Glutamate receptor ionotropic, NMDA 3A

Overview
NameGlutamate receptor ionotropic, NMDA 3A
Smed IDSMED30003545
Length (bp)3188
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor ionotropic, NMDA 3A (SMED30003545) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 3A (SMED30003545) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor ionotropic, NMDA 3A (SMED30003545) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 3A (SMED30003545) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003545

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003545h1SMcG0008385 SmedASXL_015696SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30003545h1SMcG0008385 SmedASXL_015695SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30003545h1SMcG0008385 dd_Smed_v4_5950_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003545h1SMcG0008385 dd_Smed_v4_5950_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003545h1SMcG0008385 dd_Smed_v4_5950_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30003545h1SMcG0008385 dd_Smed_v4_5950_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003545h1SMcG0008385 dd_Smed_v6_5950_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:HGNC Symbol;Acc:HGNC:16767])

HSP 1 Score: 221.861 bits (564), Expect = 1.020e-58
Identity = 174/685 (25.40%), Postives = 306/685 (44.67%), Query Frame = 1
Query:  772 VKKIFQINHKYSFINNEMIIILSDMT---------LPNKL--------DIINHTLNSLNILYIERMHKSTAIDVVNHYSDVIMNIINVYSVNCISKDI--RQCKRKLYRNLSNLFSVNGEYKFNNASLFKLY--RQGSLKK--WDECNQY-NGKQVIEKGLLCQNS-----FFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYL---CQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHS 2685
            +++IF+I  ++  +  E+  +L D           LP  L         +  H +     L    +  +T I          MN + V + N  S     R      +R LS    V G    ++ + F ++  +   + K  W     +  GK V++ G+  + +      F +       +V ++   PF+        F     +   C    +C D   ND    D +++ ++    ++N +    F +CCYG+ I +L+K+A D+ +D   YIV +  YG++ N  W G+V +++ G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   + AV + ++EW SPFGL+P GR R K ++ +SALN  YA++FG T+  K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S+    + Q+  ++ +  +RY  P     V YL +  +  + F       I+D++L+   +      C+L T        GYG G   +S +   I   +  Y   GF D+L     D  Y    C K     S   T+     I++  GLFV L +G  ++ L    EH++Y  ++PR  N  K   W     +  SQRL+R +++
Sbjct:  335 IRRIFEITTQFGVMPPELRWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCMEVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLI-EHPFV--------FTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSSLH----SSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAF-------IMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLH----DKWYRVVPCGK----RSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYW-----LHTSQRLHRAINT 985          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3B (glutamate ionotropic receptor NMDA type subunit 3B [Source:HGNC Symbol;Acc:HGNC:16768])

HSP 1 Score: 180.644 bits (457), Expect = 1.205e-45
Identity = 124/456 (27.19%), Postives = 206/456 (45.18%), Query Frame = 1
Query: 1288 FINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
            F     E   C    +C D   ND    D            N S  R   +CCYG+ I +L++LA D  +D   Y+V +  YG+  +  W G+V +++ G AH+   +FSI   R++V+D + PF+++ + I+   +D  S +G    P     WL +     + A+ + ++EW SP+GL+P GR R   ++ +SALN  YA++F  T+ +K PK    + + N WA  C+++ + YTANL   + G      ++ + +          + G + +S+    I ++  D+    +R+  P     V  L S       F       I+D+SL+   +      C+L T        GYG G  ++S + + +   +  Y   GF DLL     D  Y     K++    +    T+     I +  GLFV L +GL  A L    EH  +   +PR
Sbjct:  429 FARDPDEDGQCPAGQLCLDPGTNDSATLDAL-----FAALANGSAPRALRKCCYGYCIDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAF-------IMDKSLLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLH----DKWY-----KMVPCGKRVFAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPR 862          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2B (glutamate ionotropic receptor NMDA type subunit 2B [Source:HGNC Symbol;Acc:HGNC:4586])

HSP 1 Score: 133.65 bits (335), Expect = 7.549e-31
Identity = 98/404 (24.26%), Postives = 195/404 (48.27%), Query Frame = 1
Query: 1438 RCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFG----LSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSN----TNSELNVGNT-----QIGIIKDSNIIQTLIDLDDKRYPVV-KWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLC--QKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYW 2586
            +CC GF I IL+K++  +K+    Y+V+N  +G  IN  WNGM+  ++   A++  G+ +I  +R++V+D S PF  + I ++    +         +PF+ ++W+ +  ++  V AVA+ +FE+ SP G    L+        ++T+  A+  ++ ++F +++  + PK    K + + WAF  ++  A YTANL  F+    ++      ++ +    N      + G + + +  + + +   + +  + K+N R +D   DA        LD  + ++ V+  +  +   C+L   T+  G +    GYG    KDS  K ++   L I   FG  ++ E        +C  +K++++SS          I+N+ G+F  L   + ++ +    EH+ YW
Sbjct:  455 KCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVD---DALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKL--VTIGSGKVFASTGYGIAIQKDSGWKRQVD--LAILQLFGDGEMEELEALWLTGICHNEKNEVMSSQ-------LDIDNMAGVFYMLGAAMALSLITFICEHLFYW 844          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 133.265 bits (334), Expect = 8.609e-31
Identity = 101/414 (24.40%), Postives = 195/414 (47.10%), Query Frame = 1
Query: 1405 NTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFGLS---PWGRMRH-KNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF------IAGVAHLSNTNSELNVGNT---QIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT--LDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYW 2586
            N + ++  N  +CC GF I IL+KL+  +K+    Y+V+N  +G  +NN WNGM+  ++   A +  G+ +I  +R++V+D S PF  + I ++    +         +PF+  +W+ +  ++  V A+A+ +FE+ SP G +     G+  H  ++T+  A+  ++ ++F +++  + PK    K + + WAF  ++  A YTANL  F      +  V  LS+   +     +   + G + + +  + + +     YP +   +   +     + L   KT  LD  + ++ V+     +   C+L   T+  G I    GYG    K S  K +I   L  +   G  + LE          +K++++SS          I+N+ G+F  L+  + ++ +    EH+ YW
Sbjct:  306 NNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRN----NYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKL--VTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQ-------LDIDNMAGVFYMLAAAMALSLITFIWEHLFYW 706          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 132.109 bits (331), Expect = 1.963e-30
Identity = 101/414 (24.40%), Postives = 195/414 (47.10%), Query Frame = 1
Query: 1405 NTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFGLS---PWGRMRH-KNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF------IAGVAHLSNTNSELNVGNT---QIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT--LDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYW 2586
            N + ++  N  +CC GF I IL+KL+  +K+    Y+V+N  +G  +NN WNGM+  ++   A +  G+ +I  +R++V+D S PF  + I ++    +         +PF+  +W+ +  ++  V A+A+ +FE+ SP G +     G+  H  ++T+  A+  ++ ++F +++  + PK    K + + WAF  ++  A YTANL  F      +  V  LS+   +     +   + G + + +  + + +     YP +   +   +     + L   KT  LD  + ++ V+     +   C+L   T+  G I    GYG    K S  K +I   L  +   G  + LE          +K++++SS          I+N+ G+F  L+  + ++ +    EH+ YW
Sbjct:  443 NNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRN----NYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKL--VTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQ-------LDIDNMAGVFYMLAAAMALSLITFIWEHLFYW 843          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 140.969 bits (354), Expect = 1.124e-33
Identity = 120/464 (25.86%), Postives = 204/464 (43.97%), Query Frame = 1
Query: 1228 VLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELW---LFICIIATVCAVAMGIFEWNSP--FGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAH---LSNTNSE-LNVGNTQ-----IGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHM 2577
            V V  +   PFI +        +++ +T  C         P N G   D +  + +      + K+R  ++CC G+ + +L KLA D+ +  T Y V +  +G    N WNG++ ++M   A +   +  +  +R + ID S PF  + I I+  I+          +PF    W   LF+CI   V A+++ +FEW SP  F +  +    HK ++L  +   V+A +F  ++ T  PKS   + +   WA   +   A+YTANL  F+        LS  +   LN  + Q      G +   N  +T+     K +  VK N  +  +     E   N+ LD  + +++V+     K + C L T        GYG GF K+S   + +   +  Y   G  + L+      N+    +    S ++T      IEN +  FV L+ G+IV+ ++L  EH+
Sbjct:  463 VKVVTLHEPPFIAVS-------DVDPDTQKC---------PGNQGSICD-WGDV-EYTDGAGVKKNRTLLKCCSGYCVDLLNKLANDIGFTYTLYKVRDEKWGLKTENGWNGLIADLMHNKADMCVTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCI--HVAAISIFLFEWVSPYSFNMQKYPPPEHK-FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVLDYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHTSLVNHYMLQYQQKGDLERLQ------NFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHI 899          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 97.4413 bits (241), Expect = 5.232e-21
Identity = 93/349 (26.65%), Postives = 154/349 (44.13%), Query Frame = 1
Query: 1579 MDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLG--VVYKPFTLELW---LFICIIATVCAVAMGIFEWNSP--FGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAH---LSNTNSE-LNVGNTQ-----IGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHM 2577
            M   A +   +  +  +R + ID S PF  + I I+  +K R  +L      +PF    W   LF+CI   V A+++ +FEW SP  F +  +    HK ++L  +   V+A +F  ++ T  PKS   + +   WA   +   A+YTANL  F+        LS  +   LN  + Q      G +   N  +T+     K +  VK N  +  +     E   N+ LD  + +++V+     K + C L T        GYG GF K+S   + +   +  Y   G  + L+      N+    +    S ++T      IEN +  FV L+ G+IV+ ++L  EH+
Sbjct:    1 MHNKADMCVTSLKLNSERARDIDFSLPFLDTGISII--VKIRSGVLSPTAFLEPFEYSTWVIILFVCI--HVAAISIFLFEWVSPYSFNMQKYPPPEHK-FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVLDYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHTSLVNHYMLQYQQKGDLERLQ------NFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHI 338          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 98.5969 bits (244), Expect = 1.246e-20
Identity = 94/413 (22.76%), Postives = 171/413 (41.40%), Query Frame = 1
Query: 1441 CCYGFSITILQKLAM-----DLKYDLTYYIVSNSSYGSFINNEWNGM----VRNIMDG-IAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPF----------------GLSPW-GRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIA------GVAHLSNTNSELNVGNTQIGIIKDSNIIQTL---IDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLE 2571
            CC G +I +L  L++      +    T+ +  N SYG    +E  G+    V   +DG  A +  G  +I  +R +++D ++P+    I IL     RDS +    +P    LW  + I   +  +A+   ++ SPF                    W G+   +N     A+  V+ V+    +  K P+S   + +   W   C+++ A YTANL  F+       G+  +++        N   G + +SN+ Q     ++L      +   NVR    + +A    LN +LD  + +S  +    A+   C L TR    G   YG G  K+S     I S +   S+ G  + L++   D       + ++ +     + G  + N+  +F+ +S G+ +   + F+E
Sbjct:  456 CCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGVVQASETTGITISGVIGELDGDTADMAIGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSANFSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVR---RASEAVHSLLNGSLDAFIWDSTRLEFEAARH--CELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMSESGVMEKLDQKWIDRG---GPNCVVEAHKSPARLG--LVNMKDIFILVSSGVALGIFLSFVE 858          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 98.5969 bits (244), Expect = 1.246e-20
Identity = 94/413 (22.76%), Postives = 171/413 (41.40%), Query Frame = 1
Query: 1441 CCYGFSITILQKLAM-----DLKYDLTYYIVSNSSYGSFINNEWNGM----VRNIMDG-IAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPF----------------GLSPW-GRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIA------GVAHLSNTNSELNVGNTQIGIIKDSNIIQTL---IDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLE 2571
            CC G +I +L  L++      +    T+ +  N SYG    +E  G+    V   +DG  A +  G  +I  +R +++D ++P+    I IL     RDS +    +P    LW  + I   +  +A+   ++ SPF                    W G+   +N     A+  V+ V+    +  K P+S   + +   W   C+++ A YTANL  F+       G+  +++        N   G + +SN+ Q     ++L      +   NVR    + +A    LN +LD  + +S  +    A+   C L TR    G   YG G  K+S     I S +   S+ G  + L++   D       + ++ +     + G  + N+  +F+ +S G+ +   + F+E
Sbjct:  456 CCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGVVQASETTGITISGVIGELDGDTADMAIGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSANFSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVR---RASEAVHSLLNGSLDAFIWDSTRLEFEAARH--CELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMSESGVMEKLDQKWIDRG---GPNCVVEAHKSPARLG--LVNMKDIFILVSSGVALGIFLSFVE 858          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: glr-6 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q8MXV8])

HSP 1 Score: 79.337 bits (194), Expect = 1.047e-14
Identity = 98/397 (24.69%), Postives = 168/397 (42.32%), Query Frame = 1
Query: 1450 GFSITILQKLAMDLKYDLTYYIVSNSSYGSFIN--NEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSM---IKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNT---QIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LDIILDESLVIRNLKAKGSL-------CRLHTRTLNI--GPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKS-ISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEH 2574
            GF + +L KLA  L ++ T  IV ++ YG   N  +EW+GM+  I+ G A +     ++T  R +VID +DPF    I +L      K   SL   ++ P +  +W F  I   + A+ + +    SP   +   ++++  + L   L    +   G+  +  A +     W    W+F  ++I A YTAN    +         NS   +GN      G I   + +Q        +Y  ++   R  +  + AE      T    ++ +L+E  V   L    +L       C L TR  N+  G  GY     K S  + ++  ++   ++ G   +L+ +    S   CQ     SS+ +  +     EN+ GLF+ L++G  +  L   LEH
Sbjct:  436 GFCVDLLDKLAEMLHFNYTLKIVKDNKYGERKNGTDEWDGMIGEILRGDADMAVAPITVTATRLEVIDFTDPFLQLGISMLMRQPNPKSSSSLTRFLW-PLSASVWTFSAIATVITALLVTVAAVLSPKESTAEFKIQNSVWYLVCILLRAGS---GYNCQAGATRLISAVW----WSFTLVLI-AQYTANFAALLTVDRKSMPFNSFEELGNQTEYNFGSILGGSTMQFF------KYSRIETFRRLWERMQSAEPSAFVGTNHEGVNRVLNEKYVF--LMESATLDYQVTQNCNL-TRVGNVVLGSNGYSIALPKGSKWREKLTRQILDLNEKGIILMLKNNWWKKSQQECQ-----SSEPEDLQTALGAENVYGLFLLLALGSGIGVLCAVLEH 809          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091453)

HSP 1 Score: 112.464 bits (280), Expect = 7.457e-25
Identity = 98/392 (25.00%), Postives = 176/392 (44.90%), Query Frame = 1
Query: 1243 VPTEPFIKIDVTSKA-FINIESETPDCG-----HNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLG--VVYKPFTLELWLFICIIATVCAVAM-GIFEWNSPFGLSPWGRMRHKN-----YTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFI---------AGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLD--SSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDS 2343
            VP +  +KI    +A +IN+    P  G       V+C    +++    DI   + Q  +N       +F +CC GF I +L+K A +L +      V +  +G+  N +WNG++ ++++    +   +  I  +R  V+D S+PF  + I I+  +  R  ++      +PF    W+ + I+A   A  M  +FEW SP G      +++ N     ++L      V+AV+F   +   +P+ +  +++ N WA   +V  A+YTANL  F+         +G+      +   +  + + G I  S+   T+     K + V+   +R  +  S  D     LN  LD  + +  V+  L A+   CRL T        GYG  F+++S
Sbjct:  318 VPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRVAADHEMAA-DI--DVGQAHRN------ESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIV--VAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTI----HKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNS 694          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301842)

HSP 1 Score: 112.464 bits (280), Expect = 7.457e-25
Identity = 98/392 (25.00%), Postives = 176/392 (44.90%), Query Frame = 1
Query: 1243 VPTEPFIKIDVTSKA-FINIESETPDCG-----HNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLG--VVYKPFTLELWLFICIIATVCAVAM-GIFEWNSPFGLSPWGRMRHKN-----YTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFI---------AGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLD--SSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDS 2343
            VP +  +KI    +A +IN+    P  G       V+C    +++    DI   + Q  +N       +F +CC GF I +L+K A +L +      V +  +G+  N +WNG++ ++++    +   +  I  +R  V+D S+PF  + I I+  +  R  ++      +PF    W+ + I+A   A  M  +FEW SP G      +++ N     ++L      V+AV+F   +   +P+ +  +++ N WA   +V  A+YTANL  F+         +G+      +   +  + + G I  S+   T+     K + V+   +R  +  S  D     LN  LD  + +  V+  L A+   CRL T        GYG  F+++S
Sbjct:  318 VPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRVAADHEMAA-DI--DVGQAHRN------ESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIV--VAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTI----HKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNS 694          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091454)

HSP 1 Score: 112.464 bits (280), Expect = 7.457e-25
Identity = 98/392 (25.00%), Postives = 176/392 (44.90%), Query Frame = 1
Query: 1243 VPTEPFIKIDVTSKA-FINIESETPDCG-----HNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLG--VVYKPFTLELWLFICIIATVCAVAM-GIFEWNSPFGLSPWGRMRHKN-----YTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFI---------AGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLD--SSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDS 2343
            VP +  +KI    +A +IN+    P  G       V+C    +++    DI   + Q  +N       +F +CC GF I +L+K A +L +      V +  +G+  N +WNG++ ++++    +   +  I  +R  V+D S+PF  + I I+  +  R  ++      +PF    W+ + I+A   A  M  +FEW SP G      +++ N     ++L      V+AV+F   +   +P+ +  +++ N WA   +V  A+YTANL  F+         +G+      +   +  + + G I  S+   T+     K + V+   +R  +  S  D     LN  LD  + +  V+  L A+   CRL T        GYG  F+++S
Sbjct:  318 VPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRVAADHEMAA-DI--DVGQAHRN------ESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIV--VAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTI----HKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNS 694          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301843)

HSP 1 Score: 112.464 bits (280), Expect = 8.090e-25
Identity = 98/392 (25.00%), Postives = 176/392 (44.90%), Query Frame = 1
Query: 1243 VPTEPFIKIDVTSKA-FINIESETPDCG-----HNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLG--VVYKPFTLELWLFICIIATVCAVAM-GIFEWNSPFGLSPWGRMRHKN-----YTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFI---------AGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLD--SSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDS 2343
            VP +  +KI    +A +IN+    P  G       V+C    +++    DI   + Q  +N       +F +CC GF I +L+K A +L +      V +  +G+  N +WNG++ ++++    +   +  I  +R  V+D S+PF  + I I+  +  R  ++      +PF    W+ + I+A   A  M  +FEW SP G      +++ N     ++L      V+AV+F   +   +P+ +  +++ N WA   +V  A+YTANL  F+         +G+      +   +  + + G I  S+   T+     K + V+   +R  +  S  D     LN  LD  + +  V+  L A+   CRL T        GYG  F+++S
Sbjct:  357 VPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRVAADHEMAA-DI--DVGQAHRN------ESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIV--VAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTI----HKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNS 733          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0339592)

HSP 1 Score: 112.464 bits (280), Expect = 1.093e-24
Identity = 102/416 (24.52%), Postives = 183/416 (43.99%), Query Frame = 1
Query: 1243 VPTEPFIKIDVTSKA-FINIESETPDCG-----HNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLG--VVYKPFTLELWLFICIIATVCAVAM-GIFEWNSPFGLSPWGRMRHKN-----YTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFI---------AGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLD--SSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEK 2415
            VP +  +KI    +A +IN+    P  G       V+C    +++    DI   + Q  +N       +F +CC GF I +L+K A +L +      V +  +G+  N +WNG++ ++++    +   +  I  +R  V+D S+PF  + I I+  +  R  ++      +PF    W+ + I+A   A  M  +FEW SP G      +++ N     ++L      V+AV+F   +   +P+ +  +++ N WA   +V  A+YTANL  F+         +G+      +   +  + + G I  S+   T+     K + V+   +R  +  S  D     LN  LD  + +  V+  L A+   CRL T        GYG  F+++S        RL  +   G  + L +
Sbjct:  499 VPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRVAADHEMAA-DI--DVGQAHRN------ESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIV--VAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTI----HKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRR 899          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 210.305 bits (534), Expect = 1.869e-55
Identity = 136/486 (27.98%), Postives = 240/486 (49.38%), Query Frame = 1
Query: 1306 ETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHS--ERLIRPKETTKEMIEIVK 2739
            E  +C     C D   N  +  D + +  + Q N +     ++ +CCYG+ I +L+KL+ D+ ++   YIV +  YG+    +W G+V +++ G+A +   +FSI   R+KVID + PF+++ + IL   KD  + +G    P    +W+ I +   + A+ + ++EW SPFG++P GR R K ++ +SALN  YA++FG T+ +K PK W  +++ N WA  C+++ + YTANL   + G       +   +    + G +++S+      D   K +P +   +R  +     + +   KT    LD  I+D++L+   +      C+L T        GYG G  ++S + + I   +  Y   G+ D+L     D  Y +    K + +  +T + G  I +  GLFV L VG+  A L L  EH  Y  ++P      K   W     +  SQ+++R ++   E + R +  T++   I K
Sbjct:  322 EDGNCPAGQYCLDAGTNSSETLD-HLYAERAQGNKSFLPP-DYSKCCYGYCIDLLEKLSEDMNFEFDLYIVGDGKYGAVKGGQWTGLVGDLLSGVADMAVTSFSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKGFRFGTVRESSA----EDYMKKSFPEMHEYMRKFNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFVSRYKSDGYMDMLH----DKWYKVVPCGKRVFAVTETLQMG--IRHFSGLFVLLCVGVTGALLTLAGEHAFYRLVLPHIRRKQKFKYW-----LHTSQKIHRALNMTYEDVKRQRANTEKSCNIQK 789          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 209.534 bits (532), Expect = 6.672e-55
Identity = 127/470 (27.02%), Postives = 234/470 (49.79%), Query Frame = 1
Query: 1306 ETPDCGHNVVCYDLPENDGKYFDIYNHI-NQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNS--ELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIV 2679
            E   C    +C D   N+    ++ N +  +L++  + S   +  +CCYG+ I +L+KLA D+ ++   YIV +  YG++    W+G+V +++ G+A +   +FSI   R++VID + PF+++ + IL   KD  + +G    P    +W+ I +   + A+ + ++EWNSPFG++P GR R + ++ +SALN  YA++FG T+ +K PK W  +++ N WA  C+++ + YTANL   + G       +   ++ + +  +G    +    +  D   K +P +   +R  +     + +   KT    LD  I+D++L+   +      C+L T        GYG G  ++S +   +   +  Y   G+ D+L     D  Y     K++    +    T+     I++  GLFV L VG+  A L L  EH  + +I+P   +  +   W     +  SQ+++R +
Sbjct:  514 EEGQCPAGQLCLDPQTNNS---EVLNQLFRELEQTNSSSLPTDMRKCCYGYCIDLLEKLAEDMHFEFDLYIVGDGKYGAWKGGRWSGLVGDLLSGVADMAVTSFSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFITLYEWNSPFGMTPHGRNRIRVFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDVKLHHPSLGFRFGTVRESSAEDYVKKSFPEMHEYMRRFNKPTTPDGVSTLKTDPPQLDAFIMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTRNVSEYVSRYKSDGYMDMLH----DKWY-----KVVPCGKRVFAVTETLQMGIQHFSGLFVLLCVGVAGALLTLLGEHAFFRFILPHLRHQQRFKYW-----LHTSQKIHRAI 965          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 204.912 bits (520), Expect = 3.036e-54
Identity = 132/470 (28.09%), Postives = 232/470 (49.36%), Query Frame = 1
Query: 1306 ETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIV 2679
            E  +C     C D   N  +  D + +  + Q N +     ++ +CCYG+ I +L+KL+ D+ ++   YIV +  YG+    +W G+V +++ G+A +   +FSI   R+KVID + PF+++ + IL   KD  + +G    P    +W+ I +   + A+ + ++EW SPFG++P GR R K ++ +SALN  YA++FG T+ +K PK W  +++ N WA  C+++ + YTANL   + G      V+ + +          + G +++S+      D   K +P +   +R  +     + +   KT    LD  I+D++L+   +      C+L T        GYG G  ++S + + I   +  Y   G+ D+L     D  Y +    K + +  +T + G  I +  GLFV L VG+  A L L  EH  Y  ++P      K   W     +  SQ+++R +
Sbjct:  320 EDGNCPAGQYCLDAGTNSSETLD-HLYAERAQGNKSFLPP-DYSKCCYGYCIDLLEKLSEDMNFEFDLYIVGDGKYGAVKGGQWTGLVGDLLSGVADMAVTSFSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKLHHPSQGFRFGTVRESSA----EDYMKKSFPEMHEYMRKFNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFVSRYKSDGYMDMLH----DKWYKVVPCGKRVFAVTETLQMG--IRHFSGLFVLLCVGVTGALLTLAGEHAFYRLVLPHIRRKQKFKYW-----LHTSQKIHRAL 771          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 203.371 bits (516), Expect = 5.043e-53
Identity = 129/464 (27.80%), Postives = 218/464 (46.98%), Query Frame = 1
Query: 1318 CGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIV 2679
            C    +C D   ND    +    + Q  +  N +    F +CCYG+ I +L+KLA D+ +D   YIV +  YG++ N  W G+V ++M G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   V AV + ++EW SPFG++P GR R + ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S    +  D   K +P +   +R  ++    +       +D + D+    + L A                    F   K+S + + I   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L VG+ ++ L    EH+++ W+IPR     +   W     +  SQRL+R +
Sbjct:  539 CPAGQLCLDPLTNDTALLE---SLFQGLQGANDTVPLEFKKCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRES----SAEDYVKKSFPEMHEYMRRYNAPTTPD------GIDHLKDDP---QKLDA--------------------FIMDKNSPLTSNISELVSQYKSDGFMDMLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLGEHIVHRWVIPRMQESTEHKYW-----LHTSQRLHRAL 952          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 202.986 bits (515), Expect = 6.614e-53
Identity = 129/464 (27.80%), Postives = 218/464 (46.98%), Query Frame = 1
Query: 1318 CGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIV 2679
            C    +C D   ND    +    + Q  +  N +    F +CCYG+ I +L+KLA D+ +D   YIV +  YG++ N  W G+V ++M G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   V AV + ++EW SPFG++P GR R + ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S    +  D   K +P +   +R  ++    +       +D + D+    + L A                    F   K+S + + I   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L VG+ ++ L    EH+++ W+IPR     +   W     +  SQRL+R +
Sbjct:  549 CPAGQLCLDPLTNDTALLE---SLFQGLQGANDTVPLEFKKCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRES----SAEDYVKKSFPEMHEYMRRYNAPTTPD------GIDHLKDDP---QKLDA--------------------FIMDKNSPLTSNISELVSQYKSDGFMDMLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLGEHIVHRWVIPRMQESTEHKYW-----LHTSQRLHRAL 962          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: nup155 (nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973827])

HSP 1 Score: 218.394 bits (555), Expect = 1.372e-57
Identity = 138/474 (29.11%), Postives = 232/474 (48.95%), Query Frame = 1
Query: 1318 CGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHS 2685
            C    +C D   ND K  D  +    LQ   N S    F +CCYG+ I +L+KLA D+ +D   YIV +  YG++ N  W G+V +++ G AH+   +FSI   R++VID + PF+++ + IL   KD  + +G    P    +WL I +   + A+ + ++EW SPFGL+P GR R K ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S+    + ++  ++ +  +RY  P     V +L +  +A + F       I+D++L+   +      C+L T        GYG G   +S + + I   +  Y   GF D    S+ D  Y     K++    +    T+     I +  GLFV L +G  ++ L    EH+++  ++PR     K   W     +  SQRL+R +++
Sbjct:  549 CPAGQLCLDPMTNDSKVLD--SLFESLQGG-NDSVPIEFKKCCYGYCIDLLEKLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGAAHLAVTSFSINTARSQVIDFTSPFFSTSLGILVRTKDTAAPIGAFMWPLHWTMWLGIFVSLHITAIFLTLYEWKSPFGLTPNGRNRSKVFSFSSALNVCYAILFGRTAAIKTPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPSTSEGVTFLKNDPEALDAF-------IMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPPNSPLTSNISELVSQYKSSGFMD----SLHDKWY-----KVVPCGKRSFAVTETLQMGITHFSGLFVMLCIGFGLSILTTIGEHIVFRLVLPRIKKKSKLKYW-----LHTSQRLHRALNT 997          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN3B (glutamate receptor, ionotropic, N-methyl-D-aspartate 3B [Source:NCBI gene;Acc:100497172])

HSP 1 Score: 199.134 bits (505), Expect = 1.438e-51
Identity = 138/497 (27.77%), Postives = 237/497 (47.69%), Query Frame = 1
Query: 1153 NGKQVIEKGL----LCQNSFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDI-YNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVR--YLDSSKDAEELFLNKTLD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIP 2598
             GK  +E+GL    + Q       +   K+ V  +   PF+        F         C    +C D   N+    D+ +  +N    + N S    +  CCYG+ I +L+KL+ DL++D   YIV +  YG+   + W G+V +++ G AH+   +FSI   R+ VID + PFY++ + IL  ++D  S +G    P    +W+ I +   + A+ +  +EW SPFG++P GR R K ++ +SALN  YA++FG T+ +K PK    + + N WA  C+++ + YTANL   + G      ++ + +          + G + +S+  Q +     K +P +   +R   + ++ D   L    TL+  I+D++L+   +    S C+L T        GYG G  ++S + + I   +  Y   GF D L     D  Y +    K + +  +T + G  I +  GLFV L +G   + L   +E ++Y  I+P
Sbjct:  392 QGKMEVEEGLWQSRIQQWEPAPGGFARTKLRVVTLVEHPFV--------FTREVDADGSCPAGQMCLDPRTNNSAVLDVLFEELN----SPNGSVPLEYKTCCYGYCIDLLEKLSEDLRFDFELYIVGDGKYGARKGDRWTGLVGDLLSGAAHMAVTSFSINSARSTVIDFTSPFYSTSLGILVRMRDTASPIGAFMWPLHWSMWVGIFVALHITALFLTFYEWKSPFGMTPHGRNRTKIFSYSSALNLCYAILFGRTVSSKTPKCCTGRVLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEALSGIHDPKLHHPSQGFRFGTVWESSAEQYI----KKSFPEMHNYMRKFSVPATSDGVHLTDPPTLNAFIMDKALLDYEVSID-SDCKLLTIGKPFAIEGYGIGLPQNSPLTSNISEFISRYKSSGFMDTLH----DKWYKMVPCGKRVYAVTETLQMG--IYHFSGLFVLLCIGFCGSLLTSLMERVVYHLILP 865          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2C (glutamate receptor, ionotropic, N-methyl D-aspartate 2C [Source:NCBI gene;Acc:100496638])

HSP 1 Score: 147.902 bits (372), Expect = 2.438e-35
Identity = 143/597 (23.95%), Postives = 259/597 (43.38%), Query Frame = 1
Query:  994 NCISKDIRQCKRKLYRNLSNLFSVNGEYKFNNASLFKLYRQGSL-------------KKWDECNQYNGKQVIEKGLLCQNSFFANNY---NFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVV-CYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVR-CCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIA-TVCAVAMGIFEWNSPFG----LSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF---------IAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTL-IDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQ-SRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLY 2670
            +C++         LYR++ N    + E  FN+        QG L             + W+E  ++    +I         + A N    + + + VA +   PF+ ++ T  A       T DC  N V C                  + Q N  LS    + + CC GF I IL+KLA  +K+    Y+V+N  +G  +   WNGM+  +    AH+  G+ +I  +R++++D S PF  + I +L    +         +P++  +W+ + ++  +V AV + IFE+ SP G    LS   R+   ++T+  +L  ++A++F +++  + P+    K +   WAF  ++  A YTANL  F         ++G++       +      + G + + +  + +  +  D    +V++N R   S +DA        LD  + ++ V+  +  K   C+L   T+  G +    GYG    K+S  K  I  + L+   D  +   LE        +CQ  K  +  +K D     I+N+ G+F  L V + ++ L+   EH++YW +    H MP     K +  + IS+ +Y
Sbjct:  302 SCLAPPHLHGNDTLYRHMMNTVWKHREVSFNS--------QGYLLDPSMLVITLTPHRAWEEVGRWE-SGIIRMKYPVWPRYGAGNQLVTDSRHLTVATLEERPFVIVESTDPA-------TGDCIRNTVPC------------------RKQSNLTLSSGEPYTKLCCKGFCIDILKKLARTVKFSYDLYLVTNGKHGKLVRGVWNGMIGEVYYRRAHLAIGSLTINEERSEIVDFSVPFVETGISVLVSRSNGTVSPSAFLEPYSPAVWMMMFVMCLSVVAVTVFIFEYFSPMGYDQDLSNGKRLGGPSFTIGKSLWLLWALVFNNSVPIQNPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDRKFQKPQEQYPPFRFGTVPNGSTERNIRTNYPDMHSYMVRYNQR---SVEDALASLKAGKLDAFIYDAAVLNYMAGKDEGCKL--VTIGSGKVFATTGYGIALQKNSRWKRPIDLALLQFLGDGEYTQRLETVWLSG--ICQNEKNEAVSSKLD-----IDNMAGVFYMLLVAMGLSLLVFSWEHLVYWRM---RHCMPSSCGEKGL--LGISRGIY 847          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 146.362 bits (368), Expect = 7.535e-35
Identity = 114/458 (24.89%), Postives = 217/458 (47.38%), Query Frame = 1
Query: 1393 QLQKNTNLSKSRNFV-RCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFG----LSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF------IAGVAHLSNT--------NSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLC--QKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMF-ISQRLYRIVHS 2685
            Q++      +  N++ RCC GF I IL+K+A  +K+    Y+V+N  +G  IN  WNGM+  ++   A++  G+ +I  +R++V+D S PF  + I ++    +         +PF+ ++W+ +  ++  V AVA+ +FE+ SP G    L+        ++T+  A+  ++ ++F +++  + PK    K + + WAF  ++  A YTANL  F      +  V+ LS+         +     G    G   + NI    +++      +VK+N R   S +DA        LD  + ++ V+  +  +   C+L   T+  G +    GYG    KDS  K ++   L I   FG  ++ E        +C  +K++++SS          I+N+ G+F  L+  + ++ +   +EH+ +W +   +  +    C     V+F IS+ +Y  +H 
Sbjct:  426 QIRTENRTEEGGNYIKRCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGST-ERNIRNNYLEMHSY---MVKFNQR---SVQDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKL--VTIGSGKVFATTGYGIAIQKDSGWKRQVD--LAILQLFGDGEMEELEALWLTGICHNEKNEVMSSQ-------LDIDNMAGVFYMLAAAMALSLITFIMEHLFFWQLRHCFMGV----CSGKPGVVFSISRGIYSCIHG 861          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 146.362 bits (368), Expect = 9.303e-35
Identity = 114/458 (24.89%), Postives = 217/458 (47.38%), Query Frame = 1
Query: 1393 QLQKNTNLSKSRNFV-RCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFG----LSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF------IAGVAHLSNT--------NSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLC--QKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMF-ISQRLYRIVHS 2685
            Q++      +  N++ RCC GF I IL+K+A  +K+    Y+V+N  +G  IN  WNGM+  ++   A++  G+ +I  +R++V+D S PF  + I ++    +         +PF+ ++W+ +  ++  V AVA+ +FE+ SP G    L+        ++T+  A+  ++ ++F +++  + PK    K + + WAF  ++  A YTANL  F      +  V+ LS+         +     G    G   + NI    +++      +VK+N R   S +DA        LD  + ++ V+  +  +   C+L   T+  G +    GYG    KDS  K ++   L I   FG  ++ E        +C  +K++++SS          I+N+ G+F  L+  + ++ +   +EH+ +W +   +  +    C     V+F IS+ +Y  +H 
Sbjct:  436 QIRTENRTEEGGNYIKRCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGST-ERNIRNNYLEMHSY---MVKFNQR---SVQDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKL--VTIGSGKVFATTGYGIAIQKDSGWKRQVD--LAILQLFGDGEMEELEALWLTGICHNEKNEVMSSQ-------LDIDNMAGVFYMLAAAMALSLITFIMEHLFFWQLRHCFMGV----CSGKPGVVFSISRGIYSCIHG 871          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 215.698 bits (548), Expect = 8.141e-57
Identity = 160/625 (25.60%), Postives = 286/625 (45.76%), Query Frame = 1
Query:  967 MNIINVYSVNCISKDI--RQCKRKLYRNLSNLFSVNGEY---KFNNASLFKL-YRQGSLKKWDECNQYNGKQVI-------EKGLLCQNSFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNR 2745
            MN ++V + N  S     R      +R LS    V G       NN  ++ L Y       W     + G +++       E+    +  F   N    +V+  I    PF+        F     +   C    +C D   ND    D +++ ++    ++N +    F +CCYG+ I +L++LA D+ +D   YIV +  YG++ N  W G+V +++ G A++   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   + A+ + ++EW SPFG++P GR R+K ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S+    + Q+  ++ +  +RY  P     V+YL +  +  + F       I+D++L+   +      C+L T        GYG G   +S + + I   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L +G  ++ L    EH++Y  ++PR  N  K   W     +  SQR +R +++   +  K+   +   + K+R
Sbjct:  417 MNCMDVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIVSSENNFFIWNLQYDPMGKPMWTRLGSWQGGRIVMDSGIWPEQAQRHKTHFHHPNKLHLRVVTLI--EHPFV--------FTREVDDEGLCPAGQLCLDPMTNDSSILDSLFSSLH----SSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLDAF-------IMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYW-----LHTSQRFHRALNTS-FVEEKQPCSKTKRVEKSR 1004          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 214.927 bits (546), Expect = 1.136e-56
Identity = 160/628 (25.48%), Postives = 285/628 (45.38%), Query Frame = 1
Query:  967 MNIINVYSVNCISKDI--RQCKRKLYRNLSNLFSVNGEY---KFNNASLFKL-YRQGSLKKWDECNQYNGKQVI-------EKGLLCQNSFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNREFG 2754
            MN ++V + N  S     R      +R LS    V G       NN  ++ L Y       W     + G +++       E+    +  F   N    +V+  I    PF+        F     +   C    +C D   ND    D +++ ++    ++N +    F +CCYG+ I +L++LA D+ +D   YIV +  YG++ N  W G+V +++ G A++   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   + A+ + ++EW SPFG++P GR R+K ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S+    + Q+  ++ +  +RY  P     V+YL +  +  + F       I+D++L+   +      C+L T        GYG G   +S + + I   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L +G  ++ L    EH++Y  ++PR  N  K   W     +  SQR +R +++   +  K+   +   + K    G
Sbjct:  417 MNCMDVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIVSSENNFFIWNLQYDPMGKPMWTRLGSWQGGRIVMDSGIWPEQAQRHKTHFHHPNKLHLRVVTLI--EHPFV--------FTREVDDEGLCPAGQLCLDPMTNDSSILDSLFSSLH----SSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLDAF-------IMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYW-----LHTSQRFHRALNTS-FVEEKQPCSKTKRVEKRSNMG 1007          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 195.282 bits (495), Expect = 1.234e-52
Identity = 132/475 (27.79%), Postives = 215/475 (45.26%), Query Frame = 1
Query: 1222 KKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG--------------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
             K+ V  +   PF+        F     E   C    +C D   ND    D       L+   N S  R   RCCYG+ I +L++LA DL +D   YIV +  YG+  +  W G+V +++ G AH+   +FSI   R++V+D + PF+++ + I+   +D  S +G    P    +W+ +     + A+ + ++EW SP+GL+P GR R   ++ +SALN  YA++FG T+ +K PK    +++ N WA  C+++ + YTANL   + G              + H S       V  +       ++  +    +     P     V  L S       F       I+D+SL+   +      C+L T        GYG G  ++S + + +   +  Y   GF DLL     D  Y +    K + +  +T + G  + +L GLFV L +GL  A L    EH+ Y  ++PR
Sbjct:   57 PKLRVVTLVEHPFV--------FTRESDEDGQCPAGQLCLDPGTNDSARLDAL--FTALE---NGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAF-------IMDKSLLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLH----DKWYKMVPCGKRVFAVTETLQMG--VYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPR 504          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 191.815 bits (486), Expect = 2.111e-49
Identity = 127/454 (27.97%), Postives = 209/454 (46.04%), Query Frame = 1
Query: 1288 FINIESETPDCGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG--------------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
            F     E   C    +C D   ND    D ++  +       N S  R   RCCYG+ I +L++LA DL +D   YIV +  YG+  +  W G+V +++ G AH+   +FSI   R++V+D + PF+++ + I+   +D  S +G    P    +W+ +     + A+ + ++EW SP+GL+P GR R   ++ +SALN  YA++FG T+ +K PK    +++ N WA  C+++ + YTANL   + G              + H S       V  +       ++  +    +     P     V  L S       F       I+D+SL+   +      C+L T        GYG G  ++S + + +   +  Y   GF DLL     D  Y +    K + +  +T + G  + +L GLFV L +GL  A L    EH+ Y  ++PR
Sbjct:  429 FTRESDEDGQCPAGQLCLDPGTNDSARLDALFTALE------NGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAF-------IMDKSLLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLH----DKWYKMVPCGKRVFAVTETLQMG--VYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPR 862          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 133.65 bits (335), Expect = 4.965e-31
Identity = 103/417 (24.70%), Postives = 197/417 (47.24%), Query Frame = 1
Query: 1405 NTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFGLS---PWGRMRH-KNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF------IAGVAHLSNTNSELNVGNT---QIGIIKDSNIIQTLIDLDDKRYP-----VVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYW 2586
            N + ++  N  +CC GF I IL+KL+  +K+    Y+V+N  +G  +NN WNGM+  ++   A +  G+ +I  +R++V+D S PF  + I ++    +         +PF+  +W+ +  ++  V A+A+ +FE+ SP G +     G+  H  ++T+  A+  ++ ++F +++  + PK    K + + WAF  ++  A YTANL  F      +  V  LS+   +     +   + G + + +  + + +     YP     + K+N R ++   DA        LD  + ++ V+     +   C+L   T+  G I    GYG    K S  K +I   L  +   G  + LE          +K++++SS          I+N+ G+F  L+  + ++ +    EH+ YW
Sbjct:  443 NNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRN----NYPYMHQYMTKFNQRGVE---DALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKL--VTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQ-------LDIDNMAGVFYMLAAAMALSLITFIWEHLFYW 843          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8TCU5|NMD3A_HUMAN (Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 4.898e-58
Identity = 174/685 (25.40%), Postives = 306/685 (44.67%), Query Frame = 1
Query:  772 VKKIFQINHKYSFINNEMIIILSDMT---------LPNKL--------DIINHTLNSLNILYIERMHKSTAIDVVNHYSDVIMNIINVYSVNCISKDI--RQCKRKLYRNLSNLFSVNGEYKFNNASLFKLY--RQGSLKK--WDECNQY-NGKQVIEKGLLCQNS-----FFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYL---CQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHS 2685
            +++IF+I  ++  +  E+  +L D           LP  L         +  H +     L    +  +T I          MN + V + N  S     R      +R LS    V G    ++ + F ++  +   + K  W     +  GK V++ G+  + +      F +       +V ++   PF+        F     +   C    +C D   ND    D +++ ++    ++N +    F +CCYG+ I +L+K+A D+ +D   YIV +  YG++ N  W G+V +++ G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   + AV + ++EW SPFGL+P GR R K ++ +SALN  YA++FG T+  K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S+    + Q+  ++ +  +RY  P     V YL +  +  + F       I+D++L+   +      C+L T        GYG G   +S +   I   +  Y   GF D+L     D  Y    C K     S   T+     I++  GLFV L +G  ++ L    EH++Y  ++PR  N  K   W     +  SQRL+R +++
Sbjct:  335 IRRIFEITTQFGVMPPELRWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCMEVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLI-EHPFV--------FTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSSLH----SSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAF-------IMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLH----DKWYRVVPCGK----RSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYW-----LHTSQRLHRAINT 985          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q9R1M7|NMD3A_RAT (Glutamate receptor ionotropic, NMDA 3A OS=Rattus norvegicus OX=10116 GN=Grin3a PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 8.570e-56
Identity = 173/721 (23.99%), Postives = 323/721 (44.80%), Query Frame = 1
Query:  730 VPSKLLFIHSTDKMVKKIFQINHKYSFINNEMIIILSDMT---------LPNKLDIINHTLNSLNILYIE--------RMHKSTAIDVVNHYSDVIMNIINVYSVNCISKDI--RQCKRKLYRNLSNLFSVNGEYKFNNASLFKLY--RQGSLKK--WDECNQYNGKQVI-------EKGLLCQNSFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNR 2745
             P+ ++F    D  +++IF+++ ++     E+  +L D           LP  L     T  S+   Y++         +  +T I          MN ++V + N  S     R      +R LS    V G    ++ + F ++  +   + K  W     + G +++       E+    +  F   N    +V+  I    PF+        F     +   C    +C D   ND    D +++ ++    ++N +    F +CCYG+ I +L++LA D+ +D   YIV +  YG++ N  W G+V +++ G A++   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   + A+ + ++EW SPFG++P GR R+K ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S+    + Q+  ++ +  +RY  P     V+YL +  +  + F       I+D++L+   +      C+L T        GYG G   +S + + I   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L +G  ++ L    EH+++  ++PR  N  K   W     +  SQR +R +++   +  K+   +   + K+R
Sbjct:  322 TPTMVMFGCDMDS-IRQIFEMSTQFGLSPPELHWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALLPSTMNCMDVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIISSENNFFIWNLQHDPMGKPMWTRLGSWQGGRIVMDSGIWPEQAQRHKTHFQHPNKLHLRVVTLI--EHPFV--------FTREVDDEGLCPAGQLCLDPMTNDSSMLDRLFSSLH----SSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLDAF-------IMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVHRLLLPRIKNKSKLQYW-----LHTSQRFHRALNTS-FVEEKQPRSKTKRVEKSR 1004          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q91ZU9|NMD3B_MOUSE (Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.477e-48
Identity = 127/454 (27.97%), Postives = 209/454 (46.04%), Query Frame = 1
Query: 1288 FINIESETPDCGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG--------------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
            F     E   C    +C D   ND    D ++  +       N S  R   RCCYG+ I +L++LA DL +D   YIV +  YG+  +  W G+V +++ G AH+   +FSI   R++V+D + PF+++ + I+   +D  S +G    P    +W+ +     + A+ + ++EW SP+GL+P GR R   ++ +SALN  YA++FG T+ +K PK    +++ N WA  C+++ + YTANL   + G              + H S       V  +       ++  +    +     P     V  L S       F       I+D+SL+   +      C+L T        GYG G  ++S + + +   +  Y   GF DLL     D  Y +    K + +  +T + G  + +L GLFV L +GL  A L    EH+ Y  ++PR
Sbjct:  429 FTRESDEDGQCPAGQLCLDPGTNDSARLDALFTALE------NGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAF-------IMDKSLLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLH----DKWYKMVPCGKRVFAVTETLQMG--VYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPR 862          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8VHN2|NMD3B_RAT (Glutamate receptor ionotropic, NMDA 3B OS=Rattus norvegicus OX=10116 GN=Grin3b PE=1 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 3.225e-48
Identity = 126/453 (27.81%), Postives = 205/453 (45.25%), Query Frame = 1
Query: 1288 FINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG--------------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
            F     E   C    +C D   ND    D            N S  R   RCCYG+ I +L++LA DL +D   YIV +  YG+  +  W G+V +++ G AH+   +FSI   R++V+D + PF+++ + I+   +D  S +G    P    +W+ +     + A+ + ++EW SP+GL+P GR R   ++ +SALN  YA++FG T+ +K PK    +++ N WA  C+++ + YTANL   + G              + H S       V  +       ++  +    +     P     V  L S       F       I+D+SL+   +      C+L T        GYG G  ++S + + +   +  Y   GF DLL     D  Y +    K + +  +T + G  + +  GLFV L +GL  A L    EH+ Y  ++PR
Sbjct:  429 FTRESDEDGQCPAGQLCLDPGTNDSARLDAL-----FAALVNGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAF-------IMDKSLLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLH----DKWYKMVPCGKRVFAVTETLQMG--VYHFSGLFVLLCLGLGSALLTSLGEHVFYRLVLPR 862          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|O60391|NMD3B_HUMAN (Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 5.787e-45
Identity = 124/456 (27.19%), Postives = 206/456 (45.18%), Query Frame = 1
Query: 1288 FINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
            F     E   C    +C D   ND    D            N S  R   +CCYG+ I +L++LA D  +D   Y+V +  YG+  +  W G+V +++ G AH+   +FSI   R++V+D + PF+++ + I+   +D  S +G    P     WL +     + A+ + ++EW SP+GL+P GR R   ++ +SALN  YA++F  T+ +K PK    + + N WA  C+++ + YTANL   + G      ++ + +          + G + +S+    I ++  D+    +R+  P     V  L S       F       I+D+SL+   +      C+L T        GYG G  ++S + + +   +  Y   GF DLL     D  Y     K++    +    T+     I +  GLFV L +GL  A L    EH  +   +PR
Sbjct:  429 FARDPDEDGQCPAGQLCLDPGTNDSATLDAL-----FAALANGSAPRALRKCCYGYCIDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAF-------IMDKSLLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLH----DKWY-----KMVPCGKRVFAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPR 862          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A210Q7T0 (Glutamate receptor ionotropic, NMDA 3A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07996 PE=3 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 1.213e-106
Identity = 269/864 (31.13%), Postives = 437/864 (50.58%), Query Frame = 1
Query:  343 FLLIHLTPSVERLLLTLTNDNSLVISYPKNIYSNLPQVTAPLYF-LHPGNRFYVKSIFMLFKNNNFKMEHGIIILLESQLKSSYEFSQFFSEMFK----EHFNLTET--GKHLTILWIRPNWSEFQIAVKMSIISHVPSKLLFIHSTDKMVKKIFQINHKYSFINNEMI--IILSDMTLPNKLDIINHTLNSLNILYIERMHKSTAI-DVVNHYSDVIMNIINV---------YSVNCISKDIRQC-KRKLYRNLSNL----------FSVNGEYKFNNASLFKLYRQGSLKKWDECNQYNGKQVIEKGLLCQNSFFANN-YNFKKVLVAIV-PTEPFIKIDVTSKAFINIESETPD---CGHNVVCYDLPENDGKYFDIYNHINQLQ--KNTNLSKSRNF-VRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNS--ELNVGNTQIGIIKDSNI------IQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSL---CRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFF-DLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNREFGKVFFKENIQK 2784
            F+++    +V  L L        V+ Y KN      ++ + +Y  L P  R+  + +   F+ N F  E     LL   L+  + F  F+ E+      + +N++E    K +T         E ++   ++   +   +++ IHS+  M K+IF++    +   +  I   I       NK  +  +   SL +L  + ++    + DV++  S V  ++ N          Y  + +S +I  C   KLY+ ++            F  +G    +N  +  L   G  K W +     G  +   G++  +   +N  +N KK    +  P +PF+            +   PD   C  + VC  +   + +       I  L+  +N  ++KS  + VRCC G +I +L +L+ DL +D T YIV + +YG  IN  WNGMV+++M G AH+   AFSIT  R KVID + P++ S   +L   + R + +    +PF +E+W+ I I AT+ A+AM +FEWNSPFGL+PWGR R +NYTLAS L  VY+V+FGHT++TK+PKSWP K +QN WAFACI + A YTANL  FIAG     N     +  + + ++G+++ S +      I   + L  +R+ V K        S +A E+ +   LD  L +  ++    A+G+L   C+L   +   G  GYG G AKDS +K  +  +++ Y + G+  DL++   +D+   C K +I S +++ +     + +  GLFV LSVG++   ++ F+EH +Y  ++PR+     +SC KS H+MF SQRL+RI+ S  L+   E+ KEMI IVKNREF K+F K  I++
Sbjct:   91 FIVLGSKETVNALTLLTEPLGIPVLGYIKNDLHTDSKIPSSMYIKLEPSWRYMARGLIKFFQAN-FWFE----FLL--YLEDDFLFDGFYDELHSITDDDKWNISEEIFSKKMT---------EKEMYRSLNTSVNNQDRIIVIHSSVAMAKRIFKVVGSVNLFKDVHIAWFITERAYTRNKTVLRYYPEGSLALLMNDAVNTVDLLQDVISLVSTVFRDLPNEDKRLFSNVKYDCDNLS-NINVCLGEKLYKEITKTHFDGLTGTLEFEADGSINISNYDIRNLVTSGRNKVWRDMGFIRGHNINPFGIVWPSETISNQIFNGKKRYRIVTNPVKPFVME----------QKPNPDYDGCAQDTVCLKIFTKEKQ-----ATIRVLRDYENGRINKSNPYEVRCCRGLAIDLLNRLSRDLDFDYTLYIVGDVTYGKEINGSWNGMVKDLMVGSAHMAVAAFSITRKRLKVIDFTHPYFFSGFSVLYSERKRHTRMHAFLEPFAVEVWVAIFISATIGAIAMALFEWNSPFGLNPWGRKRKQNYTLASGLTMVYSVLFGHTVRTKSPKSWPSKVMQNFWAFACIFVIASYTANLAAFIAGKHAGINYQDIYDSRMFDIRVGVLEASAVESIVKKINYRLFLTSQRHHVPK--------SDEAIEMLIAGQLDAYLGDYPILE--YARGNLDPKCQLRLLSQTFGEDGYGIGIAKDSPLKIPLSEKIKEYHEIGYIDDLIDVHFADAE--CYKQRITSEESRLE-----VLHHAGLFVMLSVGIVFGIILCFVEHAIYRNLVPRFRKKSPKSCMKSSHLMFFSQRLHRILTSAELVNANESAKEMIGIVKNREFSKLFMKSTIRR 905          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: K1Q881 (Glutamate [NMDA] receptor subunit 3A OS=Crassostrea gigas OX=29159 GN=CGI_10021967 PE=3 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.718e-91
Identity = 189/602 (31.40%), Postives = 330/602 (54.82%), Query Frame = 1
Query: 1015 RQCKRKLYRNLSNLFSVNGEYKFNNASLFKLYRQGSLKK------WDECNQYNGKQVIEKGLLCQNSFFANNYNFK-KVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNF-VRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELN--VGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYL-DSSKDAEELFLNKTLDIILDESLVIRNLKAK-GSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNREFGKVFFKENIQK 2784
            R  + K+Y+  S  F  N +    N    K YR  +LK       W++    +G+    +G+L  +    +  N + +  V   P +PF+ ++       N   ++  C  +  C  +  +D         +N L    N++ S +F ++CC GF++ +L KLA DL+++   YIV +++YG   N  W+GM+R++ +GIAH+   AFSIT +R + ID S P+Y S   +L   + + + +    +PF+ E+W  I + A++ A+ M +FEWNSPFGL+PWGR R +NYT+ S +  VY+++FGHT+ TK+PKSWP K +QN WA ACI I A YTANL  F+AG  +  + NS  +  +   ++G++  S +     +++ K Y   + +  YL  ++ DA  + +N  +D  L +  ++   + K    C L+    + G   YG GF KDS ++  +  +++ Y + G+ +    ++ D ++   + K  +      +    + +  GLF  LS+ ++   L++ +EH+++ +++P     P +S WKS++VMF SQRL+R ++S  L+  +E+ KEM+ IVKN +F ++F K  I+K
Sbjct:  126 RHFQEKVYQGFSMKFEFNSDGYLAN----KNYRIKALKGMVGRSIWEDVGYVHGEIARPRGILWPSEPDLDIRNGRVRYRVVTNPVKPFVMVE-------NGIEDSNQCIQSTPCIQILVSDEN-----QTLNVLHNYENINDSSSFQLKCCRGFAVDLLNKLASDLEFEYVLYIVHDTTYGKEKNGTWDGMMRDLTNGIAHMAIAAFSITGNRLRAIDFSYPYYFSRFTVLYTQQSQKTYMYAFLEPFSPEVWCTIFVSASLSALGMSMFEWNSPFGLNPWGRKRKQNYTIGSGMTMVYSLLFGHTVSTKSPKSWPSKVLQNFWASACIFIIASYTANLAAFLAGKHNGIDYNSVFDSRLMEIRVGVLGGSAVEALTNNINKKLY---QRSQHYLVPTTNDAINMLINGNIDAYLGDYPILDYARVKLDPNCNLYIVPQSFGEDEYGIGFPKDSPLQKPVSEKIKHYHESGYLE----NLIDIHF--DEEKCFNQGINQQRFSLTVFHHSGLFALLSIAIVCCILLVLVEHLVFKFLLPICRGRPDDSFWKSLNVMFFSQRLHRCINSAVLVSAQESAKEMLGIVKNGDFSRLFMKSTIRK 702          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A2S1WM03 (Putative ionotropic glutamate receptor NMDA-like 2 OS=Hirudo verbana OX=311461 PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 3.742e-82
Identity = 181/511 (35.42%), Postives = 282/511 (55.19%), Query Frame = 1
Query: 1420 KSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYG--SFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIA----GVAHLSNTNSELNVGNTQIGIIKDSNI------IQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAK-GSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDN------KTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNREFGKVFFKENIQKPIASRKASPTKMSVFDISSEMVKLKRQSQSQEHIDPS 2895
            +SR  V CC+G SI +L+KLA DL + L  Y V +S +G     + EW G+VR++  G+AH    AFS T  R++ ID + P++ S   IL   K R + +    +PF   +W+ I   ATV AVA+ + EWNSPFGL+PWGR R  NYTL S LN VYA++F HTIKTK+PK+WP KW+QN WA A I I + YTANL  F+A    GV      +  L    T+IG+IK S +      +   + L  + YP    N+    S ++   L  N T+D  L ++ ++ + +    + C+L       G   Y  G  K SW+++++ +++  Y + G+ D L  ++  S   C       SDN      + +     ++   GL++ L  G++V  L++ +EH  + W++P W + P  S WKS  +MF SQRLYRI+ SE+L+ P  + +EM+E+V+ R+F K+F K   ++   +R     + ++F++  E ++ K +S    H+  S
Sbjct:  227 ESRYSVSCCHGLSIMLLEKLAKDLNFRLQIYFVGDSQFGHQEPPSMEWTGIVRDLTTGLAHAAVTAFSATRLRSEEIDFTYPYFYSGFSILVSEKKRSTPIYAFMEPFDGWVWISIVCSATVVAVALSLLEWNSPFGLNPWGRRRKTNYTLGSGLNMVYAILFQHTIKTKSPKAWPSKWLQNFWAGASIFIYSSYTANLAAFLAGKNSGVVISGLDDPRLLEPETRIGLIKGSAVEEFTARVNPKLLLRAQHYPA---NM----SLENVVALLQNDTIDAFLGDTPILEHARTTLDNKCQLRLVGRGFGEDSYAIGVPKHSWLRDQLSAKIIDYQESGYLDDL-MALHFSGSKC-------SDNPNHNQLQGEAAPMNLDQHAGLYLLLVAGVVVCVLLMLVEHATFKWLVPYWRSKPSVSFWKSFSMMFWSQRLYRIITSEQLVSPHHSAREMMEVVRKRDFAKLFQKSVRRQETRAR----NRRNLFNV-VEQLRWKNRSLESGHLQQS 717          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A2T7NPA1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16261 PE=3 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 2.552e-81
Identity = 180/550 (32.73%), Postives = 279/550 (50.73%), Query Frame = 1
Query: 1054 LFSVNGEYKFN-----NASLFK---LYRQGSLKKWDECNQYNGKQVIEKGLLCQN---SFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG--VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAK-GSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQ 2661
            +  + GE +F+     N S F+   L   G  K W +     G++V   G++      S  +     K+  V   P +PF+  +   K +    ++TP       C +L         + + I   +     +     ++CC G +I +L KLA DL +D T YIV +  YG + N  W G++++++D  AH    AFSIT  R KVID + P++ S   +L   + R++ +    +PF   +W  I + A   AVAM +FEWNSPFGL+PWGR R +NY+LAS L  V++V+FGHT+KTK+PK+WP K +QN WAFA I I A YTANL  FIAG       N   +  + + +IG ++ S +   L  L  K Y V   N+  +  +    +  +   LD  L +  ++   +A     C L   +   G   YG G  K+S +K  +  +++ Y + G+ D L K +  ++  C K +I   D+K +     + +  GLFV L VG  V  L L LE++++ W++P     P  S WKS+H+MF SQ
Sbjct:  192 MHGLTGEMEFDDDGYMNISTFRVRNLVFDGREKVWQDVGCVQGREVRPFGIIWPGDAKSLKSPTEGRKRYRVVTNPVQPFVMTEAPHKDYGECITDTP-------CLNLTSKQKNQEHVLSAIAAYESGLGNTSGLYSIQCCRGLTIDLLNKLASDLDFDFTLYIVQDEQYGQWKNETWTGIIKDLVDHTAHFAVAAFSITRARQKVIDFTHPYFFSGFSVLYSDRTRETSMLAFLEPFDTSVWFAIFVSANFTAVAMALFEWNSPFGLNPWGRKRKQNYSLASGLTMVFSVLFGHTVKTKSPKAWPSKVMQNFWAFAAIFIIASYTANLAAFIAGKHAGIYYNDIKDHRLLSIRIGTLQGSAVDDFLRRLQSKLYDVSNRNL--VPKTDVGIDWVIKGRLDAYLGDYPILDYARAHLAPSCELKLISKIFGDDQYGLGLPKNSPLKVTLSKKIQEYHETGYVDDL-KDVHFADAHCFKKRISEEDSKLE-----VGHHAGLFVMLCVGFGVGLLTLALEYVIFKWLVPFIREAPSTSIWKSVHLMFFSQ 726          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A2C9KEF5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067211 PE=3 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 4.031e-78
Identity = 168/498 (33.73%), Postives = 270/498 (54.22%), Query Frame = 1
Query: 1435 VRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNS--ELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIR-NLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLC--QKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNREFGKVFFKENIQKPIA-SRKASPTKMSVF-DISSEMVKLKRQSQSQEHIDPSQEVQ 2907
            V CC G ++ +L  LA +L +    Y V++++YG+  +  W GMV +++DG A I AGAFS+T +R  V+D ++P+Y ++  +++        +     PF+ ++WL I + + V  +A    EW SPFGL+P GR R KNY L S L  V  ++ GHTI  KAPKSWP K +QN WA   I I   YTANL  ++AG + +S+  +  +  +   ++ ++K S +   L  ++       K N  Y+ S+  A     ++T+D+ LD+S +++  L      CR+       G  GY FG ++ SW+K  + + +  Y+    F  L K      YL   Q    LS         Y +E+  GLF+ LS  +++A L L LEH+ Y +++P     P ES WK+ ++ FISQR++R+V SERL   K+  +EMI IV+ R+F ++  K  +QK  A +++   +K  VF +I++ +V   RQ QS      + E +
Sbjct:  594 VHCCKGLTLEMLNTLAQNLNFRYVVYFVNDTNYGTVKDGNWTGMVGDVIDGTADIIAGAFSMTSERMAVLDFTEPYYQNEYALVTGEDAHYVSIWAFMSPFSGQVWLCIMVSSIVAGIATAFLEWRSPFGLNPRGRKRTKNYGLGSGLLMVMVLLTGHTINIKAPKSWPGKLIQNVWAGLAIFIMTSYTANLAAYLAGQSAVSSVKNVFDPELLTKRVAVMKSSAVENYLSKINPSLSKRAKIN--YVTSTVMAINKLRDRTIDVYLDDSPLLQYGLVKNDKDCRIRFAGKGFGADGYAFGLSRHSWLKIPMSNEIMKYTQSEKFHELGK-----KYLSRPQCEHFLSGTANP----YGLEHTGGLFIILSTAILIAVLFLILEHLAYHFVVPWLRKQPAESFWKTENLAFISQRVFRVVRSERLYSQKQAAQEMISIVRQRDFTRIIQKNELQKRRATAQRRVKSKAEVFQEITANIVSYHRQLQSASETADNSEAE 1080          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 224.172 bits (570), Expect = 1.114e-59
Identity = 138/473 (29.18%), Postives = 231/473 (48.84%), Query Frame = 1
Query: 1318 CGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVV-----KWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIG-PI---GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIV 2679
            C    +C D   N+    +    + Q  +  N +    F +CCYG+ I +L+KLA D+ +D   YIV +  YG++ N  W G+V ++M G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   V AV + ++EW SPFG++P GR R + ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S    +  D   K +P +     ++NV       D  +    K    I+D++L+   +           +TL +G P    GYG G  ++S + + I   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L VG+ ++ L    EH+++ W+IPR  N P+   W     +  SQRL+R +
Sbjct:  546 CPAGQLCLDPLTNNTALLE---SLFQGLQGGNDTVPMEFKKCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRES----SAEDYVKKSFPEMHEYMRRYNVPTTPDGIDHLKADPQKLDAFIMDKALLDYEVSIDAD-----CKTLTVGKPFAIEGYGIGLKQNSPLTSNISELVSQYKSDGFMDMLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHIVHRWVIPRMQNKPQYQYW-----LHTSQRLHRAL 992          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 224.172 bits (570), Expect = 1.152e-59
Identity = 138/473 (29.18%), Postives = 231/473 (48.84%), Query Frame = 1
Query: 1318 CGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVV-----KWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIG-PI---GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIV 2679
            C    +C D   N+    +    + Q  +  N +    F +CCYG+ I +L+KLA D+ +D   YIV +  YG++ N  W G+V ++M G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   V AV + ++EW SPFG++P GR R + ++ +SALN  YA++FG T   K PK W  +++ N WA  C+   + YTANL   + G      ++ + +          + G +++S    +  D   K +P +     ++NV       D  +    K    I+D++L+   +           +TL +G P    GYG G  ++S + + I   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L VG+ ++ L    EH+++ W+IPR  N P+   W     +  SQRL+R +
Sbjct:  567 CPAGQLCLDPLTNNTALLE---SLFQGLQGGNDTVPMEFKKCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRES----SAEDYVKKSFPEMHEYMRRYNVPTTPDGIDHLKADPQKLDAFIMDKALLDYEVSIDAD-----CKTLTVGKPFAIEGYGIGLKQNSPLTSNISELVSQYKSDGFMDMLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHIVHRWVIPRMQNKPQYQYW-----LHTSQRLHRAL 1013          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 204.912 bits (520), Expect = 1.316e-53
Identity = 140/519 (26.97%), Postives = 249/519 (47.98%), Query Frame = 1
Query: 1225 KVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHS--ERLIRPKETTKEMIEIVK 2739
            +V V  +   PF+        F     E  +C     C D   N+    D +        NT L    ++ +CCYG+ I +L+KL+ D+ ++   YIV +  YG++    W G+V ++++G+A +   +FSI   R+KV+D + PF+++ + IL   KD  + +G    P    +W+ I +   + A+ + ++EW SPFG++P GR R + ++ +SALN  YA++FG T+ +K PK W  +++ N WA  C+++ + YTANL   + G      ++ + +          + G +++S+      D   K +P +   +R  +     + +   KT    LD  I+D++L+   +      C+L T        GYG G  ++S + + I   +  Y   G+ D+L     D  Y +    K + +  +T + G  I +  GLFV L VG+  A L L  EH  Y  ++P      K   W     +  SQ+++R ++   E + R + T ++   I K
Sbjct:  365 RVRVVTLVEHPFV--------FTREVDEDGNCPAGQYCLDAGTNNSDTLDRFFTSRAQGNNTFLPL--DYSKCCYGYCIDLLEKLSEDMDFEFDLYIVGDGKYGAWKGGRWTGLVGDLLNGVADMAVTSFSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPFGMTPHGRNRVRVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEELSGIHDAKLHHPSHGFRFGTVRESSA----EDYMKKSFPEMHEYMRRFNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFISRYKSDGYMDMLH----DKWYKVVPCGKRVFAVTETLQMG--IRHFSGLFVLLCVGVTGALLTLAGEHAFYRLVLPHIRRRQKFKYW-----LHTSQKIHRALNMTYEDVKRQRGTAEKSCNIQK 857          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 190.274 bits (482), Expect = 1.979e-49
Identity = 126/451 (27.94%), Postives = 219/451 (48.56%), Query Frame = 1
Query: 1315 DCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCW 2631
             C    +C D   N     D+   +NQL +++  S      +CCYG+ I +L+KLA D++++   YIV +  YG++   EW G+V +++ G A +   +FSI   R++VID + PF+++ + IL   KD  + +G    P    +W+ I +   + A+ + ++EWNSPF            ++ +SALN  YA++FG T+ +K PK W  +++ N WA  C+++ + YTANL   + G      V+ + +          + G +++S+      D   K +P +   +R  +     E +   KT    LD  I+D++L+   +      C+L T        GYG G  ++S +   +   +  Y   G+ D+L     D  Y +    K + +  +T + G  I++  GLFV L VG+  A L L  EH  Y +I+P   +  +   W
Sbjct:  366 QCPAGQLCLDPHTNSS---DV---LNQLFRDSGSSIPSEIRKCCYGYCIDLLEKLAEDMQFEFDLYIVGDGKYGAWKGGEWTGLVGDLLRGAADMAVTSFSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWNSPF-----------VFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKLHHPSLGFRFGTVRESSA----EDYMKKSFPEMHEYMRRFNKPTTPEGVSTLKTDPAQLDAFIMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTRNVSEYVSRYKSDGYMDMLH----DKWYKVVPCGKRVFAVTETLQMG--IQHFSGLFVLLCVGVAGALLTLLGEHAFYRFILPHLRHQHRLRYW 788          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 185.652 bits (470), Expect = 6.330e-48
Identity = 124/451 (27.49%), Postives = 217/451 (48.12%), Query Frame = 1
Query: 1315 DCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNY-LCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCW 2631
             C    +C D   N     D+ N + +   ++  S      +CCYG+ I +L+KLA D++++   YIV +  YG++   EW G+V +++ G A +   +FSI   R++VID + PF+++ + IL   KD  + +G    P    +W+ I +   + A+ + ++EWNSPF            ++ +SALN  YA++FG T+ +K PK W  +++ N WA  C+++ + YTANL   + G      V+ + +          + G +++S+      D   K +P +   +R  +     E +   KT    LD  I+D++L+   +      C+L T        GYG G  ++S +   +   +  Y   G+ D+L     D  Y +    K + +  +T + G  I++  GLFV L VG+  A L L  EH  Y +I+P   +  +   W
Sbjct:  382 QCPAGQLCLDPHTNSS---DVLNQLFR-DGSSGSSIPSEIRKCCYGYCIDLLEKLAEDMQFEFDLYIVGDGKYGAWKGGEWTGLVGDLLRGAADMAVTSFSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWNSPF-----------VFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKLHHPSLGFRFGTVRESSA----EDYMKKSFPEMHEYMRRFNKPTTPEGVSTLKTDPAQLDAFIMDKALLDYEVSIDAD-CKLLTVGKPFAIEGYGIGLPQNSPLTRNVSEYVSRYKSDGYMDMLH----DKWYKVVPCGKRVFAVTETLQMG--IQHFSGLFVLLCVGVAGALLTLLGEHAFYRFILPHLRHQHRLRYW 806          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.428 bits (350), Expect = 5.400e-34
Identity = 110/419 (26.25%), Postives = 191/419 (45.58%), Query Frame = 1
Query: 1408 TNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIA-TVCAVAMGIFEWNSPFG----LSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVV-----KWNVR--YLD-----------SSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLY 2583
            TN S S    +CC GF I IL+KL+  +K+    Y+V+N  +GS IN  WNGM+  +++  AH+  G+ +I  +R++V+D S PF  + I ++    +         +PF+ ++W+ + I+   V  +A+ IFE+ SP G    LS         +T+  ++  ++A++F +++  + P+    K++ + WAF  ++  A YTANL  F+    ++            Q+  + D      L      R+  V     + N+R  YL            S +DA        LD  + ++ V+  +  K   CRL   T+  G +    GYG    K S  K  I   L  +   G  D LE          +++ ++SS          I+N+ G+F  L V + ++F++   EH  Y
Sbjct:  384 TNPSSSPYVKKCCKGFCIDILKKLSKTVKFTYDLYLVTNGKHGSKINGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYID-----------QVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNNYLQMHGYMSKFHQKSVEDALMSLKAGKLDAFIYDAAVLNYMAGKDEGCRL--VTIGSGKVFVATGYGIALQKSSRWKRAIDLALLQFIGDGEMDELEMIWLTGICHGERNDVMSSQ-------LDIDNMAGVFYMLLVAMGLSFIVFVCEHFFY 782          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000889.1 (pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1 gene:ENSPMAG00000000813.1 transcript:ENSPMAT00000000889.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 5.497e-20
Identity = 45/142 (31.69%), Postives = 77/142 (54.23%), Query Frame = 1
Query: 1405 NTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIA-TVCAVAMGIFEWNSPFGL 1827
            +T+  KS    RCC GF I IL+KL+  +++    Y+V N  +G  I   WNGMV  +    AH+  G+ +I  +R++V+D S PF  + I ++    +         +PF+  +W+ + I+   + A+A+ +FE+ SP G 
Sbjct:   74 DTSGDKSPYVKRCCKGFCIDILRKLSTTVRFTYDLYLVVNGKHGKKIQGVWNGMVGEVEQKRAHMAVGSLTINEERSQVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSAAVWVMMFILCLMLSAIAVWLFEYLSPVGF 215          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 58.151 bits (139), Expect = 6.832e-9
Identity = 41/153 (26.80%), Postives = 75/153 (49.02%), Query Frame = 1
Query: 1357 DGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNE--WNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVV--YKPFTLELWLFICIIATVCAVAMGIF 1803
            D  YF +  +  Q + N              G+ + + Q++A+  +++  + +V + +YG+   +   WNGMV  ++ G A I     +I++ R +VID S PF +  I I+ + K + S  GV+    P   E+W+  CII     V++ +F
Sbjct:   40 DAPYFMLKKNHEQFEGNDKYE----------GYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIM-IKKPQKSKPGVISFLDPLAYEIWM--CIIFAYIGVSVVLF 179          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000779.1 (pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 gene:ENSPMAG00000000712.1 transcript:ENSPMAT00000000779.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 5.667e-8
Identity = 34/144 (23.61%), Postives = 67/144 (46.53%), Query Frame = 1
Query: 1642 IDMSDPFYTSDIEI-LSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPF--GLSP------------WGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG 2028
            ++ + PF +S + I ++  ++    LG    P    +W+ + +     A+ + +FE  +P   G +P                   +++LA+AL   Y+V+FG  +   AP+ W  +++   WA  C++   +YTANL   + G
Sbjct:  348 LEFTAPFLSSSLSIAVARRQEGRHPLGAFALPLHWTVWVGVFVALHAIALFLTLFECRTPRADGEAPVGTSGSAAAAAGTPAKARGSFSLAAALGLCYSVLFGRNVARGAPRCWSSRFLVGLWAMFCLLCFCIYTANLAAMLVG 491          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010601.1 (pep scaffold:Pmarinus_7.0:GL477914:44203:59941:1 gene:ENSPMAG00000009599.1 transcript:ENSPMAT00000010601.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 8.292e-7
Identity = 26/92 (28.26%), Postives = 48/92 (52.17%), Query Frame = 1
Query: 1414 LSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYG-SFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEIL 1686
            L + + FV    GF++ +L++L+  L +    Y   ++SYG       W+G++  I+   A +G GA +IT +R  V+D +  F    + I+
Sbjct:  200 LGQPKRFV----GFAVDVLEELSRHLGFTYDLYQAPDNSYGRPGPGGSWSGLLGEILHKRADVGIGAVTITPERESVVDFTKRFMDRGVAIM 287          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 112.849 bits (281), Expect = 2.329e-25
Identity = 97/404 (24.01%), Postives = 186/404 (46.04%), Query Frame = 1
Query: 1450 GFSITILQKLAMDLKYDLTYYIVSNSSYGS--FINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKD---RDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYT--------------LASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF---------IAGVAHLSNTN--SELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLE 2571
            G+ I +L+KL+  L++    Y+V ++++G+   +  EWNG+VR +++G A +   + +I+ +R KVID + P+   D+ +  +IK     +     + +PF  +LW+ I     +    + +F   SPFG   +GR   K +T              L  AL S      G +     P S   +     + FA +++ + YTANL  F         I+ V  L+     S   V N+Q     +S  + + + +    +  ++++  ++++S +  E  +N+    I D +++      + S   L T     G IGYGFG AKDS    ++ + +      G+ + L++    +N  C +    +++    +     E+L G+F+ L  G+ V+ ++L LE
Sbjct:  475 GYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYM--DLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGF--YGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTM----WQYMRYHHTFVNNSAEGIEKVMNENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAE----AAEKAKSENQLTFEDLSGVFIVLIAGIGVSCVVLVLE 866          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO44842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE9])

HSP 1 Score: 98.9821 bits (245), Expect = 2.448e-22
Identity = 86/320 (26.88%), Postives = 150/320 (46.88%), Query Frame = 1
Query: 1438 RCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVY-KPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYT----LASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIA--GVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDK-RYPVV---KWNVRYLDSSKDAEELFLNK--TLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDS-WIKN 2355
            +CCYG  I +++ L+ D+ +      +     GSF N +W G++  ++ G A +   + SIT  R+K +D S+PF  +   IL + K   S  G  + KPF +  WL I  +  + AV + +FE ++P GL    R +H+NY     +  ++  +++  F   +    P+    + V + W+FA ++I A+YTANL  F+     AH  +  ++  + N    ++K + I  T ++   K  +P V     N R+  SS+    +       +D  + ES  +    A  + C L T        G+   F K S W +N
Sbjct:    1 KCCYGLCIDLIKLLSRDIGFIPVIETIQGGRAGSFKNGKWTGLIGEVVAGNADMAMSSISITSQRSKFVDFSEPFIHTGSTIL-VAKRHGSFKGDGFLKPFKVSAWLLIFAVLYLVAVVVLLFESHNP-GLQ---RQKHRNYRGEFDIHQSVWLMFSRFFSGILNAPIPRFVSSRVVLSSWSFATLMIDALYTANLAAFMVLQDQAHYIDGINDSRIQNPLASVLKFTTIRDTSVEKYFKINFPHVYSFMRNYRFNHSSEGVRAVKEGYVIVIDAFIWESATMERYVANDTRCSLLTVGKLFDTSGFAAAFPKGSPWTRN 315          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 94.7449 bits (234), Expect = 9.469e-20
Identity = 89/375 (23.73%), Postives = 164/375 (43.73%), Query Frame = 1
Query: 1450 GFSITILQKLAMDLKYDLTYYIVSNSSYGSF--INN----EWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYT--LASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFI------AGVAHLSNTNSELNVGNTQIGIIKDSNI---IQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFV 2523
            GF + +L +L   + +  +  +  + SYGS   +N     +WNGMV  ++ G A +   A +I  +R + I+ S PF    + IL    ++ + L    +PF + LWL + +   + AV + + +  SPFG     R   +     L+SA+   + V+    I    P+S+  + +   WA   ++I A YTANL  F+      A V+ + + N            + +S++    +  ++L      +  +NV+   ++K+  E   N  L   + +S V+    +K   C L T     G  GYG G  K S   N I   +  + + G  + LE +  D++  C           T      +++++G+F+
Sbjct:  441 GFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVELSSMYTFMEGYNVK---TAKEGIEKVKNGELKAFIWDSPVLYYEASKD--CTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEELETTWIDASK-CNT-------ENTSPATLGLQHMLGVFI 802          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO48352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJC5])

HSP 1 Score: 80.4925 bits (197), Expect = 6.800e-17
Identity = 54/210 (25.71%), Postives = 102/210 (48.57%), Query Frame = 1
Query: 1405 NTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINN--EWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSD-PFYTSDIEILSMIKD---RDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTV 2016
            N  ++++++F  CC GF I IL  L  DL +    YIV +  YG +  N   W GM+ +++DG A +   +  +++ R +VID S+ P    D  I+  +K         G   KPF+  LW+     + +  + + + +  SP+G     +   + +TL  + + + + +F   +     +S   ++    ++F  +V+ + YTANL V
Sbjct:    5 NATITRAKHF--CCKGFVIDILISLERDLDFKAEVYIVEDGKYGVYDRNSKRWCGMIGDLIDGKAELALTSLELSLAREEVIDYSNVPLMYHDRVIVMAVKSSYTSHDWFGFT-KPFSTTLWITFGAASVILVIVVWLIDKYSPYG----HKHHFQVFTLRDSFSYLSSTVFKINLDDVTARSPSARFTYAVFSFGTLVLISTYTANLMV 207          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO37551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF8])

HSP 1 Score: 85.1149 bits (209), Expect = 9.260e-17
Identity = 97/416 (23.32%), Postives = 181/416 (43.51%), Query Frame = 1
Query: 1441 CCYGFSITILQKLAMDLKYDLTYYIVSNSSYGS--FINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDR--DSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMR---HKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNS----------ELNVGNTQI--GIIKDSNIIQTLIDLDDKRYPVVKW-------NVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAK---GSLCRLHT--RTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDK----KGYKIENLVGLFVALSVGLIVAFLILFLEHMLY 2583
            CCYG +I +L  +  +L+++   Y V + +YG+    + EWNG+VR+++ G A I     +    R+ V+D S  +  + + +L ++ ++  + +    + PFT +LW+ I     V  VA+ I +  SP+G     +      +++ L  ++   + V F +    + P ++  + +  C A   ++    YTANLT      AHL + ++          +    ++QI  G++K S+ + +  +L+    PV++        N   +D+  D      +  LDI + E L +    AK       RL     +      GY + F K+S  K +             FDL+   +   N   ++ K   S  K D     +     +L G+F   +   IVA L L +E+ L+
Sbjct:  449 CCYGLAIDVLNYVKTELEFEPFVYFVRDGNYGAKNLTSGEWNGVVRDLIRGEADISIDLMTNEA-RSDVVDFSLRWTHAGLALLVLVGEKNVEPIDFAFFDPFTWQLWVGIIATVNVYLVALWIADRLSPYGYHQINKRSVDNKRHFELDGSMWYCWGVCFDNQFVEQRPAAYSSRAMSVCLAMFALLCLTSYTANLT------AHLVSDDTKPYVTGIRDKKFTAKDSQISSGVVK-SSYVDSYFELNQD--PVMQMLFRRMRDNGHLVDNFTDGVRRVKSGELDIFISEILSLDYEVAKQKNTGYPRLQVVGASKPFADTGYSYSFRKNSTWKPK-------------FDLVVNRLKAENKPSEQYKKWVSAGKKDAEEPHEQLTQHSLSGVFFLGASLAIVACLFLLVENKLW 841          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin3ba (glutamate ionotropic receptor NMDA type subunit 3B [Source:NCBI gene;Acc:101155155])

HSP 1 Score: 199.134 bits (505), Expect = 1.769e-51
Identity = 132/477 (27.67%), Postives = 226/477 (47.38%), Query Frame = 1
Query: 1318 CGHNVVCYDLPEN-----DGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFIN-NEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKT----LD-IILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHS 2685
            C    +C D   N      G Y  ++N  + +     +    +  +CCYG+ I +L+KLA D+ +    YIV +  YG+      W G+V +++ G A +   +FSI   R++VID + PFY++ + IL    D  + +G    P    +W  I +   + A+ + ++EWNSPFG++P GR R + ++ +SALN  YA++FG T+ TK PK W  +++ N WA  C+++ + YTANL   + G      V+ + +          + G +++S+      D   K +P +   +R  +     E + + KT    LD  I+D++L+   +      C+L T        GYG G  + S +   +   +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L +G+  A L L  EH  Y  +IPR         W     +  SQ+++R +++
Sbjct:  540 CPAGQLCLDPKTNRSEIIQGLYNQLHNPNSTVVDLEGVDLPDDLRKCCYGYCIDLLEKLAEDMGFTFDLYIVGDGKYGALSGTGRWTGLVGDLLSGAADMAVTSFSINSARSRVIDFTSPFYSTSLGILVRSHDTAAPIGAFMWPLHWSMWAGIFVTLHLTALFLTLYEWNSPFGMTPHGRNRLRVFSYSSALNLCYAILFGRTVATKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEQVSGIHDEKLHHPSMGFRFGTVRESSA----EDYMKKSFPEMHDYMRRFNQPTTPEGVHMLKTDPPALDAFIMDKALLDFEVSIDAD-CKLLTVGKPFAIEGYGIGLPQGSPLTRNVSEFVSRYKSDGFMDMLH----DKWY-----KVVPCGKRVFAVTETLQMGIQHFSGLFVLLCIGVGGALLTLAGEHTFYHLVIPRLRRSHTLQYW-----LHTSQKIHRALNT 997          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 196.823 bits (499), Expect = 7.552e-51
Identity = 122/451 (27.05%), Postives = 220/451 (48.78%), Query Frame = 1
Query: 1318 CGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSN----IIQTLIDLDD--KRY--PVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIG-PI---GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
            C    +C D   N+    + ++ ++ +     N S   +  +CCYG+ I +L+KL  D+ +    YIV +  YG F N  W G+V +++ G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   V A+ + ++EW+SPFG++P GR R++ ++ +SALN  YA++FG T+  K PK W  + + N WA  C+   + YTANL   + G      ++ + +          +   +++S+    + ++  ++ +  +RY  P     +  L +     + F       I+D++L+   +           +TL +G P    GYG G  ++S + +     +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L VG+ ++ L    EH++Y  +IPR
Sbjct:  571 CPAGQLCLDPLTNESSVLEGLFQNLGR----RNGSVPTHLKKCCYGYCIDLLEKLGEDMGFTFDLYIVGDGKYGGFKNGRWTGLVGDLLSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSAEDYVKKSFPEMHEYMRRYNVPATPDGIHNLKADPQKLDAF-------IMDKALLDYEVSIDAD-----CKTLTVGKPFAIEGYGIGLPQNSPLTSNFSELVSQYKSDGFMDMLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLAEHIVYKLVIPR 996          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 196.438 bits (498), Expect = 8.051e-51
Identity = 122/443 (27.54%), Postives = 214/443 (48.31%), Query Frame = 1
Query: 1318 CGHNVVCYDLPENDGKYFD-IYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAG------VAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIG-PI---GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNK----TDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPR 2601
            C    +C D   N+    + ++ ++ +     N S   +  +CCYG+ I +L+KL  D+ +    YIV +  YG F N  W G+V +++ G AH+   +FSI   R++VID + PF+++ + IL   +D  + +G    P    +WL I +   V A+ + ++EW+SPFG++P GR R++ ++ +SALN  YA++FG T+  K PK W  + + N WA  C+   + YTANL   + G      ++ + +          +   +++S+      D   K +P +   +R  +     + +   K     LD  ++ + L           +TL +G P    GYG G  ++S + +     +  Y   GF D+L     D  Y     K++    +    T+     I++  GLFV L VG+ ++ L    EH++Y  +IPR
Sbjct:  512 CPAGQLCLDPLTNESSVLEGLFQNLGR----RNGSVPTHLKKCCYGYCIDLLEKLGEDMGFTFDLYIVGDGKYGGFKNGRWTGLVGDLLSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSA----EDYVKKSFPEMHEYMRRYNVPATPDGIHNLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLPQNSPLTSNFSELVSQYKSDGFMDMLH----DKWY-----KVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLAEHIVYKLVIPR 937          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin2aa (glutamate ionotropic receptor NMDA type subunit 2A [Source:NCBI gene;Acc:101161811])

HSP 1 Score: 140.969 bits (354), Expect = 2.643e-33
Identity = 104/420 (24.76%), Postives = 201/420 (47.86%), Query Frame = 1
Query: 1393 QLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFGLS---PWGRMRH-KNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVF---------IAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVV-KWNVRYLDSS-KDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLC--QKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYW 2586
             ++ NT  +      +CC GF I IL+K+A  +K+    Y+V+N  +G  INN WNGMV  ++   A +  G+ +I  +R++VID S PF  + I ++    +         +PF+  +W+ +  ++  V A+A+ +FE+ SP G +     G+  H  ++T+  A+  ++ ++F +++  + PK    K++ + WAF  ++  A YTANL  F         + G++     N        + G + + +  + +     K YP + ++ V+Y  +   DA        LD  + ++ V+  +  +   C+L   T+  G I    GYG    K S+ K ++   L I +  G  ++ E        +C  +K++++SS          ++N+ G+F  L+  + ++ +    EH+ YW
Sbjct:  458 HIKDNTTEAGGTYIKKCCKGFCIDILKKIAKYVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVTAMAVFMFEYISPLGFNRNLAQGKDPHGPSFTMGKAVWLLWGLVFNNSVPVQNPKGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDNKFQNPHAYSPPFRFGTVPNGSTERNI----RKNYPAMHQYMVKYHQTGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDEGCKL--VTIGSGYIFATTGYGIALQKGSYWKRQVD--LAILAIIGDGEMEELEAQWLTGICHNEKNEVMSSQ-------LDVDNMAGVFYMLATAMGLSLITFISEHLFYW 862          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: ENSORLT00000040618.1 (glutamate receptor ionotropic, NMDA 2A [Source:NCBI gene;Acc:101164378])

HSP 1 Score: 136.346 bits (342), Expect = 6.304e-32
Identity = 103/405 (25.43%), Postives = 197/405 (48.64%), Query Frame = 1
Query: 1438 RCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFI-CIIATVCAVAMGIFEWNSPFGLS---PWGRMRH-KNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTV------FIAGVAHLSNTNSELNVGNT---QIGIIKDSNIIQTLIDLDDKRYP-VVKWNVRYLDSS-KDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPI----GYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLC--QKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYW 2586
            +CC GF I IL+K+A ++K+    Y+V+N  +G  INN WNGMV  ++   A +  G+ +I  +R++VID S PF  + I ++    +         +PF+  +W+ +  ++  V A+A+ +FE+ SP G +     G+  H  ++T+  A+  ++ ++F +++  + P+    K++ + WAF  ++  A YTANL        F+  V  LS+   +     +   + G + + +  + +     K YP + ++  +Y  +   DA        LD  + ++ V+  +  +   C+L   T+  G I    GYG    K S+ K  +   L I S  G  ++ E        +C  +K++++SS          ++N+ G+F  L+  + ++ L    EH+ YW
Sbjct:  551 QCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNMWNGMVGEVVYKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLAQGKDPHGPSFTIGKAIWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQSPYSYSPPFRFGTVPNGSTERNI----RKNYPDMHQYMTKYHQTGVTDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKL--VTIGSGYIFATTGYGIALQKGSYWKRHVD--LAILSIIGDGEMEELEAQWLTGICHNEKNEVMSSQ-------LDVDNMAGVFYMLATAMGLSILTFISEHLFYW 940          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000037019.1 (SMESG000037019.1)

HSP 1 Score: 1737.62 bits (4499), Expect = 0.000e+0
Identity = 842/851 (98.94%), Postives = 847/851 (99.53%), Query Frame = 1
Query:  157 MTNAENAFDNIFVFTSNQTSNEVKLVMEKENLKQYGKVHYLSEDNFGIVSSGYFNLENVSSLFLLIHLTPSVERLLLTLTNDNSLVISYPKNIYSNLPQVTAPLYFLHPGNRFYVKSIFMLFKNNNFKMEHGIIILLESQLKSSYEFSQFFSEMFKEHFNLTETGKHLTILWIRPNWSEFQIAVKMSIISHVPSKLLFIHSTDKMVKKIFQINHKYSFINNEMIIILSDMTLPNKLDIINHTLNSLNILYIERMHKSTAIDVVNHYSDVIMNIINVYSVNCISKDIRQCKRKLYRNLSNLFSVNGEYKFNNASLFKLYRQGSLKKWDECNQYNGKQVIEKGLLCQNSFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKE 2709
            MTNAENAFDNIFVFTSNQTSNEVKLVMEKENLKQYGKVHYLSEDNFGIVSSGYFNLENVSSLFLLIHLTPSVERLLLTLTNDNSLVISYPKNIYSNLPQVTAPLYFLHPGNRFYVKSIFMLFKNNNFKMEHGIIILLESQLKSSYEFSQFFSEMFKEHFNLTETGKHLTILWIRPNWSEFQIAVKMSIISHVPSKLLFIHSTDKMVKKIFQINHKYSFINNEMIIILSDMTLPNKLDIINHTLNSLNILYIERMHKSTAIDVVNHYSDVIM+IINVYSVNCISKDIRQCKRKLYRNLSNLFSVNGEYKFNNASLFKLYRQGSLKKWDECNQYNGKQVIEKGLLCQNSFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVH+ +  R ++
Sbjct:    1 MTNAENAFDNIFVFTSNQTSNEVKLVMEKENLKQYGKVHYLSEDNFGIVSSGYFNLENVSSLFLLIHLTPSVERLLLTLTNDNSLVISYPKNIYSNLPQVTAPLYFLHPGNRFYVKSIFMLFKNNNFKMEHGIIILLESQLKSSYEFSQFFSEMFKEHFNLTETGKHLTILWIRPNWSEFQIAVKMSIISHVPSKLLFIHSTDKMVKKIFQINHKYSFINNEMIIILSDMTLPNKLDIINHTLNSLNILYIERMHKSTAIDVVNHYSDVIMSIINVYSVNCISKDIRQCKRKLYRNLSNLFSVNGEYKFNNASLFKLYRQGSLKKWDECNQYNGKQVIEKGLLCQNSFFANNYNFKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHNCKKPRIRK 851          

HSP 2 Score: 81.6481 bits (200), Expect = 2.329e-15
Identity = 38/40 (95.00%), Postives = 39/40 (97.50%), Query Frame = 3
Query: 2730 DCKKSRIRKGFLQGKYTKTYSIQKSLTDKNERFRYKFRNG 2849
            +CKK RIRKGFLQGKYTKTYSIQKSLTDKNERFRYKFRNG
Sbjct:  843 NCKKPRIRKGFLQGKYTKTYSIQKSLTDKNERFRYKFRNG 882          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000008719.1 (SMESG000008719.1)

HSP 1 Score: 388.652 bits (997), Expect = 1.241e-117
Identity = 250/676 (36.98%), Postives = 362/676 (53.55%), Query Frame = 1
Query:  928 TAIDVVNHYSDVIMNIINVYSVNCISKDIRQCKRKLYRNLSNLFSVNGEYKFNNASLFKLYR---------------QGSLKKWDECNQYNGKQVIEKGLLCQNSFFANNYNF--KKVLVAIVPTEPFIKIDVTSKAFINIESETP-----DCGHNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVD--RTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGV-----AHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTKEMIEIVKNREFGKVFFKENIQKPIASRKASPTKMSVFDISSEMVKLKRQS 2868
            + I+++  ++ +  N  N Y   C+SK     +R + + LS+LF  +G  K    S ++L +                G   K       N +  I    LC N     N  +  KK+ + I   E  +        ++N +S+T         H VVC++L       +  +NH                   C G  + +L+ +   L  D  Y    N    S      + M+ N       I A  FS+ +D      +D+++PF   +  +++ + D   LLG  ++PFT  +W+ ICIIATVCAVAM ++EW+SPFGL+PWGR R+ NY+LASAL SV+A++FGHTI TKAPKSWPVK ++N WA ACIVI AMYTANLTVFIAG+      +            T++  I         ++L      +VK         ++A++LFLNKT+ I++ E   + N +   SLC+     L     G+ FGF   S +  EI   L  Y   GF DLL KS       C  + + ++ NK    GY IEN+ G F+ + +G +V+ L+L LEH+L+  I+P+W N+P+ S WKSI ++F+SQRL+R++HSERLI+P ETT+EMI IV+NREF K+FFKEN+ KP+ SR  SPTK+SVFDISSEMVK+KR+S
Sbjct:  303 SVIELILRFTAMSKNWKNCY---CLSK-----RRLIAKYLSSLFFEDGSLKQGEVSFYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSENYIHPLSLCDNLPEMENKKYLRKKIRILIEYHESLL--------WVNNQSDTEADNFRPMMHQVVCHEL-------YHSHNHF------------------CSGLLVHLLETIGKHLDIDFLYVYTENVPISSI--KTASEMISN-----TSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVK-------DDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNSFGFSFGFQPGSPLFKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNK----GYGIENVSGCFLFMGIGFLVSLLVLLLEHILFRLIVPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHKPVPSRIISPTKISVFDISSEMVKMKRRS 919          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 224.172 bits (570), Expect = 5.254e-61
Identity = 132/426 (30.99%), Postives = 215/426 (50.47%), Query Frame = 1
Query: 1435 VRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNII------QTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLN-IGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSER 2691
            ++CCYGFS+ +L +L +D+ +D+  Y + +  YGS +N  WNG+++ I+   A +  G  ++T DR K ID + PF+     +L   K +      V++PF+  +W+ I +   V   A+  FEW SPFGL+P GR R +NY L S + +VY + F  T   K+PKS+P K+ QN W   CIVI +MY  N+   IA V        E NV  T   ++++ + I       + I +  +++P ++  + Y+ +  + +    NK +   L E LV+RN       C      LN +G   +  G  KD+W +NE+   L IY   G+   L K++  ++  C +        K  +  YK  N   LF  L     + F+IL +EH+ ++          K     S HVM+ SQ+LYR++ + +
Sbjct:  363 LKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNI---IATVI-------ETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRN----TDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQ--------KYTQMKYK--NFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQKLYRLIRNPK 764          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 224.172 bits (570), Expect = 6.692e-61
Identity = 132/426 (30.99%), Postives = 215/426 (50.47%), Query Frame = 1
Query: 1435 VRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNII------QTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLN-IGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSER 2691
            ++CCYGFS+ +L +L +D+ +D+  Y + +  YGS +N  WNG+++ I+   A +  G  ++T DR K ID + PF+     +L   K +      V++PF+  +W+ I +   V   A+  FEW SPFGL+P GR R +NY L S + +VY + F  T   K+PKS+P K+ QN W   CIVI +MY  N+   IA V        E NV  T   ++++ + I       + I +  +++P ++  + Y+ +  + +    NK +   L E LV+RN       C      LN +G   +  G  KD+W +NE+   L IY   G+   L K++  ++  C +        K  +  YK  N   LF  L     + F+IL +EH+ ++          K     S HVM+ SQ+LYR++ + +
Sbjct:  368 LKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNI---IATVI-------ETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRN----TDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQ--------KYTQMKYK--NFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQKLYRLIRNPK 769          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 201.83 bits (512), Expect = 1.546e-53
Identity = 120/385 (31.17%), Postives = 194/385 (50.39%), Query Frame = 1
Query: 1435 VRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNII------QTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLN-IGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFL 2568
            ++CCYGFS+ +L +L +D+ +D+  Y + +  YGS +N  WNG+++ I+   A +  G  ++T DR K ID + PF+     +L   K +      V++PF+  +W+ I +   V   A+  FEW SPFGL+P GR R +NY L S + +VY + F  T   K+PKS+P K+ QN W   CIVI +MY  N+   IA V        E NV  T   ++++ + I       + I +  +++P ++  + Y+ +  + +    NK +   L E LV+RN       C      LN +G   +  G  KD+W +NE+   L IY   G+   L K++  ++  C +        K  +  YK  N   LF  L     + F+IL +
Sbjct:  368 LKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNI---IATVI-------ETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRN----TDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQ--------KYTQMKYK--NFTSLFHVLLCAFPICFIILMV 728          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.020e-5825.40glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3B1.205e-4527.19glutamate ionotropic receptor NMDA type subunit 3B... [more]
GRIN2B7.549e-3124.26glutamate ionotropic receptor NMDA type subunit 2B... [more]
GRIN2A8.609e-3124.40glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A1.963e-3024.40glutamate ionotropic receptor NMDA type subunit 2A... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmr-21.124e-3325.86NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-25.232e-2126.65NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-11.246e-2022.76NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
nmr-11.246e-2022.76NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
glr-61.047e-1424.69GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmdar27.457e-2525.00gene:FBgn0053513 transcript:FBtr0091453[more]
Nmdar27.457e-2525.00gene:FBgn0053513 transcript:FBtr0301842[more]
Nmdar27.457e-2525.00gene:FBgn0053513 transcript:FBtr0091454[more]
Nmdar28.090e-2525.00gene:FBgn0053513 transcript:FBtr0301843[more]
Nmdar21.093e-2424.52gene:FBgn0053513 transcript:FBtr0339592[more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin3bb1.869e-5527.98glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba6.672e-5527.02glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb3.036e-5428.09glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a5.043e-5327.80glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a6.614e-5327.80glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nup1551.372e-5729.11nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973... [more]
GRIN3B1.438e-5127.77glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
GRIN2C2.438e-3523.95glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B7.535e-3524.89glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B9.303e-3524.89glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grin3a8.141e-5725.60glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3a1.136e-5625.48glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3b1.234e-5227.79glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin3b2.111e-4927.97glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin2a4.965e-3124.70glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TCU5|NMD3A_HUMAN4.898e-5825.40Glutamate receptor ionotropic, NMDA 3A OS=Homo sap... [more]
sp|Q9R1M7|NMD3A_RAT8.570e-5623.99Glutamate receptor ionotropic, NMDA 3A OS=Rattus n... [more]
sp|Q91ZU9|NMD3B_MOUSE1.477e-4827.97Glutamate receptor ionotropic, NMDA 3B OS=Mus musc... [more]
sp|Q8VHN2|NMD3B_RAT3.225e-4827.81Glutamate receptor ionotropic, NMDA 3B OS=Rattus n... [more]
sp|O60391|NMD3B_HUMAN5.787e-4527.19Glutamate receptor ionotropic, NMDA 3B OS=Homo sap... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q7T01.213e-10631.13Glutamate receptor ionotropic, NMDA 3A OS=Mizuhope... [more]
K1Q8811.718e-9131.40Glutamate [NMDA] receptor subunit 3A OS=Crassostre... [more]
A0A2S1WM033.742e-8235.42Putative ionotropic glutamate receptor NMDA-like 2... [more]
A0A2T7NPA12.552e-8132.73Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9KEF54.031e-7833.73Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.114e-5929.18glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3A1.152e-5929.18glutamate ionotropic receptor NMDA type subunit 3A... [more]
grin3bb1.316e-5326.97glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba1.979e-4927.94glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba6.330e-4827.49glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010716.15.400e-3426.25pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000000889.15.497e-2031.69pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1... [more]
gria1b6.832e-926.80glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000000779.15.667e-823.61pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 ge... [more]
ENSPMAT00000010601.18.292e-728.26pep scaffold:Pmarinus_7.0:GL477914:44203:59941:1 g... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302032.329e-2524.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448422.448e-2226.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355459.469e-2023.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483526.800e-1725.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375519.260e-1723.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin3ba1.769e-5127.67glutamate ionotropic receptor NMDA type subunit 3B... [more]
GRIN3A7.552e-5127.05glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
GRIN3A8.051e-5127.54glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
grin2aa2.643e-3324.76glutamate ionotropic receptor NMDA type subunit 2A... [more]
ENSORLT00000040618.16.304e-3225.43glutamate receptor ionotropic, NMDA 2A [Source:NCB... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037019.12.329e-1598.94SMESG000037019.1[more]
SMESG000008719.11.241e-11736.98SMESG000008719.1[more]
SMESG000006949.15.254e-6130.99SMESG000006949.1[more]
SMESG000006949.16.692e-6130.99SMESG000006949.1[more]
SMESG000006949.11.546e-5331.17SMESG000006949.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003545 ID=SMED30003545|Name=Glutamate receptor ionotropic, NMDA 3A|organism=Schmidtea mediterranea sexual|type=transcript|length=3188bp
ATTTAAGTGGATAATTCGATGAATAAATGTTTTCTTATTAGCTTTTTTTC
GTCAGCCAATAAAAATAGTGTTGGCATAAAATCAATAAAATTCATTATTT
CAGTATCGCAGTCAATGATAATACATTTGTTGTTATCAATTCTCCTCGTG
GATTTTATGACAAATGCAGAAAACGCTTTCGATAATATTTTTGTCTTCAC
CAGCAATCAAACGTCAAATGAAGTCAAATTAGTGATGGAAAAAGAAAATC
TGAAACAATACGGAAAAGTTCATTATTTATCCGAAGACAACTTTGGAATC
GTCAGTAGTGGATATTTTAATTTAGAAAATGTTTCTTCTTTGTTTTTATT
AATCCATTTGACTCCATCAGTCGAAAGATTGCTTTTGACATTGACAAATG
ACAATTCATTAGTGATTTCATATCCGAAAAATATATACTCAAATTTGCCA
CAAGTGACTGCTCCACTTTATTTTTTACATCCTGGAAATAGATTTTATGT
CAAGTCAATTTTTATGCTTTTCAAAAACAATAACTTTAAAATGGAACATG
GAATTATTATTTTACTGGAATCTCAGTTGAAATCTTCATACGAGTTCAGT
CAATTTTTCAGTGAAATGTTCAAAGAACATTTCAATTTGACCGAGACCGG
AAAACATTTAACTATTTTGTGGATCCGGCCGAATTGGAGTGAATTCCAAA
TTGCTGTCAAAATGTCTATCATATCGCATGTGCCTTCAAAATTGCTCTTT
ATTCATTCTACTGATAAAATGGTAAAAAAGATTTTTCAAATTAATCATAA
ATACTCTTTCATTAACAATGAAATGATTATTATTCTCTCTGATATGACTT
TGCCGAATAAGTTGGATATTATCAATCATACGCTAAACTCTCTGAATATT
TTATACATTGAGAGAATGCACAAGTCAACTGCCATTGACGTCGTCAATCA
CTACTCTGATGTAATAATGAACATTATAAACGTCTATTCTGTCAATTGTA
TTTCAAAGGATATAAGACAATGCAAAAGAAAACTCTATCGCAATCTTTCT
AATTTATTTTCTGTCAATGGAGAATACAAATTCAACAATGCAAGTTTGTT
TAAACTCTACAGACAAGGATCTCTTAAAAAGTGGGACGAATGCAACCAAT
ACAATGGGAAACAAGTCATTGAGAAAGGACTTCTTTGTCAAAACAGTTTT
TTTGCCAACAATTACAATTTTAAAAAGGTCTTGGTGGCCATTGTACCGAC
AGAGCCATTTATTAAAATTGATGTGACCTCAAAGGCTTTCATCAACATCG
AATCTGAAACTCCGGATTGTGGACATAATGTCGTTTGTTATGACTTGCCA
GAGAATGATGGGAAATATTTCGATATTTATAACCATATCAATCAGCTTCA
GAAAAACACAAATTTATCCAAATCGAGAAATTTTGTCCGTTGCTGTTACG
GATTTTCAATAACAATTTTGCAAAAGCTCGCAATGGATTTGAAATACGAT
TTAACGTATTACATCGTCAGTAACTCTTCGTACGGATCCTTTATTAACAA
CGAATGGAATGGTATGGTTAGAAATATCATGGACGGAATCGCACATATTG
GTGCTGGGGCCTTCAGCATTACAGTTGACCGAACGAAAGTAATTGACATG
TCCGATCCGTTTTATACCAGTGACATTGAAATATTAAGCATGATTAAAGA
CAGGGACAGCTTGTTAGGGGTGGTTTATAAACCTTTCACGTTAGAATTGT
GGTTATTTATATGCATAATAGCGACTGTCTGTGCAGTTGCCATGGGCATT
TTTGAATGGAATAGCCCATTTGGATTGAGCCCTTGGGGGAGGATGCGTCA
CAAAAATTACACATTGGCATCGGCATTGAATTCAGTTTATGCTGTAATGT
TTGGACATACAATTAAAACAAAAGCCCCGAAATCGTGGCCAGTAAAATGG
GTACAAAATTGCTGGGCATTTGCATGCATAGTCATTGCTGCTATGTATAC
TGCTAATTTGACTGTATTTATTGCTGGTGTTGCTCACCTATCTAACACAA
ACAGCGAACTGAATGTTGGCAACACTCAAATTGGCATCATCAAAGATTCA
AATATCATCCAGACTCTCATAGATTTAGATGACAAACGATATCCCGTTGT
CAAGTGGAATGTACGCTATTTGGATAGTTCGAAAGATGCTGAAGAACTTT
TTTTGAACAAAACATTGGACATCATTCTGGATGAAAGTTTAGTTATCAGG
AATCTGAAAGCTAAAGGCTCTTTGTGCAGGCTGCATACTCGTACACTGAA
TATTGGACCCATCGGCTATGGATTCGGATTCGCAAAGGATTCTTGGATAA
AAAATGAAATTCAAAGTCGACTAAGAATATACAGTGATTTTGGATTTTTC
GATTTACTTGAGAAAAGCATCAGCGATTCAAATTATCTTTGCCAAAAATC
AAAGATTTTAAGCAGTGATAATAAGACAGACAAAAAAGGTTATAAAATAG
AAAACCTCGTTGGATTGTTTGTCGCACTATCAGTTGGGCTTATCGTAGCC
TTTTTAATATTATTTTTGGAACATATGCTTTATTGGTGGATTATTCCACG
TTGGCATAACATGCCGAAGGAGAGTTGTTGGAAAAGTATTCATGTTATGT
TTATTAGTCAAAGGCTATATCGCATAGTTCATAGTGAAAGATTAATACGT
CCCAAGGAAACAACTAAGGAAATGATTGAGATTGTAAAAAATCGAGAATT
CGGAAAGGTTTTCTTCAAGGAAAATATACAAAAACCTATAGCATCCAGAA
AAGCCTCACCGACAAAAATGAGCGTTTTCGATATAAGTTCAGAAATGGTT
AAATTAAAAAGACAAAGTCAAAGCCAGGAACATATAGACCCATCTCAAGA
GGTTCAAAGTAATCACTTTCTACAACGCAGCAAAAGTTTTGATGACTACC
AACTGAAAATAGAAAAATCTCCTGAAAGGATATTATCATTTAATCAAAAT
GATAAATCTAAATTTTACAAAAACTCTGAAACTTCGACAAGTACAATTTT
TGGAAGTGATAATAATTCACTAAGAATTGCTTTCACGAACCCACTAAATG
AAGGAACAGTTGATGACTATAAATACAAAATGTTAAATATATCAAATAAA
GATTAAATGCTTTTTAAAAATGCTTCAAATATGAATTT
back to top

protein sequence of SMED30003545-orf-1

>SMED30003545-orf-1 ID=SMED30003545-orf-1|Name=SMED30003545-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1046bp
MNKCFLISFFSSANKNSVGIKSIKFIISVSQSMIIHLLLSILLVDFMTNA
ENAFDNIFVFTSNQTSNEVKLVMEKENLKQYGKVHYLSEDNFGIVSSGYF
NLENVSSLFLLIHLTPSVERLLLTLTNDNSLVISYPKNIYSNLPQVTAPL
YFLHPGNRFYVKSIFMLFKNNNFKMEHGIIILLESQLKSSYEFSQFFSEM
FKEHFNLTETGKHLTILWIRPNWSEFQIAVKMSIISHVPSKLLFIHSTDK
MVKKIFQINHKYSFINNEMIIILSDMTLPNKLDIINHTLNSLNILYIERM
HKSTAIDVVNHYSDVIMNIINVYSVNCISKDIRQCKRKLYRNLSNLFSVN
GEYKFNNASLFKLYRQGSLKKWDECNQYNGKQVIEKGLLCQNSFFANNYN
FKKVLVAIVPTEPFIKIDVTSKAFINIESETPDCGHNVVCYDLPENDGKY
FDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIV
SNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYT
SDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSP
FGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWA
FACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNIIQTL
IDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKG
SLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKS
ISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFL
EHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHSERLIRPKETTK
EMIEIVKNREFGKVFFKENIQKPIASRKASPTKMSVFDISSEMVKLKRQS
QSQEHIDPSQEVQSNHFLQRSKSFDDYQLKIEKSPERILSFNQNDKSKFY
KNSETSTSTIFGSDNNSLRIAFTNPLNEGTVDDYKYKMLNISNKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0005216ion channel activity
GO:0004872receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 830..854
score: 20.0
coord: 577..602
score: 37.69
coord: 644..671
score: 35.71
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 459..803
e-value: 8.5E-5
score: -36.6
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 575..841
e-value: 1.9E-14
score: 53.8
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 463..522
e-value: 7.0E-5
score: 32.2
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 471..557
e-value: 1.1E-17
score: 64.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 562..851
e-value: 3.4E-54
score: 185.9
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 476..823
e-value: 3.4E-54
score: 185.9
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 552..767
e-value: 3.4E-54
score: 185.9
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 446..942
NoneNo IPR availablePANTHERPTHR18966:SF448coord: 446..942
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 475..798
NoneNo IPR availableTMHMMTMhelixcoord: 615..632
NoneNo IPR availableTMHMMTMhelixcoord: 573..595
NoneNo IPR availableTMHMMTMhelixcoord: 827..849
NoneNo IPR availableTMHMMTMhelixcoord: 647..669