Ubiquitin conjugating enzyme E2 H

Overview
NameUbiquitin conjugating enzyme E2 H
Smed IDSMED30003542
Length (bp)990
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin conjugating enzyme E2 H (SMED30003542) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin conjugating enzyme E2 H (SMED30003542) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin conjugating enzyme E2 H (SMED30003542) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin conjugating enzyme E2 H (SMED30003542) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003542

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30003542SMESG000064993.1 dd_Smed_v4_4514_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30003542SMESG000064993.1 dd_Smed_v4_4514_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003542SMESG000064993.1 dd_Smed_v4_4514_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Human
Match: UBE2H (ubiquitin conjugating enzyme E2 H [Source:HGNC Symbol;Acc:HGNC:12484])

HSP 1 Score: 241.506 bits (615), Expect = 1.920e-79
Identity = 106/153 (69.28%), Postives = 136/153 (88.89%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Human
Match: UBE2H (ubiquitin conjugating enzyme E2 H [Source:HGNC Symbol;Acc:HGNC:12484])

HSP 1 Score: 181.415 bits (459), Expect = 2.200e-56
Identity = 77/116 (66.38%), Postives = 102/116 (87.93%), Query Frame = 1
Query:  196 TPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
             PYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:   11 APYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 121          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Human
Match: UBE2H (ubiquitin conjugating enzyme E2 H [Source:HGNC Symbol;Acc:HGNC:12484])

HSP 1 Score: 174.096 bits (440), Expect = 5.971e-54
Identity = 81/141 (57.45%), Postives = 106/141 (75.18%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVK 507
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALY                    DPLNG+AA++++ +  +Y +K+K
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALY--------------------DPLNGDAAAMYLHRPEEYKQKIK 122          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Human
Match: UBE2H (ubiquitin conjugating enzyme E2 H [Source:HGNC Symbol;Acc:HGNC:12484])

HSP 1 Score: 167.548 bits (423), Expect = 6.676e-51
Identity = 79/153 (51.63%), Postives = 106/153 (69.28%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSI                                    DLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSI------------------------------------DLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 123          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Human
Match: UBE2H (ubiquitin conjugating enzyme E2 H [Source:HGNC Symbol;Acc:HGNC:12484])

HSP 1 Score: 135.961 bits (341), Expect = 3.498e-39
Identity = 60/89 (67.42%), Postives = 77/89 (86.52%), Query Frame = 1
Query:  277 MNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            MN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    1 MNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 84          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Celegans
Match: ubc-8 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q9N2W9])

HSP 1 Score: 214.927 bits (546), Expect = 6.004e-69
Identity = 94/150 (62.67%), Postives = 123/150 (82.00%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATE 534
            GK+R+D DV+KLI   +EV I++G +E +V+F+GPKDT YE G+W I+V++P++YP+KSPSIGF+N+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIFD+FLPQLL+YPN  DPLNGEAA L++ K  +Y    +EYV R+A+E
Sbjct:    8 GKRRIDCDVVKLISHNHEVQIVNGCSEFIVRFHGPKDTAYENGVWRIRVDMPDKYPFKSPSIGFLNKIFHPNIDEA-----SGTVCLDVINQAWTALYDLTNIFDTFLPQLLTYPNAADPLNGEAARLYIHKPEEYRRTCREYVMRFASE 152          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Celegans
Match: ubc-13 (Ubiquitin-conjugating enzyme E2 13 [Source:UniProtKB/Swiss-Prot;Acc:Q95XX0])

HSP 1 Score: 93.2041 bits (230), Expect = 5.751e-23
Identity = 42/119 (35.29%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GP D+P+ GG++ +++ +PE YP  +P + FM +IYHPNID      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  ++ I+  K++   YA
Sbjct:   38 VMIAGPDDSPFAGGVFKLELFLPEEYPMAAPKVRFMTKIYHPNID------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPEDPLATDVAEQWKTNEAEAIKTAKQWTMNYA 149          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Celegans
Match: let-70 (Ubiquitin-conjugating enzyme E2 2 [Source:UniProtKB/Swiss-Prot;Acc:P35129])

HSP 1 Score: 92.4337 bits (228), Expect = 1.045e-22
Identity = 41/115 (35.65%), Postives = 67/115 (58.26%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP ++PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ +    Y +  +E+ ++YA
Sbjct:   39 GPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Celegans
Match: ubc-1 (Ubiquitin-conjugating enzyme E2 1 [Source:UniProtKB/Swiss-Prot;Acc:P52478])

HSP 1 Score: 91.2781 bits (225), Expect = 9.661e-22
Identity = 39/115 (33.91%), Postives = 69/115 (60.00%), Query Frame = 1
Query:  178 FYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRR 522
             +GP++TP+E G + + +E  E YP K P++ F+++++HPN+      +  G++CLD++  +WS  YD+  I  S +  LL  PNP  P N  AA L+     +Y ++V++ V +
Sbjct:   40 IFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNV------YADGSICLDILQNRWSPTYDVAAILTS-IQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVEQ 147          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Celegans
Match: ubc-20 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q9TZ69])

HSP 1 Score: 89.7373 bits (221), Expect = 3.855e-21
Identity = 40/131 (30.53%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  157 LNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            L E+     GP DTPY GG++++ ++IP++YP+  P++ F  +I+HPN+       ++G +CLD++  QW+A   L  +  S +  L+  P P DP +   A  +M K + +    + +  ++A   V N 
Sbjct:   36 LTEIKGHIRGPPDTPYAGGMFDLDIKIPDQYPFSPPNVKFSTKIWHPNVSS-----QTGVICLDILKDQWAASLTLRTVLLS-IQALMCTPEPKDPQDAVVAKQYMEKPAVFKATAEYWTTKFAKGAVKNA 160          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Fly
Match: UbcE2H (gene:FBgn0029996 transcript:FBtr0071112)

HSP 1 Score: 228.024 bits (580), Expect = 2.072e-74
Identity = 103/155 (66.45%), Postives = 129/155 (83.23%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GK+RMD DVIKLIE K+EVTIL GLNE  VKF+GP +TPYEGG+W ++V +P+ YP+KSPSIGF+N+IYHPNIDE+     SGTVCLDVINQ W+ALYDL+NIF+SFLPQLL+YPNP DPLN +AA+L++ +  +Y  KV +YV+RYATE+ L  
Sbjct:    7 GKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDES-----SGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYATEDALRA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Fly
Match: UbcE2H (gene:FBgn0029996 transcript:FBtr0071114)

HSP 1 Score: 228.024 bits (580), Expect = 2.072e-74
Identity = 103/155 (66.45%), Postives = 129/155 (83.23%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GK+RMD DVIKLIE K+EVTIL GLNE  VKF+GP +TPYEGG+W ++V +P+ YP+KSPSIGF+N+IYHPNIDE+     SGTVCLDVINQ W+ALYDL+NIF+SFLPQLL+YPNP DPLN +AA+L++ +  +Y  KV +YV+RYATE+ L  
Sbjct:    7 GKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDES-----SGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYATEDALRA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Fly
Match: UbcE2H (gene:FBgn0029996 transcript:FBtr0071113)

HSP 1 Score: 228.024 bits (580), Expect = 2.072e-74
Identity = 103/155 (66.45%), Postives = 129/155 (83.23%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GK+RMD DVIKLIE K+EVTIL GLNE  VKF+GP +TPYEGG+W ++V +P+ YP+KSPSIGF+N+IYHPNIDE+     SGTVCLDVINQ W+ALYDL+NIF+SFLPQLL+YPNP DPLN +AA+L++ +  +Y  KV +YV+RYATE+ L  
Sbjct:    7 GKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDES-----SGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYATEDALRA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Fly
Match: CG14739 (gene:FBgn0037987 transcript:FBtr0082553)

HSP 1 Score: 131.724 bits (330), Expect = 1.080e-36
Identity = 64/148 (43.24%), Postives = 92/148 (62.16%), Query Frame = 1
Query:   91 KRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYI--EKVKEYVRRYA 528
            +R+D DV +L+   Y  T+   +  L V   GP  + YEGGIW + V +P+ YP  +P + F+ +I HPNI+     F +G VC++V+ Q WS+ YDL NIF++FLPQLL YPNP D LN  AA++   KHS+ +  E V   ++ YA
Sbjct:   16 RRLDRDVNRLLASGYRTTVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRVRFVTKILHPNIE-----FITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIM--KHSEQLFREHVILCMKTYA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Fly
Match: ben (gene:FBgn0000173 transcript:FBtr0307296)

HSP 1 Score: 100.523 bits (249), Expect = 1.429e-25
Identity = 46/118 (38.98%), Postives = 72/118 (61.02%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEE 537
            GP D+P+EGG++ +++ +PE YP  +P + F+ +IYHPNID      R G +CLDV+  +WS    +  I  S +  LLS PNP DPL  + A L+    ++ I   +E+ ++YA E+
Sbjct:   41 GPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNID------RLGRICLDVLKDKWSPALQIRTILLS-IQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREWTQKYAVED 151          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Zebrafish
Match: ube2h (ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-030616-67])

HSP 1 Score: 244.202 bits (622), Expect = 9.356e-81
Identity = 108/153 (70.59%), Postives = 137/153 (89.54%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTILSGLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  DY +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILSGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEDYKQKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Zebrafish
Match: ube2nb (ubiquitin-conjugating enzyme E2Nb [Source:ZFIN;Acc:ZDB-GENE-040426-1291])

HSP 1 Score: 96.6709 bits (239), Expect = 6.214e-24
Identity = 44/119 (36.97%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + S  +  IE  + + R YA
Sbjct:   37 VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKSNEAQAIETARTWTRLYA 148          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Zebrafish
Match: CR753897.1 (pep chromosome:GRCz11:CHR_ALT_CTG18_2_4:15782215:15792426:1 gene:ENSDARG00000111297.1 transcript:ENSDART00000190037.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR753897.1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.229e-23
Identity = 43/119 (36.13%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R YA
Sbjct:   33 VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARTWTRLYA 144          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Zebrafish
Match: ube2na (ubiquitin-conjugating enzyme E2Na [Source:ZFIN;Acc:ZDB-GENE-040426-2873])

HSP 1 Score: 95.9005 bits (237), Expect = 1.352e-23
Identity = 43/119 (36.13%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R YA
Sbjct:   37 VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARTWTRLYA 148          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Zebrafish
Match: CR753897.1 (pep chromosome:GRCz11:CHR_ALT_CTG18_2_4:15781720:15792426:1 gene:ENSDARG00000111297.1 transcript:ENSDART00000193676.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR753897.1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.780e-23
Identity = 43/119 (36.13%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R YA
Sbjct:   40 VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARTWTRLYA 151          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Xenopus
Match: larp6 (La ribonucleoprotein domain family member 6 [Source:Xenbase;Acc:XB-GENE-493801])

HSP 1 Score: 241.506 bits (615), Expect = 1.511e-79
Identity = 123/182 (67.58%), Postives = 155/182 (85.16%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNGXXXXXXXXXXXXXXXXXXXXXAQGMEL 630
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L        DS +ESSMS+FSEDEAQ MEL
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFIVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEERTGDSSSESSMSDFSEDEAQDMEL 183          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Xenopus
Match: ube2n (ubiquitin conjugating enzyme E2 N [Source:NCBI gene;Acc:395006])

HSP 1 Score: 95.1301 bits (235), Expect = 4.622e-23
Identity = 42/123 (34.15%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEV 540
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R +A   +
Sbjct:   48 VLIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLHAMNNI 163          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Xenopus
Match: ube2n (ubiquitin conjugating enzyme E2 N [Source:NCBI gene;Acc:395006])

HSP 1 Score: 94.3597 bits (233), Expect = 4.688e-23
Identity = 42/123 (34.15%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEV 540
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R +A   +
Sbjct:   28 VLIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLHAMNNI 143          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Xenopus
Match: ube2n (ubiquitin conjugating enzyme E2 N [Source:NCBI gene;Acc:395006])

HSP 1 Score: 94.7449 bits (234), Expect = 4.787e-23
Identity = 42/123 (34.15%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEV 540
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R +A   +
Sbjct:   37 VLIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLHAMNNI 152          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Xenopus
Match: ube2d3 (ubiquitin conjugating enzyme E2 D3 [Source:NCBI gene;Acc:548818])

HSP 1 Score: 93.5893 bits (231), Expect = 8.657e-23
Identity = 42/115 (36.52%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ +    Y    +E+ ++YA
Sbjct:   39 GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Mouse
Match: Ube2h (ubiquitin-conjugating enzyme E2H [Source:MGI Symbol;Acc:MGI:104632])

HSP 1 Score: 241.506 bits (615), Expect = 1.318e-79
Identity = 106/153 (69.28%), Postives = 136/153 (88.89%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Mouse
Match: Ube2h (ubiquitin-conjugating enzyme E2H [Source:MGI Symbol;Acc:MGI:104632])

HSP 1 Score: 167.548 bits (423), Expect = 4.583e-51
Identity = 79/153 (51.63%), Postives = 106/153 (69.28%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSI                                    DLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSI------------------------------------DLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 123          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Mouse
Match: Ube2n (ubiquitin-conjugating enzyme E2N [Source:MGI Symbol;Acc:MGI:1934835])

HSP 1 Score: 96.2857 bits (238), Expect = 9.731e-24
Identity = 43/123 (34.96%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEV 540
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R YA   +
Sbjct:   37 VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI 152          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Mouse
Match: Ube2d2a (ubiquitin-conjugating enzyme E2D 2A [Source:MGI Symbol;Acc:MGI:1930715])

HSP 1 Score: 93.5893 bits (231), Expect = 6.556e-23
Identity = 42/115 (36.52%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ +    Y    +E+ ++YA
Sbjct:   39 GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Mouse
Match: Ube2d2a (ubiquitin-conjugating enzyme E2D 2A [Source:MGI Symbol;Acc:MGI:1930715])

HSP 1 Score: 93.5893 bits (231), Expect = 6.556e-23
Identity = 42/115 (36.52%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ +    Y    +E+ ++YA
Sbjct:   39 GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. UniProt/SwissProt
Match: sp|P62257|UBE2H_MOUSE (Ubiquitin-conjugating enzyme E2 H OS=Mus musculus OX=10090 GN=Ube2h PE=1 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 9.220e-79
Identity = 106/153 (69.28%), Postives = 136/153 (88.89%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. UniProt/SwissProt
Match: sp|P62256|UBE2H_HUMAN (Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens OX=9606 GN=UBE2H PE=1 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 9.220e-79
Identity = 106/153 (69.28%), Postives = 136/153 (88.89%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. UniProt/SwissProt
Match: sp|Q32LN1|UBE2H_BOVIN (Ubiquitin-conjugating enzyme E2 H OS=Bos taurus OX=9913 GN=UBE2H PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 9.220e-79
Identity = 106/153 (69.28%), Postives = 136/153 (88.89%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTIL GLNE +VKFYGP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. UniProt/SwissProt
Match: sp|Q9P7R4|UBC8_SCHPO (Ubiquitin-conjugating enzyme E2 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc8 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.769e-58
Identity = 85/151 (56.29%), Postives = 117/151 (77.48%), Query Frame = 1
Query:   88 KKRMDTDVIKLIEKKYEVTILS-GLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEE 537
            ++R++TDV+KL+   YEVT+++  + E  V+F+GP +TPY GGIW + VE+P  YP+KSPSIGF+NRI+HPNIDE      SG+VCLDVINQ WS ++D+ NIF+ FLPQLL YPN +DPLNGEAA+L + + + Y  KV++Y+ RYA +E
Sbjct:    5 RRRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHGPSETPYSGGIWKVHVELPSEYPWKSPSIGFVNRIFHPNIDEL-----SGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNASDPLNGEAAALLLREPNTYYAKVRDYIARYANKE 150          
BLAST of Ubiquitin conjugating enzyme E2 H vs. UniProt/SwissProt
Match: sp|P16577|UBC4_WHEAT (Ubiquitin-conjugating enzyme E2-23 kDa OS=Triticum aestivum OX=4565 GN=UBC4 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.625e-57
Identity = 87/147 (59.18%), Postives = 112/147 (76.19%), Query Frame = 1
Query:   91 KRMDTDVIKLIEKKYEVTILS-GLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            KR + D++KL+   Y+V +++ G++E  V F+GPKD+ Y+GG+W ++VE+ E YPYKSPSIGF N+IYHPN+DE      SG+VCLDVINQ WS ++DL NIF+ FLPQLL YPNP+DPLNGEAASL M   + Y  KVKEY  RYA
Sbjct:    6 KRREMDLMKLMMSDYKVDMINDGMHEFFVHFHGPKDSIYQGGVWKVRVELTEAYPYKSPSIGFTNKIYHPNVDEM-----SGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAYENKVKEYCERYA 147          
BLAST of Ubiquitin conjugating enzyme E2 H vs. TrEMBL
Match: A0A3Q0KP17 (Putative ubiquitin-conjugating enzyme h OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 4.196e-84
Identity = 121/155 (78.06%), Postives = 139/155 (89.68%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GKKRMDTDV+KLIE KYEVTIL GLNELMVKF+GP +TPYEGGIW ++V++PERYP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQQWSALYDLTNIF+SFLPQLL+YPNPTDPLN +AASLFM K S+Y+ KVKEYV+R+A+EE L  
Sbjct:    7 GKKRMDTDVVKLIESKYEVTILGGLNELMVKFFGPPETPYEGGIWKVRVDLPERYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQQWSALYDLTNIFESFLPQLLAYPNPTDPLNSDAASLFMFKPSEYVTKVKEYVQRFASEEALKA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. TrEMBL
Match: W6USC2 (Ubiquitin-conjugating enzyme E2 H OS=Echinococcus granulosus OX=6210 GN=EGR_01623 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 3.249e-83
Identity = 121/155 (78.06%), Postives = 137/155 (88.39%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GKKRMDTDV+KLIE KYEVT+L GLNELMVKF GP +TPYEGGIW ++VE+PERYP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQQWSA+YDLTNIF+SFLPQLL+YPNPTDPLN +AASLFM K  DY+ KVKEYV+R+ATEE L  
Sbjct:    7 GKKRMDTDVVKLIESKYEVTVLGGLNELMVKFNGPPETPYEGGIWKVRVELPERYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQQWSAVYDLTNIFESFLPQLLAYPNPTDPLNSDAASLFMYKPMDYVSKVKEYVQRFATEEALKA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. TrEMBL
Match: A0A0R3VYS2 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS2567 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 3.249e-83
Identity = 121/155 (78.06%), Postives = 137/155 (88.39%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GKKRMDTDV+KLIE KYEVT+L GLNELMVKF GP +TPYEGGIW ++VE+PERYP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQQWSA+YDLTNIF+SFLPQLL+YPNPTDPLN +AASLFM K  DY+ KVKEYV+R+ATEE L  
Sbjct:    7 GKKRMDTDVVKLIESKYEVTVLGGLNELMVKFNGPPETPYEGGIWKVRVELPERYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQQWSAVYDLTNIFESFLPQLLAYPNPTDPLNSDAASLFMYKPMDYVSKVKEYVQRFATEEALKA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. TrEMBL
Match: A0A0R3WM64 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1839 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 3.249e-83
Identity = 121/155 (78.06%), Postives = 137/155 (88.39%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GKKRMDTDV+KLIE KYEVT+L GLNELMVKF GP +TPYEGGIW ++VE+PERYP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQQWSA+YDLTNIF+SFLPQLL+YPNPTDPLN +AASLFM K  DY+ KVKEYV+R+ATEE L  
Sbjct:    7 GKKRMDTDVVKLIESKYEVTVLGGLNELMVKFNGPPETPYEGGIWKVRVELPERYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQQWSAVYDLTNIFESFLPQLLAYPNPTDPLNSDAASLFMYKPMDYVSKVKEYVQRFATEEALKA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. TrEMBL
Match: A0A0R3S7J4 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 3.431e-83
Identity = 121/155 (78.06%), Postives = 137/155 (88.39%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
            GKKRMDTDV+KLIE KYEVT+L GLNELMVKF GP +TPYEGGIW ++VE+PERYP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQQWSA+YDLTNIF+SFLPQLL+YPNPTDPLN +AASLFM K  DY+ KVKEYV+R+ATEE L  
Sbjct:    7 GKKRMDTDVVKLIESKYEVTVLGGLNELMVKFNGPPETPYEGGIWKVRVELPERYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQQWSAVYDLTNIFESFLPQLLAYPNPTDPLNSDAASLFMYKPMDYVSKVKEYVQRFATEEALKA 156          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Cavefish
Match: ube2h (ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-030616-67])

HSP 1 Score: 181.415 bits (459), Expect = 1.210e-56
Identity = 77/116 (66.38%), Postives = 102/116 (87.93%), Query Frame = 1
Query:  196 TPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
             PYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:   14 APYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 124          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Cavefish
Match: ube2na (ubiquitin conjugating enzyme E2 N [Source:NCBI gene;Acc:103021524])

HSP 1 Score: 95.9005 bits (237), Expect = 1.146e-23
Identity = 43/119 (36.13%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + +  +  IE  + + R YA
Sbjct:   37 VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKTNEAQAIETARTWTRLYA 148          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Cavefish
Match: ube2d2l (ubiquitin-conjugating enzyme E2 D2 [Source:NCBI gene;Acc:103039786])

HSP 1 Score: 95.1301 bits (235), Expect = 1.391e-23
Identity = 43/116 (37.07%), Postives = 67/116 (57.76%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYAT 531
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ + +  Y    +E+  +YAT
Sbjct:   39 GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDNEKYNRLAREWTEKYAT 147          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Cavefish
Match: ube2d2l (ubiquitin-conjugating enzyme E2 D2 [Source:NCBI gene;Acc:103039786])

HSP 1 Score: 93.9745 bits (232), Expect = 4.409e-23
Identity = 42/115 (36.52%), Postives = 67/115 (58.26%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ + +  Y    +E+ ++YA
Sbjct:   39 GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDNEKYNRIAREWTQKYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Cavefish
Match: ube2d2l (ubiquitin-conjugating enzyme E2 D2 [Source:NCBI gene;Acc:103039786])

HSP 1 Score: 93.5893 bits (231), Expect = 5.479e-23
Identity = 42/115 (36.52%), Postives = 67/115 (58.26%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ + +  Y    +E+ ++YA
Sbjct:   32 GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDNEKYNRIAREWTQKYA 139          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006211.1 (pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gene:ENSPMAG00000005612.1 transcript:ENSPMAT00000006211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 6.645e-23
Identity = 43/124 (34.68%), Postives = 73/124 (58.87%), Query Frame = 1
Query:  160 NELMV---KFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRR 522
            N +MV     +GP+ TP+E G + + +E  E YP K P++ F+++++HPN+      +  G++CLD++  +WS  YD+++I  S +  LL  PNP  P N +AA L+     +Y +KV   V +
Sbjct:   19 NNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNV------YADGSICLDILQNRWSPTYDVSSILTS-IQSLLDEPNPNSPANSQAAQLYQENKREYEKKVSAIVEQ 135          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Sea Lamprey
Match: ube2t (ubiquitin-conjugating enzyme E2T (putative) [Source:NCBI gene;Acc:768152])

HSP 1 Score: 89.3521 bits (220), Expect = 5.048e-22
Identity = 43/127 (33.86%), Postives = 71/127 (55.91%), Query Frame = 1
Query:  160 NELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQ----QWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
             EL  +  G   TPYEGGI++++V+IP+RYP++ P + F+  IYHPNID A      G +CLD++       W    +++ +  S   QL+  PNP DPL  + ++ F      ++   K + +++A
Sbjct:   32 GELRAQILGGAGTPYEGGIFSLEVQIPDRYPFEPPKVTFLTPIYHPNIDTA------GRICLDILKMPPKGAWRPSLNVSTVLTSVQ-QLMGEPNPDDPLMPDISAEFKYNKPSFVSTAKSWTQKHA 151          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008817.1 (pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143:-1 gene:ENSPMAG00000007968.1 transcript:ENSPMAT00000008817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 5.919e-22
Identity = 40/114 (35.09%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  181 YGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRR 522
            +GP+ TP+E G + + +E  E YP K P++ F+++++HPN+      +  G++CLD++  +WS  YD+++I  S +  LL  PNP  P N  AA L+     +Y +KV   V +
Sbjct:   41 FGPEGTPFEDGTFKLTLEFTEEYPNKPPTVKFVSKMFHPNV------YADGSICLDILQNRWSPTYDVSSILTS-IQSLLDEPNPNSPANSLAAQLYQENKREYEKKVSAVVEQ 147          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010378.1 (pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 gene:ENSPMAG00000009396.1 transcript:ENSPMAT00000010378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 1.777e-21
Identity = 40/111 (36.04%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYV 516
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ +    Y +  +E +
Sbjct:   40 GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDRDKYNKLARETI 143          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Sea Lamprey
Match: ube2kb (ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-980605-9])

HSP 1 Score: 85.1149 bits (209), Expect = 5.565e-20
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  157 LNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNG 549
              EL  +  GP DTPYEGG + ++++IPE YP+  P + F+ +I+HPNI        +G +CLD++  QW+A   L  +  S    LL+   P DP +   A  +   H  +++  + +   YA     NG
Sbjct:   35 FTELRGEIAGPPDTPYEGGRYMLEIKIPETYPFNPPKVRFITKIWHPNISSV-----TGAICLDILKDQWAAAMTLRTVLLSLQ-ALLAAAEPDDPQDAVVARQYKENHEMFVQTARLWAHMYAGAPAYNG 159          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Yeast
Match: UBC8 (Ubiquitin-conjugating enzyme that regulates gluconeogenesis; negatively regulates gluconeogenesis by mediating the glucose-induced ubiquitination of fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme that catalyzes the ubiquitination of histones in vitro [Source:SGD;Acc:S000000738])

HSP 1 Score: 172.94 bits (437), Expect = 2.395e-53
Identity = 82/152 (53.95%), Postives = 111/152 (73.03%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILS-GLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEE 537
             K+R++TDV+KL+   ++V +++  + E  VKF GPKDTPYE G+W + VE+P+ YPYKSPSIGF+N+I+HPNID A     SG++CLDVIN  WS LYDL NI +  +P LL  PN +DPLN EAA+L +     Y EK+KEY+ +YAT+E
Sbjct:    4 SKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIA-----SGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYATKE 150          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Yeast
Match: RAD6 (Ubiquitin-conjugating enzyme (E2); involved in postreplication repair as a heterodimer with Rad18p, regulation of K63 polyubiquitination in response to oxidative stress, DSBR and checkpoint control as a heterodimer with Bre1p, ubiquitin-mediated N-end rule protein degradation as a heterodimer with Ubr1p, ERAD with Ubr1p in the absence of canonical ER membrane ligases, and Rpn4p turnover as part of proteasome homeostasis, in complex with Ubr2p and Mub1p [Source:SGD;Acc:S000003026])

HSP 1 Score: 96.2857 bits (238), Expect = 1.408e-24
Identity = 44/113 (38.94%), Postives = 69/113 (61.06%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRR 522
            GP DTPYE G + + +E  E YP K P + F++ ++HPN+      + +G +CLD++  +W+  YD+ +I  S +  L + PNP  P N EAA+LF    S Y+++VKE V +
Sbjct:   42 GPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNV------YANGEICLDILQNRWTPTYDVASILTS-IQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEK 147          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Yeast
Match: UBC5 (Ubiquitin-conjugating enzyme; mediates selective degradation of short-lived, abnormal, or excess proteins, including histone H3; central component of the cellular stress response; expression is heat inducible; protein abundance increases in response to DNA replication stress; UBC5 has a paralog, UBC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002466])

HSP 1 Score: 92.8189 bits (229), Expect = 1.550e-23
Identity = 43/115 (37.39%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY GG++ + +  P  YP+K P + F  +IYHPNI+       SG +CLD++  QWS    L+ +  S    LL+  NP DPL  E A ++ +  + Y    KE+ ++YA
Sbjct:   40 GPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINS------SGNICLDILKDQWSPALTLSKVLLSIC-SLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYA 147          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Yeast
Match: UBC4 (Ubiquitin-conjugating enzyme (E2); key E2 partner with Ubc1p for the anaphase-promoting complex (APC); mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; regulates levels of DNA Polymerase-{alpha} to promote efficient and accurate DNA replication; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response; UBC4 has a paralog, UBC5, that arose from the whole genome duplication [Source:SGD;Acc:S000000286])

HSP 1 Score: 89.7373 bits (221), Expect = 1.860e-22
Identity = 43/124 (34.68%), Postives = 65/124 (52.42%), Query Frame = 1
Query:  157 LNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            L        GP D+PY GG++ + +  P  YP+K P I F  +IYHPNI+       +G +CLD++  QWS    L+ +  S    LL+  NP DPL  E A ++ +    Y    +E+ ++YA
Sbjct:   31 LYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINA------NGNICLDILKDQWSPALTLSKVLLSIC-SLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYA 147          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Yeast
Match: UBC11 (Ubiquitin-conjugating enzyme; most similar in sequence to Xenopus ubiquitin-conjugating enzyme E2-C, but not a true functional homolog of this E2; unlike E2-C, not required for the degradation of mitotic cyclin Clb2 [Source:SGD;Acc:S000005866])

HSP 1 Score: 89.7373 bits (221), Expect = 2.922e-22
Identity = 47/143 (32.87%), Postives = 83/143 (58.04%), Query Frame = 1
Query:   91 KRMDTDVIKLIEKKYEVTILSGLNELMVKFY-----GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKV 504
            KR+  ++++L+    E      +++  + ++     GPKDTPY G  + + ++ P+ YP+  P I F++ ++HPN+D      +SG +CLD++ ++WSA+Y++  I  S L  LL  PN   PLN  AA L+ +   +Y +KV
Sbjct:   11 KRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVD------KSGNICLDILKEKWSAVYNVETILLS-LQSLLGEPNNRSPLNAVAAELWDADMEEYRKKV 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Nematostella
Match: EDO48747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIN2])

HSP 1 Score: 243.047 bits (619), Expect = 9.572e-81
Identity = 111/153 (72.55%), Postives = 133/153 (86.93%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+R+DTDVIKLIE K+EVTIL GLNE +VKF+GP  TPYEGG+W ++V++PE+YP+KSPSIGF+N+IYHPNIDEA     SGTVCLDVINQ W+ALYDL+NIF+SFLPQLLSYPNP DPLNG+AA+LF+ K   Y EK+ EY+RRYATEE L
Sbjct:    7 GKRRIDTDVIKLIESKHEVTILGGLNEFIVKFFGPVGTPYEGGVWKVRVDLPEKYPFKSPSIGFVNKIYHPNIDEA-----SGTVCLDVINQAWTALYDLSNIFESFLPQLLSYPNPIDPLNGDAAALFLHKPDQYKEKISEYIRRYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Nematostella
Match: EDO40595 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q0])

HSP 1 Score: 97.4413 bits (241), Expect = 1.081e-24
Identity = 47/119 (39.50%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GPKD+PYEGG + +++ +PE YP  +P + FM +IYHPNID      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  +       IE  K + R YA
Sbjct:   39 VTVNGPKDSPYEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNID------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKVNEVQAIETAKAWTRLYA 150          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Nematostella
Match: EDO31327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q0])

HSP 1 Score: 97.4413 bits (241), Expect = 1.081e-24
Identity = 47/119 (39.50%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GPKD+PYEGG + +++ +PE YP  +P + FM +IYHPNID      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  +       IE  K + R YA
Sbjct:   39 VTVNGPKDSPYEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNID------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKVNEVQAIETAKAWTRLYA 150          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Nematostella
Match: EDO43669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR8])

HSP 1 Score: 95.1301 bits (235), Expect = 6.340e-24
Identity = 43/115 (37.39%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY+GG++ + +  P  YP+K P + F  +IYHPNI+       +G++CLD++  QWS    ++ +  S    L+  PNP DPL  E A  F +    Y +  KE+ R+YA
Sbjct:   39 GPADSPYQGGVFFLTIHFPTDYPFKPPKVSFTTKIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLMDDPNPDDPLVPEIARSFKTDRKKYNDMAKEWTRKYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Nematostella
Match: EDO47887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL90])

HSP 1 Score: 92.4337 bits (228), Expect = 2.528e-22
Identity = 45/133 (33.83%), Postives = 76/133 (57.14%), Query Frame = 1
Query:  157 LNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQ----QWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            +++L  K  G + TPY  GI+ + ++IPERYP++ P + F+  IYHPNID       SG +CLD +       W    +++++  + L  L++ PNP DPL  E ++ F    + ++EK KE+  ++A +  L
Sbjct:   32 IDKLEAKLIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDS------SGRICLDTLKMPPKGMWKPALNISSVLSTIL-ILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFAMDPSL 157          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Medaka
Match: ube2h (ubiquitin conjugating enzyme E2 H [Source:NCBI gene;Acc:101164767])

HSP 1 Score: 241.891 bits (616), Expect = 6.877e-80
Identity = 106/153 (69.28%), Postives = 137/153 (89.54%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTILSGLNE +VKF+GP+ TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  +Y +K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILSGLNEFVVKFFGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Medaka
Match: ENSORLT00000013571.2 (ubiquitin-conjugating enzyme E2 H [Source:NCBI gene;Acc:101163973])

HSP 1 Score: 241.506 bits (615), Expect = 1.110e-79
Identity = 107/153 (69.93%), Postives = 135/153 (88.24%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GK+RMDTDV+KLIE K+EVTILSGLNE +VKF+GP  TPYEGG+W ++V++P++YP+KSPSIGFMN+I+HPNIDEA     SGTVCLDVINQ W+ALYDLTNIF+SFLPQLL+YPNP DPLNG+AA++++ +  DY  K+KEY+++YATEE L
Sbjct:    7 GKRRMDTDVVKLIESKHEVTILSGLNEFVVKFHGPPGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEA-----SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEDYKHKIKEYIQKYATEEAL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Medaka
Match: UBE2D2 (ubiquitin-conjugating enzyme E2 D2 [Source:NCBI gene;Acc:101158902])

HSP 1 Score: 96.2857 bits (238), Expect = 5.632e-24
Identity = 43/115 (37.39%), Postives = 67/115 (58.26%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY+GG++ + +  P  YP+K P + F  RIYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  E A ++ +    Y +  KE+ ++YA
Sbjct:   39 GPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDGQKYTKMAKEWTQKYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Medaka
Match: ENSORLT00000014143.2 (ubiquitin conjugating enzyme E2 N [Source:NCBI gene;Acc:101166376])

HSP 1 Score: 95.5153 bits (236), Expect = 1.162e-23
Identity = 44/119 (36.97%), Postives = 70/119 (58.82%), Query Frame = 1
Query:  172 VKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            V   GP+D+P+EGG + +++ +PE YP  +P + FM +IYHPN+D      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  + S  ++ I+  K + R YA
Sbjct:   37 VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEKWKSNEAEAIDIAKTWTRLYA 148          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Medaka
Match: UBE2D1 (ubiquitin-conjugating enzyme E2 D4 [Source:NCBI gene;Acc:101164669])

HSP 1 Score: 93.9745 bits (232), Expect = 4.759e-23
Identity = 43/115 (37.39%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP D+PY GG++ + V  P  YP+K P + F  +IYHPNI+       +G++CLD++  QWS    ++ +  S    LL  PNP DPL  + A ++ S    Y +  +E+ +RYA
Sbjct:   39 GPNDSPYHGGVFFLSVHFPTDYPFKPPKVAFTTKIYHPNINS------NGSICLDILRSQWSPALTISKVLLSIC-SLLCDPNPDDPLVPDIAHIYKSDRQKYNKLAREWTQRYA 146          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Planmine SMEST
Match: SMESG000064993.1 (SMESG000064993.1)

HSP 1 Score: 330.102 bits (845), Expect = 1.140e-114
Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNGXXXXXXXXXXXXXXXXXXXXXAQGMEL 630
            GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNGNMVENNDSENESSMSEFSEDEAQGMEL
Sbjct:    7 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNGNMVENNDSENESSMSEFSEDEAQGMEL 188          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Planmine SMEST
Match: SMESG000064993.1 (SMESG000064993.1)

HSP 1 Score: 313.153 bits (801), Expect = 4.018e-108
Identity = 177/182 (97.25%), Postives = 177/182 (97.25%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNGXXXXXXXXXXXXXXXXXXXXXAQGMEL 630
            GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEA     SGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNGNMVENNDSENESSMSEFSEDEAQGMEL
Sbjct:    7 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEA-----SGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVLNGNMVENNDSENESSMSEFSEDEAQGMEL 183          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Planmine SMEST
Match: SMESG000061584.1 (SMESG000061584.1)

HSP 1 Score: 224.942 bits (572), Expect = 2.105e-73
Identity = 106/153 (69.28%), Postives = 129/153 (84.31%), Query Frame = 1
Query:   85 GKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            G KRM+ DV+KL++K+Y+VT L+G NE+MVKFYGPKDTPYEGGIWNI+VEIP+ YP+KSPSIGFMNRIYHPNIDE      SGT+CLDVINQ WS + DLTNIFD FLPQLL+YPN +DPLN EAA L  SK  DY ++VK+YV+++AT ++L
Sbjct:    7 GLKRMNIDVVKLVQKRYDVTYLNGANEIMVKFYGPKDTPYEGGIWNIRVEIPDNYPFKSPSIGFMNRIYHPNIDEM-----SGTICLDVINQHWSPISDLTNIFDYFLPQLLTYPNTSDPLNIEAAKLHDSKPYDYQKRVKDYVQKFATGKIL 154          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Planmine SMEST
Match: SMESG000072369.1 (SMESG000072369.1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.849e-24
Identity = 44/115 (38.26%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYA 528
            GP +TP+EGG++ +K+ +PERYP+  P + F+ +I+HPNI           VCLD++   WS   +++ +  S +  LL+ PNP+ PLN +AA L++   + Y E VK  V+++A
Sbjct:   45 GPTETPFEGGLFKLKLHLPERYPFSPPHVKFLTKIFHPNI-------YKNEVCLDILQLNWSPSLNISKVLLSIM-SLLTDPNPSSPLNRKAADLYIKDINKYNETVKTCVKKFA 151          
BLAST of Ubiquitin conjugating enzyme E2 H vs. Planmine SMEST
Match: SMESG000045122.1 (SMESG000045122.1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.508e-23
Identity = 43/120 (35.83%), Postives = 70/120 (58.33%), Query Frame = 1
Query:  184 GPKDTPYEGGIWNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQWSALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYVRRYATEEVL 543
            GPKD+PYEGG++ +++ +P+ YP  +P + F+ +IYHPNID      + G +CLD++  +WS    +  +  S +  LLS PNP DPL  + A  +     D I   +E+   +A+ + L
Sbjct:   42 GPKDSPYEGGVFKLELFLPDEYPMSAPKVRFVTKIYHPNID------KLGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAEQWKMNEVDAIRTAREWTAIHASNQSL 154          
The following BLAST results are available for this feature:
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2H1.920e-7969.28ubiquitin conjugating enzyme E2 H [Source:HGNC Sym... [more]
UBE2H2.200e-5666.38ubiquitin conjugating enzyme E2 H [Source:HGNC Sym... [more]
UBE2H5.971e-5457.45ubiquitin conjugating enzyme E2 H [Source:HGNC Sym... [more]
UBE2H6.676e-5151.63ubiquitin conjugating enzyme E2 H [Source:HGNC Sym... [more]
UBE2H3.498e-3967.42ubiquitin conjugating enzyme E2 H [Source:HGNC Sym... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubc-86.004e-6962.67UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-135.751e-2335.29Ubiquitin-conjugating enzyme E2 13 [Source:UniPro... [more]
let-701.045e-2235.65Ubiquitin-conjugating enzyme E2 2 [Source:UniProt... [more]
ubc-19.661e-2233.91Ubiquitin-conjugating enzyme E2 1 [Source:UniProt... [more]
ubc-203.855e-2130.53UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UbcE2H2.072e-7466.45gene:FBgn0029996 transcript:FBtr0071112[more]
UbcE2H2.072e-7466.45gene:FBgn0029996 transcript:FBtr0071114[more]
UbcE2H2.072e-7466.45gene:FBgn0029996 transcript:FBtr0071113[more]
CG147391.080e-3643.24gene:FBgn0037987 transcript:FBtr0082553[more]
ben1.429e-2538.98gene:FBgn0000173 transcript:FBtr0307296[more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2h9.356e-8170.59ubiquitin-conjugating enzyme E2H (UBC8 homolog, ye... [more]
ube2nb6.214e-2436.97ubiquitin-conjugating enzyme E2Nb [Source:ZFIN;Acc... [more]
CR753897.11.229e-2336.13pep chromosome:GRCz11:CHR_ALT_CTG18_2_4:15782215:1... [more]
ube2na1.352e-2336.13ubiquitin-conjugating enzyme E2Na [Source:ZFIN;Acc... [more]
CR753897.11.780e-2336.13pep chromosome:GRCz11:CHR_ALT_CTG18_2_4:15781720:1... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
larp61.511e-7967.58La ribonucleoprotein domain family member 6 [Sourc... [more]
ube2n4.622e-2334.15ubiquitin conjugating enzyme E2 N [Source:NCBI gen... [more]
ube2n4.688e-2334.15ubiquitin conjugating enzyme E2 N [Source:NCBI gen... [more]
ube2n4.787e-2334.15ubiquitin conjugating enzyme E2 N [Source:NCBI gen... [more]
ube2d38.657e-2336.52ubiquitin conjugating enzyme E2 D3 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube2h1.318e-7969.28ubiquitin-conjugating enzyme E2H [Source:MGI Symbo... [more]
Ube2h4.583e-5151.63ubiquitin-conjugating enzyme E2H [Source:MGI Symbo... [more]
Ube2n9.731e-2434.96ubiquitin-conjugating enzyme E2N [Source:MGI Symbo... [more]
Ube2d2a6.556e-2336.52ubiquitin-conjugating enzyme E2D 2A [Source:MGI Sy... [more]
Ube2d2a6.556e-2336.52ubiquitin-conjugating enzyme E2D 2A [Source:MGI Sy... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62257|UBE2H_MOUSE9.220e-7969.28Ubiquitin-conjugating enzyme E2 H OS=Mus musculus ... [more]
sp|P62256|UBE2H_HUMAN9.220e-7969.28Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens ... [more]
sp|Q32LN1|UBE2H_BOVIN9.220e-7969.28Ubiquitin-conjugating enzyme E2 H OS=Bos taurus OX... [more]
sp|Q9P7R4|UBC8_SCHPO2.769e-5856.29Ubiquitin-conjugating enzyme E2 8 OS=Schizosacchar... [more]
sp|P16577|UBC4_WHEAT2.625e-5759.18Ubiquitin-conjugating enzyme E2-23 kDa OS=Triticum... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KP174.196e-8478.06Putative ubiquitin-conjugating enzyme h OS=Schisto... [more]
W6USC23.249e-8378.06Ubiquitin-conjugating enzyme E2 H OS=Echinococcus ... [more]
A0A0R3VYS23.249e-8378.06UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A0R3WM643.249e-8378.06UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A0R3S7J43.431e-8378.06UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2h1.210e-5666.38ubiquitin-conjugating enzyme E2H (UBC8 homolog, ye... [more]
ube2na1.146e-2336.13ubiquitin conjugating enzyme E2 N [Source:NCBI gen... [more]
ube2d2l1.391e-2337.07ubiquitin-conjugating enzyme E2 D2 [Source:NCBI ge... [more]
ube2d2l4.409e-2336.52ubiquitin-conjugating enzyme E2 D2 [Source:NCBI ge... [more]
ube2d2l5.479e-2336.52ubiquitin-conjugating enzyme E2 D2 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006211.16.645e-2334.68pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gen... [more]
ube2t5.048e-2233.86ubiquitin-conjugating enzyme E2T (putative) [Sourc... [more]
ENSPMAT00000008817.15.919e-2235.09pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143... [more]
ENSPMAT00000010378.11.777e-2136.04pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 ... [more]
ube2kb5.565e-2032.82ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, y... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBC82.395e-5353.95Ubiquitin-conjugating enzyme that regulates glucon... [more]
RAD61.408e-2438.94Ubiquitin-conjugating enzyme (E2); involved in pos... [more]
UBC51.550e-2337.39Ubiquitin-conjugating enzyme; mediates selective d... [more]
UBC41.860e-2234.68Ubiquitin-conjugating enzyme (E2); key E2 partner ... [more]
UBC112.922e-2232.87Ubiquitin-conjugating enzyme; most similar in sequ... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO487479.572e-8172.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405951.081e-2439.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313271.081e-2439.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436696.340e-2437.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478872.528e-2233.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2h6.877e-8069.28ubiquitin conjugating enzyme E2 H [Source:NCBI gen... [more]
ENSORLT00000013571.21.110e-7969.93ubiquitin-conjugating enzyme E2 H [Source:NCBI gen... [more]
UBE2D25.632e-2437.39ubiquitin-conjugating enzyme E2 D2 [Source:NCBI ge... [more]
ENSORLT00000014143.21.162e-2336.97ubiquitin conjugating enzyme E2 N [Source:NCBI gen... [more]
UBE2D14.759e-2337.39ubiquitin-conjugating enzyme E2 D4 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin conjugating enzyme E2 H vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064993.11.140e-114100.00SMESG000064993.1[more]
SMESG000064993.14.018e-10897.25SMESG000064993.1[more]
SMESG000061584.12.105e-7369.28SMESG000061584.1[more]
SMESG000072369.11.849e-2438.26SMESG000072369.1[more]
SMESG000045122.13.508e-2335.83SMESG000045122.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003542 ID=SMED30003542|Name=Ubiquitin conjugating enzyme E2 H|organism=Schmidtea mediterranea sexual|type=transcript|length=990bp
CTTGGTCAATTAAATTTAATTTCAACTAAAAAATTTATAAACATTTACAT
CAGCTGACTGTTATTAATGTCTTCTCCAAGTCCTGGTAAAAAAAGAATGG
ATACAGATGTTATTAAATTAATTGAGAAAAAGTATGAAGTTACAATTTTG
AGTGGTCTTAATGAATTGATGGTGAAATTCTATGGTCCTAAAGATACTCC
GTATGAGGGTGGCATTTGGAATATTAAAGTCGAAATACCAGAAAGATATC
CTTATAAATCCCCTTCCATAGGCTTCATGAACAGAATATATCATCCAAAC
ATAGATGAAGCTTATTTTAAATTCAGATCTGGTACCGTATGTCTTGACGT
AATCAATCAGCAGTGGTCTGCACTTTATGATCTTACAAATATTTTTGATT
CATTTCTCCCACAACTCCTATCATACCCTAATCCTACCGATCCTTTGAAT
GGAGAAGCCGCTTCCCTCTTCATGTCAAAGCATAGTGACTATATTGAAAA
AGTCAAAGAGTATGTAAGAAGATATGCTACAGAAGAAGTTTTAAATGGAA
ATATGGTGGAAAATAACGACTCAGAAAATGAAAGCAGCATGTCTGAGTTC
AGTGAAGATGAAGCTCAAGGCATGGAGTTGTGATTGTGTAATAATGCAAT
GCAATCATGGGAAATAACTCTTCTAAATCAGGTCTAATTCAATTCTATTT
ATCCTTAGTCGGTATTGTTACCAATGTCCTCTTGTAATAACAGATTATAA
TTTCTTTACTGTCTATCTTTCTTAGCAAATTTATTAGTTAAGAATCAGAG
TTCTATCTTTTGTGATTGTTGTTTGCGCTGTATGGTGTTTCAGAAGTTGT
TGTGTCAATATCGATTTCTATAAATATTCATTTATACTAAAAACACAAAT
CTGTGTGGTGCCTTTCAATTAATTATTATATTCAGGAACAAATTTATTAT
TAAGATGTTTCGTGAGTTATTATTTTTATTATTATTATTA
back to top

protein sequence of SMED30003542-orf-1

>SMED30003542-orf-1 ID=SMED30003542-orf-1|Name=SMED30003542-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MSSPSPGKKRMDTDVIKLIEKKYEVTILSGLNELMVKFYGPKDTPYEGGI
WNIKVEIPERYPYKSPSIGFMNRIYHPNIDEAYFKFRSGTVCLDVINQQW
SALYDLTNIFDSFLPQLLSYPNPTDPLNGEAASLFMSKHSDYIEKVKEYV
RRYATEEVLNGNMVENNDSENESSMSEFSEDEAQGMEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000608UBQ-conjugat_E2
IPR016135UBQ-conjugating_enzyme/RWD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00212ubc_7coord: 5..155
e-value: 2.1E-42
score: 156.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 174..188
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 161..188
NoneNo IPR availablePANTHERPTHR24068FAMILY NOT NAMEDcoord: 8..182
NoneNo IPR availablePANTHERPTHR24068:SF128UBIQUITIN-CONJUGATING ENZYME E2 Hcoord: 8..182
IPR000608Ubiquitin-conjugating enzyme E2PFAMPF00179UQ_concoord: 24..149
e-value: 1.0E-33
score: 115.9
IPR000608Ubiquitin-conjugating enzyme E2PROSITEPS50127UBIQUITIN_CONJUGAT_2coord: 29..144
score: 32.08
IPR000608Ubiquitin-conjugating enzyme E2CDDcd00195UBCccoord: 31..150
e-value: 2.09118E-44
score: 142.341
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 6..160
e-value: 4.8E-48
score: 164.5
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 5..156