVVGSYKKDTYQIFINEITVKLNGTGFRLIHDNASIHGGAISLNNVIEHLPPYSPFLNPIESVFSKIKFNIRKSISRAGGLSSMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKS 826          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000005064.1 (SMESG000005064.1)

HSP 1 Score: 379.022 bits (972), Expect = 4.193e-120
Identity = 182/328 (55.49%), Postives = 235/328 (71.65%), Query Frame = 1
Query:  304 TVPSKVKLNRNTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGFILVHDNVPIHGENFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLSSIQGFSSMNINSRFTILSDIIVNEIKKEDYSNLENFYRHIRKFF 1287
            T P  +      IS+ DKIR++ A+ENG+D+F  G+ +GI+RN++K+IIYKY K   +S GKIGG K K+ EE   KLL +VE+N + +L +M+ +L  +   +S  TISR L  HLIT K++RP VA+RNS+ VL+ R  Y  R LEE W D++LIY+DEC FNTWT++ +GR KKGERLYA +PT  G N+ L LA GV GP+HHKL++GS  K++YQ FINE T KL GTG+ L+HDN  IHG   S NN +  LPPYSPFLN IESVFSKIK N+RKS+S   GFSSMN  SRF  L D + NE+ KEDYS+L N++ HIR+FF
Sbjct:  118 TTPETLTKKHTLISEIDKIRIINAMENGEDYFYFGKLLGISRNSIKTIIYKYRKFEKLSQGKIGGNKSKISEEHGNKLLDFVEKNVYASLVEMKNFLISENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDFRMKYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAFGVNGPVHHKLVVGSYKKDTYQIFINEITVKLNGTGYRLIHDNASIHGGAISLNNAIEHLPPYSPFLNLIESVFSKIKFNIRKSISRAGGFSSMNFQSRFDFLKDALDNELVKEDYSDLTNYFGHIRRFF 445          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000005064.1 (SMESG000005064.1)

HSP 1 Score: 352.443 bits (903), Expect = 1.958e-110
Identity = 170/309 (55.02%), Postives = 219/309 (70.87%), Query Frame = 1
Query:  304 TVPSKVKLNRNTISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGFILVHDNVPIHGENFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLSSIQGFSSMNINSRFTILSDIIVNEI 1230
            T P  +      IS+ DKIR++ A+ENG+D+F  G+ +GI+RN++K+IIYKY K   +S GKIGG K K+ EE   KLL +VE+N + +L +M+ +L  +   +S  TISR L  HLIT K++RP VA+RNS+ VL+ R  Y  R LEE W D++LIY+DEC FNTWT++ +GR KKGERLYA +PT  G N+ L LA GV GP+HHKL++GS  K++YQ FINE T KL GTG+ L+HDN  IHG   S NN +  LPPYSPFLN IESVFSKIK N+RKS+S   GFSSMN  SRF  L D + NE+
Sbjct:  101 TTPETLTKKHTLISEIDKIRIINAMENGEDYFYFGKLLGISRNSIKTIIYKYRKFEKLSQGKIGGNKSKISEEHGNKLLDFVEKNVYASLVEMKNFLISENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDFRMKYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAFGVNGPVHHKLVVGSYKKDTYQIFINEITVKLNGTGYRLIHDNASIHGGAISLNNAIEHLPPYSPFLNLIESVFSKIKFNIRKSISRAGGFSSMNFQSRFDFLKDALDNEL 409          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000069530.1 (SMESG000069530.1)

HSP 1 Score: 308.145 bits (788), Expect = 2.511e-103
Identity = 147/248 (59.27%), Postives = 182/248 (73.39%), Query Frame = 1
Query:  580 MRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGFILVHDNVPIHGENFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLSSIQGFSSMNINSRFTILSDIIVNEIKKEDYSNLENFYRHIRKFFPKSLLKEEIYGD 1323
            M+ +L  +   +S  TISR L  HLIT K++RP VA+RNS+ VL+LR  Y  R LEE W D++LIY+DEC FNTWT++ +GR KKGERLYA +PT  G N+ L LAIGV GP+HHKL++GS  K++YQ FINE T KL GTGF L+HDN  IHG   S NN++  LPPYSPFLNPIESVFSKIK N+RKS+S   G SSMN  SRF  L D + NE+ KEDY +L N++ HIR+FFPK + K  I+GD
Sbjct:    1 MKNFLISENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDLRMEYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAIGVNGPVHHKLVVGSYKKDTYQVFINEITVKLNGTGFRLIHDNASIHGGAISLNNVIEHLPPYSPFLNPIESVFSKIKFNIRKSISRAGGLSSMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFGD 248          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000050992.1 (SMESG000050992.1)

HSP 1 Score: 258.84 bits (660), Expect = 2.545e-76
Identity = 121/223 (54.26%), Postives = 165/223 (73.99%), Query Frame = 1
Query:  340 ISQTDKIRLVQALENGQDFFLLGRQMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNYWCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVLELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVPTVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGF 1008
            IS+ DKIR++ A+ENG+D+F  G+ +GI RN++K++IYKY K G +S GKIGG K K+ E+   KLL +VE+N + +LE+M+ +L  +   +S  TISR L  HLIT K++RP VA+RNS+ VL+LR  Y  R LEE W D++LIY+DEC FN WT++ +GR KKGERLY+ +PT  G N+ L LAIGV G +HHKL++GS  K++YQ FINE T KL GTG+
Sbjct:  965 ISEIDKIRIINAMENGEDYFHFGKLLGIFRNSIKTLIYKYRKFGKLSQGKIGGSKSKISEDYGNKLLDFVEKNVYASLEEMKNFLIFENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDLRMKYTTRYLEEAWMDSQLIYIDECGFNIWTSQKLGRNKKGERLYSTLPTNRGRNMSLALAIGVNGSVHHKLIVGSYKKDTYQIFINEITVKLNGTGY 1187          
The following BLAST results are available for this feature:
BLAST of DDE_3 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU929414.12.669e-1024.31pep chromosome:GRCz11:24:15670013:15671038:1 gene:... [more]
CT990567.13.314e-1023.96pep chromosome:GRCz11:4:61995745:61997189:1 gene:E... [more]
CR855320.28.316e-1023.96pep chromosome:GRCz11:1:7988052:7989314:1 gene:ENS... [more]
BX897685.11.203e-923.96pep chromosome:GRCz11:3:36170943:36171968:-1 gene:... [more]
si:dkey-77f5.31.735e-626.11si:dkey-77f5.3 [Source:ZFIN;Acc:ZDB-GENE-030131-51... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000051187.17.676e-1124.00pep primary_assembly:Xenopus_tropicalis_v9.1:7:681... [more]
dnm21.916e-1024.48dynamin 2 [Source:Xenbase;Acc:XB-GENE-959257][more]
ENSXETT00000001260.14.210e-1023.45glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
cnih37.578e-1024.47cornichon family AMPA receptor auxiliary protein 3... [more]
ENSXETT00000022225.18.735e-1023.43pep primary_assembly:Xenopus_tropicalis_v9.1:1:916... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DQJ82.074e-3729.34DDE_3 domain-containing protein OS=Macrostomum lig... [more]
W4XP442.245e-3529.01DDE_3 domain-containing protein OS=Strongylocentro... [more]
A0A1I8GL131.099e-3434.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0C2JI121.326e-3329.12DDE_3 domain-containing protein OS=Thelohanellus k... [more]
W4Z6F72.280e-3329.30DDE_3 domain-containing protein OS=Strongylocentro... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035600.12.960e-1326.22pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035367.13.587e-1326.22pep primary_assembly:Astyanax_mexicanus-2.0:2:1149... [more]
ENSAMXT00000048019.17.052e-1325.87pep primary_assembly:Astyanax_mexicanus-2.0:20:179... [more]
ENSAMXT00000056445.18.270e-1326.22pep primary_assembly:Astyanax_mexicanus-2.0:1:1450... [more]
ENSAMXT00000051384.11.033e-1225.87pep primary_assembly:Astyanax_mexicanus-2.0:2:1870... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000020393.21.828e-823.18pep primary_assembly:ASM223467v1:14:19460905:19462... [more]
ENSORLT00000000705.21.191e-723.00pep primary_assembly:ASM223467v1:6:9076892:9077941... [more]
ENSORLT00000032070.12.689e-721.80pep primary_assembly:ASM223467v1:23:23735603:23736... [more]
ENSORLT00000016717.22.203e-621.63pep primary_assembly:ASM223467v1:18:7175091:717623... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041908.11.972e-12357.19SMESG000041908.1[more]
SMESG000005064.14.193e-12055.49SMESG000005064.1[more]
SMESG000005064.11.958e-11055.02SMESG000005064.1[more]
SMESG000069530.12.511e-10359.27SMESG000069530.1[more]
SMESG000050992.12.545e-7654.26SMESG000050992.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003554 ID=SMED30003554|Name=DDE_3 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1326bp
TCATAAATGACATTTTTAGATATAAATGACTAGATTTTCTCAGATGAAAT
GCCAATGAATAACATACGGTTTCCATTATCAATATAGCGAACGCATCTAT
AAGAATTAATATTAATTAATGAACACGCAGATGTAGACAATCAATAGCGT
CAGAGATTAGAGAACACACAAACACGATATACACACATACACAATGCGCG
AAATATTTCATTGGAAAACATTAATTTTAAATTCTGAAACATTCTCCCTA
TAATATTTATAATGGAAAATTGTGAAAACGTTTCCGATGATGGGAGTGAT
AAAACGGTGCCTTCAAAAGTTAAACTAAATAGGAACACAATATCACAAAC
AGATAAAATAAGACTTGTTCAGGCACTGGAAAATGGGCAAGACTTTTTTT
TATTGGGAAGACAAATGGGAATCACGCGTAATACAGTCAAAAGTATAATT
TATAAATACAATAAAACTGGGGCAATATCTTTTGGTAAAATAGGAGGCAA
AAAGCCAAAGCTTCCAGAAGAAATGGTTCAAAAGTTACTAACTTATGTTG
AACAAAATTACTGGTGTACTTTAGAAGATATGCGAAAGTATTTAGATGAT
CAAGGATTCCATATTTCAAAAGTTACTATTTCACGATGTCTAAAAAAGCA
TCTCATCACTTTCAAAAAAGTTCGACCATGTGTAGCAGATCGAAATTCTG
AAAGTGTTTTAGAACTTCGTAAAACATATGTTCGTCGGTTGTTGGAAGAA
GAGTGGAATGACAATAAACTAATTTACATGGACGAATGTTATTTCAATAC
TTGGACCAATAAAACTATGGGCAGATGTAAAAAAGGAGAAAGACTATACG
CGAAGGTTCCAACGGTTGCCGGTCCCAATATATGTCTTGTCCTTGCTATA
GGAGTAACCGGCCCAATTCATCACAAATTGCTAATTGGGTCTTTGGATAA
AGAAAGTTATCAAGCTTTTATCAATGAAACAACCGAAAAATTGCGCGGAA
CCGGCTTTATCCTCGTCCATGATAATGTTCCAATTCACGGAGAAAATTTT
TCTACAAATAACCTAGTGGTAAAACTGCCCCCTTATAGTCCATTTCTCAA
TCCGATTGAGAGTGTATTCAGTAAAATCAAAGGAAATGTCAGAAAATCTT
TGTCTAGTATCCAAGGATTCAGTTCCATGAATATTAATAGTCGATTTACG
ATTCTCAGTGATATTATTGTCAATGAAATAAAGAAAGAAGATTATTCTAA
TTTGGAAAATTTTTATAGGCACATACGAAAATTTTTTCCGAAATCTCTTT
TGAAGGAAGAAATTTATGGAGATTAA
back to top

protein sequence of SMED30003554-orf-1

>SMED30003554-orf-1 ID=SMED30003554-orf-1|Name=SMED30003554-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MENCENVSDDGSDKTVPSKVKLNRNTISQTDKIRLVQALENGQDFFLLGR
QMGITRNTVKSIIYKYNKTGAISFGKIGGKKPKLPEEMVQKLLTYVEQNY
WCTLEDMRKYLDDQGFHISKVTISRCLKKHLITFKKVRPCVADRNSESVL
ELRKTYVRRLLEEEWNDNKLIYMDECYFNTWTNKTMGRCKKGERLYAKVP
TVAGPNICLVLAIGVTGPIHHKLLIGSLDKESYQAFINETTEKLRGTGFI
LVHDNVPIHGENFSTNNLVVKLPPYSPFLNPIESVFSKIKGNVRKSLSSI
QGFSSMNINSRFTILSDIIVNEIKKEDYSNLENFYRHIRKFFPKSLLKEE
IYGD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001523Paired_dom
IPR009057Homeobox-like_sf
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding