MICAL-like 1

Overview
NameMICAL-like 1
Smed IDSMED30003512
Length (bp)2472
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MICAL-like 1 (SMED30003512) t-SNE clustered cells

Violin plots show distribution of expression levels for MICAL-like 1 (SMED30003512) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MICAL-like 1 (SMED30003512) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MICAL-like 1 (SMED30003512) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003512

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30003512SMESG000065945.1 dd_Smed_v4_4568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30003512SMESG000065945.1 dd_Smed_v4_4568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MICAL-like 1 vs. Ensembl Human
Match: MICALL1 (MICAL like 1 [Source:HGNC Symbol;Acc:HGNC:29804])

HSP 1 Score: 146.747 bits (369), Expect = 1.656e-35
Identity = 64/189 (33.86%), Postives = 110/189 (58.20%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEK---RSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
            L  WC  Q + Y+ ++I + ++S+++GL FCAILHR  PDL+D+D+L+ +N++EN  LAF VAEK  GIP+LL P DM  M  PD L ++TY+SQYYN             +K L+     +     +E + + + +  +  S+SE+   ++ +  C  C + ++ +++     + YHR C+R  + ++
Sbjct:    8 LLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSS 196          

HSP 2 Score: 72.0182 bits (175), Expect = 3.024e-12
Identity = 45/142 (31.69%), Postives = 77/142 (54.23%), Query Frame = 1
Query: 1777 KAPAPSRPLP-PKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR 2199
            + PAP    P  KR+V+ D   ++IP E ++ ++  +  +   +E  G +L+  L      G +  + L  W  L+ +K+ L  +E EL  + K+Q LE R AD+EYELR L++K E   T  + ARE+ L+ +++  +  R
Sbjct:  658 RPPAPGHGFPLIKRKVQAD---QYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGRE-DDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQR 795          
BLAST of MICAL-like 1 vs. Ensembl Human
Match: MICALL2 (MICAL like 2 [Source:HGNC Symbol;Acc:HGNC:29672])

HSP 1 Score: 144.05 bits (362), Expect = 1.142e-34
Identity = 74/214 (34.58%), Postives = 109/214 (50.93%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLS--SIENLNNNVKVIEQKIIKEDDNENDPSVS--------EKRSENH------------------MCEICSEIIYFLEKMTIADKFYHRSCYRQNQ 648
            I+ L  WC  Q + Y+++ I N T S+++GL FCAILHR  PDLI++  L  ENIYEN  LAF VAE+H GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P       K  S  S E  +     ++   +        P +S        ++R+E                     C +C + ++ +++     + YHRSC+R  Q
Sbjct:    4 IRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENNKLAFRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKRASEDSEEEPSGKKAPVQAAKLPSPAPARKPPLSPAQTNPVVQRRNEGAGGPPPKTDQALAGSLVSSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQ 217          

HSP 2 Score: 66.6254 bits (161), Expect = 1.398e-10
Identity = 40/130 (30.77%), Postives = 73/130 (56.15%), Query Frame = 1
Query: 1840 EFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            +++  E +  QL+++  +   +E+ G  L+  L   + + ++ S  +  W  L+ +K  L  +E EL    K Q LE++  D+E ELR LM+K E+ K+  E  RE+EL+ Q + TVN R+ + +  ++D
Sbjct:  733 DYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEGDDAEDS-LMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQELLEQYVSTVNDRSDIVDSLDED 861          
BLAST of MICAL-like 1 vs. Ensembl Human
Match: MICAL3 (microtubule associated monooxygenase, calponin and LIM domain containing 3 [Source:HGNC Symbol;Acc:HGNC:24694])

HSP 1 Score: 120.168 bits (300), Expect = 6.121e-28
Identity = 62/177 (35.03%), Postives = 94/177 (53.11%), Query Frame = 1
Query:   64 IMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKS------KPENQKLLSS----IENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHMCE 564
            +  N S  +   L  WC  QT  Y  + +T+ T SWK+GL  CAI+HR+ PDLID+D+L+ +N+ +N  LAF +AEK  GI  +++ K+M  +  PD+L M+ YL+Q+Y       P S        E   L++S    I  L+   + I +K   +D  E D   + KR +    E
Sbjct:   31 LTRNESVARSSKLLGWCQRQTDGYAGVNVTDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKEMASVGEPDKLSMVMYLTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQTISRKRSPKDKKEKDLDGAGKRRKTSQSE 207          
BLAST of MICAL-like 1 vs. Ensembl Human
Match: MICAL3 (microtubule associated monooxygenase, calponin and LIM domain containing 3 [Source:HGNC Symbol;Acc:HGNC:24694])

HSP 1 Score: 121.324 bits (303), Expect = 3.322e-27
Identity = 49/119 (41.18%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   64 IMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKS 420
            +  N S  +   L  WC  QT  Y  + +T+ T SWK+GL  CAI+HR+ PDLID+D+L+ +N+ +N  LAF +AEK  GI  +++ K+M  +  PD+L M+ YL+Q+Y       P S
Sbjct:  512 LTRNESVARSSKLLGWCQRQTDGYAGVNVTDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKEMASVGEPDKLSMVMYLTQFYEMFKDSLPSS 630          

HSP 2 Score: 55.4546 bits (132), Expect = 5.617e-7
Identity = 37/114 (32.46%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 1870 QLKEVNYKQSEIEIEGRVLQNIL-WETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQL 2208
            QL++V  +Q  +E  G  ++  L  E         + +Q+W  LVQ+KN +   E EL    +  ELEDR + L+ ELR  M+ ++  KT  E + E++++N++L+ V  R  L
Sbjct: 1857 QLQQVEERQRRLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEEELSEEKQILNEMLEVVEQRDSL 1970          
BLAST of MICAL-like 1 vs. Ensembl Human
Match: MICAL3 (microtubule associated monooxygenase, calponin and LIM domain containing 3 [Source:HGNC Symbol;Acc:HGNC:24694])

HSP 1 Score: 120.168 bits (300), Expect = 4.050e-27
Identity = 62/177 (35.03%), Postives = 94/177 (53.11%), Query Frame = 1
Query:   64 IMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKS------KPENQKLLSS----IENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHMCE 564
            +  N S  +   L  WC  QT  Y  + +T+ T SWK+GL  CAI+HR+ PDLID+D+L+ +N+ +N  LAF +AEK  GI  +++ K+M  +  PD+L M+ YL+Q+Y       P S        E   L++S    I  L+   + I +K   +D  E D   + KR +    E
Sbjct:  512 LTRNESVARSSKLLGWCQRQTDGYAGVNVTDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKEMASVGEPDKLSMVMYLTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQTISRKRSPKDKKEKDLDGAGKRRKTSQSE 688          
BLAST of MICAL-like 1 vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 108.612 bits (270), Expect = 5.297e-24
Identity = 54/138 (39.13%), Postives = 78/138 (56.52%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP------------KSKPENQKLLSSIENLNNNV 474
            GL  WC  +T  Y N+ + NF NSWK+GL FCA++HR  PDL+DY  L+  +   N +LAF +AEKH  IP +L  +DM     PD   ++TY+S YY+  S  +             K   EN+K++   ENL +++
Sbjct:   84 GLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDM-ANSQPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDL 220          
BLAST of MICAL-like 1 vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 108.227 bits (269), Expect = 7.093e-24
Identity = 54/138 (39.13%), Postives = 78/138 (56.52%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP------------KSKPENQKLLSSIENLNNNV 474
            GL  WC  +T  Y N+ + NF NSWK+GL FCA++HR  PDL+DY  L+  +   N +LAF +AEKH  IP +L  +DM     PD   ++TY+S YY+  S  +             K   EN+K++   ENL +++
Sbjct:  155 GLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDM-ANSQPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDL 291          
BLAST of MICAL-like 1 vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 104.375 bits (259), Expect = 1.055e-22
Identity = 45/101 (44.55%), Postives = 64/101 (63.37%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNAL 399
            GL  WC  +T  Y N+ + NF NSWK+GL FCA++HR  PDL+DY  L+  +   N +LAF +AEKH  IP +L  +D  + + PD    +TY+S +Y+A 
Sbjct:   84 GLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAED--VSRHPDEKSTMTYVSCFYHAF 182          
BLAST of MICAL-like 1 vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 104.375 bits (259), Expect = 1.277e-22
Identity = 45/101 (44.55%), Postives = 64/101 (63.37%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNAL 399
            GL  WC  +T  Y N+ + NF NSWK+GL FCA++HR  PDL+DY  L+  +   N +LAF +AEKH  IP +L  +D  + + PD    +TY+S +Y+A 
Sbjct:  155 GLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAED--VSRHPDEKSTMTYVSCFYHAF 253          
BLAST of MICAL-like 1 vs. Ensembl Celegans
Match: T15B12.1 (pep chromosome:WBcel235:III:5294501:5298361:1 gene:WBGene00020530.1 transcript:T15B12.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15B12.1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.578e-21
Identity = 45/106 (42.45%), Postives = 62/106 (58.49%), Query Frame = 1
Query:   76 NSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKS-PDRLCMITYLSQYY 390
            N N     L  W  N+   Y N+ +TNF++SW +G+ FCA++HRF P+  D+  L+P N   N DLAF VAE + GI  LL   DM +M   PD  C+ TY+  +Y
Sbjct:  111 NPNSIKDALLRWIQNRVAGYPNVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAEDN-GIFPLLEVDDMIMMGDRPDWKCVFTYVQSFY 215          
BLAST of MICAL-like 1 vs. Ensembl Fly
Match: MICAL-like (gene:FBgn0036333 transcript:FBtr0075898)

HSP 1 Score: 148.673 bits (374), Expect = 2.670e-36
Identity = 77/202 (38.12%), Postives = 111/202 (54.95%), Query Frame = 1
Query:   67 MSNNSNDKI----KGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNL 660
            MS+    K+    K L  WC   T+ Y  +++ N T SW+NGL FCAI+H F PDLID+D L  ++IYEN DLAFT AEK+ GIP+LL   DM   + PDRL ++TYLSQ+Y  L K     KPE        E L    +   QK++          V   R +   C+ C+  ++  E++ +  + YHR+C +  + ++L
Sbjct:    1 MSDRRGTKVGTGTKALEYWCRVVTQGYNGVKVENMTTSWRNGLAFCAIIHHFRPDLIDFDRLKADDIYENNDLAFTTAEKYLGIPALLDAADMVSYEVPDRLSILTYLSQFYKVLGKSLKHPKPE--------EPLGEESEP-PQKVMH--------IVGMPRRDK--CQKCNLPVFLAERVLVGKRAYHRTCLKCARCSSL 183          

HSP 2 Score: 79.337 bits (194), Expect = 1.000e-14
Identity = 50/192 (26.04%), Postives = 101/192 (52.60%), Query Frame = 1
Query: 1744 NKLSSSRHTVQKAPAPSRPLPPKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWE--------TDQNGSQFSEFLQ----------KWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFE--------QQNDDLTIK 2241
            NK +  +   +K PAP+ P+PP++ +      + +P + +  + + +  +Q  +E +G +L+ ++ +        TD +G + +E L           +  +LV +KN+LF ++ EL  + ++  LE   AD+E+E+R LM + E  KT ++ A EE LIN+++  V  R ++ +        +  +D++IK
Sbjct:  749 NKSTHGKWKRRKGPAPAVPIPPRKVL------QRLPLQEIRHEFEIIAVQQLGLEKQGVILEKMIRDRCERSLDATDTDGPESAEVLTNSKEVEDLILQLFELVNEKNELFRRQAELMYLRRQHRLEQEQADIEHEIRVLMGQPEHNKTDSDKAHEEVLINRLVKVVEMRNEVIDSLETDRVREAREDMSIK 934          
BLAST of MICAL-like 1 vs. Ensembl Fly
Match: Ehbp1 (gene:FBgn0034180 transcript:FBtr0114628)

HSP 1 Score: 118.627 bits (296), Expect = 5.935e-27
Identity = 53/131 (40.46%), Postives = 77/131 (58.78%), Query Frame = 1
Query:   25 SF*NSFHDLIKILIMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPK 417
            S  NS   + KI++  N      + L  WC   TKDY N+++TN T SW+NG+ FCAI+H F P+LID   L+  ++  NC + F  AE   GIP ++ P+DM ++  PD+L ++TYL Q     + KQ K
Sbjct:  420 SLNNSLKPVEKIVLKENTPG---QDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGFDAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLK 546          
BLAST of MICAL-like 1 vs. Ensembl Fly
Match: Ehbp1 (gene:FBgn0034180 transcript:FBtr0087019)

HSP 1 Score: 118.242 bits (295), Expect = 7.283e-27
Identity = 53/131 (40.46%), Postives = 77/131 (58.78%), Query Frame = 1
Query:   25 SF*NSFHDLIKILIMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPK 417
            S  NS   + KI++  N      + L  WC   TKDY N+++TN T SW+NG+ FCAI+H F P+LID   L+  ++  NC + F  AE   GIP ++ P+DM ++  PD+L ++TYL Q     + KQ K
Sbjct:  442 SLNNSLKPVEKIVLKENTPG---QDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGFDAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLK 568          
BLAST of MICAL-like 1 vs. Ensembl Fly
Match: Ehbp1 (gene:FBgn0034180 transcript:FBtr0340073)

HSP 1 Score: 118.242 bits (295), Expect = 7.527e-27
Identity = 53/131 (40.46%), Postives = 77/131 (58.78%), Query Frame = 1
Query:   25 SF*NSFHDLIKILIMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPK 417
            S  NS   + KI++  N      + L  WC   TKDY N+++TN T SW+NG+ FCAI+H F P+LID   L+  ++  NC + F  AE   GIP ++ P+DM ++  PD+L ++TYL Q     + KQ K
Sbjct:  442 SLNNSLKPVEKIVLKENTPG---QDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGFDAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLK 568          
BLAST of MICAL-like 1 vs. Ensembl Fly
Match: Ehbp1 (gene:FBgn0034180 transcript:FBtr0114627)

HSP 1 Score: 118.627 bits (296), Expect = 8.196e-27
Identity = 53/131 (40.46%), Postives = 77/131 (58.78%), Query Frame = 1
Query:   25 SF*NSFHDLIKILIMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPK 417
            S  NS   + KI++  N      + L  WC   TKDY N+++TN T SW+NG+ FCAI+H F P+LID   L+  ++  NC + F  AE   GIP ++ P+DM ++  PD+L ++TYL Q     + KQ K
Sbjct:  442 SLNNSLKPVEKIVLKENTPG---QDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGFDAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLK 568          
BLAST of MICAL-like 1 vs. Ensembl Zebrafish
Match: micall1a (MICAL-like 1a [Source:ZFIN;Acc:ZDB-GENE-110119-1])

HSP 1 Score: 160.229 bits (404), Expect = 5.177e-40
Identity = 76/188 (40.43%), Postives = 114/188 (60.64%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDD----NENDPSVSEKRSE-NHMCEICSEIIYFLEKMTIADKFYHRSCYR 639
            +K L +WC NQ   Y N+ ITN T+S+++GL FCAI+HR  PDLID+D+L+ EN++EN  LAF VAE+  GIP+LL  +DM  M  PDRL +ITY+SQYYN  + K         K + S  +       I++ +   +D    NE+   +  KRS  +  C  C + ++ ++++ +  K YHR+C+R
Sbjct:    4 LKALQDWCRNQCASYNNVDITNMTSSFRDGLAFCAIIHRHRPDLIDFDSLSKENVFENNRLAFEVAERELGIPALLDAEDMVSMSVPDRLSIITYVSQYYNFFTNKSHTV----SKCIKSPSSSGYIRSAIKRPLASPEDRDAHNESGADIQPKRSTLSSTCSACGKHVHLVQRILVDGKLYHRNCFR 187          

HSP 2 Score: 76.2554 bits (186), Expect = 1.033e-13
Identity = 44/134 (32.84%), Postives = 76/134 (56.72%), Query Frame = 1
Query: 1810 KREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLF 2211
            KR+V+ D   +FIP E ++ ++ ++  +  E+E  G  L+  L E   N  +    L  W  L+ +K+ L  +E EL    K+Q LE+R AD+EYELR L++K E + T+ +  RE++L+  ++  +  R Q+ 
Sbjct:  673 KRKVQSD---QFIPVEDIHVEMSDLEKRLDELEHRGVDLEKSLREC-SNDEEEEHLLVDWFTLIHEKHLLVRREAELVYTAKQQNLEERQADVEYELRCLLNKPEKEWTSEDKDREKQLMADLVTIIEQRNQIV 802          
BLAST of MICAL-like 1 vs. Ensembl Zebrafish
Match: micall1a (MICAL-like 1a [Source:ZFIN;Acc:ZDB-GENE-110119-1])

HSP 1 Score: 159.844 bits (403), Expect = 6.195e-40
Identity = 76/188 (40.43%), Postives = 114/188 (60.64%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDD----NENDPSVSEKRSE-NHMCEICSEIIYFLEKMTIADKFYHRSCYR 639
            +K L +WC NQ   Y N+ ITN T+S+++GL FCAI+HR  PDLID+D+L+ EN++EN  LAF VAE+  GIP+LL  +DM  M  PDRL +ITY+SQYYN  + K         K + S  +       I++ +   +D    NE+   +  KRS  +  C  C + ++ ++++ +  K YHR+C+R
Sbjct:    4 LKALQDWCRNQCASYNNVDITNMTSSFRDGLAFCAIIHRHRPDLIDFDSLSKENVFENNRLAFEVAERELGIPALLDAEDMVSMSVPDRLSIITYVSQYYNFFTNKSHTV----SKCIKSPSSSGYIRSAIKRPLASPEDRDAHNESGADIQPKRSTLSSTCSACGKHVHLVQRILVDGKLYHRNCFR 187          

HSP 2 Score: 76.2554 bits (186), Expect = 9.631e-14
Identity = 44/134 (32.84%), Postives = 76/134 (56.72%), Query Frame = 1
Query: 1810 KREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLF 2211
            KR+V+ D   +FIP E ++ ++ ++  +  E+E  G  L+  L E   N  +    L  W  L+ +K+ L  +E EL    K+Q LE+R AD+EYELR L++K E + T+ +  RE++L+  ++  +  R Q+ 
Sbjct:  673 KRKVQSD---QFIPVEDIHVEMSDLEKRLDELEHRGVDLEKSLREC-SNDEEEEHLLVDWFTLIHEKHLLVRREAELVYTAKQQNLEERQADVEYELRCLLNKPEKEWTSEDKDREKQLMADLVTIIEQRNQIV 802          
BLAST of MICAL-like 1 vs. Ensembl Zebrafish
Match: micall2b (mical-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5803])

HSP 1 Score: 145.976 bits (367), Expect = 2.928e-36
Identity = 72/209 (34.45%), Postives = 115/209 (55.02%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP--------------KSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHM-----CEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNL 660
            +K L  WC  Q + Y+++ ITN T S+++GL FCA++H+  PDLID+D+L+ ENIYEN   AF VAEK  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P                 P  +K    I  +  + K   +    +  NEN   V  +R+         C +C++ ++ +++  +  K YHR+C++  + + +
Sbjct:    4 VKALQQWCKIQCEGYRDVSITNMTTSFRDGLAFCALIHKHRPDLIDFDSLSKENIYENNQRAFEVAEKELGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMGGIKRPAEESNEAPSGKKNPPVIAKVLPSPKPATENKTPKPANENKREVLTERANKSSTPSSNCSVCNQHVHLVQRHLVDGKLYHRNCFKCKECSTI 212          
BLAST of MICAL-like 1 vs. Ensembl Zebrafish
Match: micall2b (mical-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5803])

HSP 1 Score: 145.976 bits (367), Expect = 2.928e-36
Identity = 72/209 (34.45%), Postives = 115/209 (55.02%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP--------------KSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHM-----CEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNL 660
            +K L  WC  Q + Y+++ ITN T S+++GL FCA++H+  PDLID+D+L+ ENIYEN   AF VAEK  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P                 P  +K    I  +  + K   +    +  NEN   V  +R+         C +C++ ++ +++  +  K YHR+C++  + + +
Sbjct:    4 VKALQQWCKIQCEGYRDVSITNMTTSFRDGLAFCALIHKHRPDLIDFDSLSKENIYENNQRAFEVAEKELGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMGGIKRPAEESNEAPSGKKNPPVIAKVLPSPKPATENKTPKPANENKREVLTERANKSSTPSSNCSVCNQHVHLVQRHLVDGKLYHRNCFKCKECSTI 212          
BLAST of MICAL-like 1 vs. Ensembl Zebrafish
Match: micall2b (mical-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5803])

HSP 1 Score: 147.517 bits (371), Expect = 4.655e-36
Identity = 72/209 (34.45%), Postives = 115/209 (55.02%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP--------------KSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHM-----CEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNL 660
            +K L  WC  Q + Y+++ ITN T S+++GL FCA++H+  PDLID+D+L+ ENIYEN   AF VAEK  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P                 P  +K    I  +  + K   +    +  NEN   V  +R+         C +C++ ++ +++  +  K YHR+C++  + + +
Sbjct:    4 VKALQQWCKIQCEGYRDVSITNMTTSFRDGLAFCALIHKHRPDLIDFDSLSKENIYENNQRAFEVAEKELGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMGGIKRPAEESNEAPSGKKNPPVIAKVLPSPKPATENKTPKPANENKREVLTERANKSSTPSSNCSVCNQHVHLVQRHLVDGKLYHRNCFKCKECSTI 212          

HSP 2 Score: 72.7886 bits (177), Expect = 1.108e-12
Identity = 48/175 (27.43%), Postives = 88/175 (50.29%), Query Frame = 1
Query: 1843 FIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQ---FSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFE--------------QQNDDLTIKSSTNERLKSKNTLRSFFTIKHRSSS 2316
            +IP E +  +LKE+    +E+E +G  L+  L + D++G +    ++ +  W  L++ K     +E EL  I + Q+LE+    ++ ELR LM K +  KT  +  REEEL+ ++++ VN R  + E              Q N  +       E++K  + +  +F+++ R SS
Sbjct:  607 YIPKEDIQKELKEIEMNMNELEKKGVELEKQLRQCDEDGEEDALMNDLMVDWFTLIRNKQVYMRRESELVYIARTQDLEEEQPSVDAELRRLMEKPDHLKTLWDRKREEELMAKLVEIVNDRNAIVEGLDEDRLREEEEDEQLNKMMQSFDMKKEKVKKMSPVTRWFSMRKRRSS 781          
BLAST of MICAL-like 1 vs. Ensembl Xenopus
Match: ttc14 (tetratricopeptide repeat domain 14 [Source:Xenbase;Acc:XB-GENE-989065])

HSP 1 Score: 157.147 bits (396), Expect = 5.079e-39
Identity = 72/180 (40.00%), Postives = 105/180 (58.33%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYR 639
            L  WC  Q + Y  I I + ++S+++GL FCA++HR  PDLID+D+L+ EN++EN  LAF VAE+  GIP+LL P+DM  MK PDRL ++TYLSQYYN      P  KP+              +K   +   KE    + P V  K S +  C +C + ++ +++  +  K YHR C+R
Sbjct:    8 LHFWCSRQCEGYPGILIYDLSSSFRDGLAFCALIHRHRPDLIDFDSLSKENVFENNRLAFEVAERELGIPALLDPEDMVSMKVPDRLSIMTYLSQYYNHFRNSSPVGKPQ--------------LKETSESPSKEPSGGSLPQVGWKLSISSTCALCQQHVHLVQRYLVEGKLYHRQCFR 173          

HSP 2 Score: 76.6406 bits (187), Expect = 1.137e-13
Identity = 50/159 (31.45%), Postives = 85/159 (53.46%), Query Frame = 1
Query: 1774 QKAPAPSRPLPP-------KREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            QK P PSRP  P       KR+V+ D+   +IP + +  +++ +  +  E+E  G  L++ L + + N S     L  W  L+Q+K+ L  +E EL    K+Q LE R AD+EYELR L++K E      +  RE+ L+ +++  +  R  + +  ++D
Sbjct:  571 QKGPKPSRPPAPGHGFPLIKRKVQADD---YIPEDEIQMEMETIELRLDELERRGVELEHRLRKLE-NESDEDSLLVDWFKLIQEKHTLVRRESELVYTTKQQSLEQRQADVEYELRCLLNKPEKDWLEEDKEREQVLMQELVTLIEQRNAIVKCLDED 725          
BLAST of MICAL-like 1 vs. Ensembl Xenopus
Match: dlg5 (discs large homolog 5 [Source:Xenbase;Acc:XB-GENE-978275])

HSP 1 Score: 140.584 bits (353), Expect = 1.510e-33
Identity = 73/216 (33.80%), Postives = 116/216 (53.70%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP-------KSKPENQKLLSSIENLNNNVKVIEQK--------------IIKEDDN-ENDP------SVSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLN 654
            IK L  WC  Q   Y+++ ITN T S+++GL FCAILH+  PDLI++D L+ EN+Y+N  +AF+VAE+  GIP+LL  +DM  ++ PDRL ++TY+SQYYN    + P       K  P +     + + + N+V    Q               ++K +   EN P       +    S +  C IC + ++ +++     K YHR+C++  Q +
Sbjct:    4 IKALQQWCKQQCDGYRDVSITNMTTSFRDGLAFCAILHKHRPDLINFDLLSKENVYDNNHMAFSVAEEKLGIPALLDAEDMVKLRVPDRLSILTYVSQYYNYFHGRSPIGGLAGVKRPPPDTVEEPAGKKVTNDVLPTPQATSRAPQPVPRTNVPVLKSNTVIENPPVRAGIREIDSNSSVSSNCMICGKHVHLVQRHMADGKLYHRNCFKCKQCS 219          

HSP 2 Score: 76.6406 bits (187), Expect = 1.247e-13
Identity = 43/130 (33.08%), Postives = 78/130 (60.00%), Query Frame = 1
Query: 1840 EFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            E+IP E +  QL+ +  +   +E +G  ++  L   D + S+ +  +  W  L+ +K  L  +E EL+ I K+Q LED+ ++++ ELR LM+K +  KT A+  RE++L++Q+L  VN R+ + E  ++D
Sbjct:  843 EYIPEEEIQRQLQIIEQELDALEQQGVEMEKQLRSCDGDESEDT-LMVDWFKLIHEKQLLLRQESELNYISKQQALEDKQSNVDTELRNLMNKPDDLKTPADREREKQLLDQLLVIVNDRSGIVECLDED 971          
BLAST of MICAL-like 1 vs. Ensembl Xenopus
Match: dlg5 (discs large homolog 5 [Source:Xenbase;Acc:XB-GENE-978275])

HSP 1 Score: 139.813 bits (351), Expect = 2.384e-33
Identity = 72/216 (33.33%), Postives = 115/216 (53.24%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP-------KSKPENQKLLSSIENLNNNVKVIEQK--------------IIKEDDNENDPSVSEKRSE-------NHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLN 654
            IK L  WC  Q   Y+++ ITN T S+++GL FCAILH+  PDLI++D L+ EN+Y+N  +AF+VAE+  GIP+LL  +DM  ++ PDRL ++TY+SQYYN    + P       K  P +     + + + N+V    Q               ++K +    +P V     E       +  C IC + ++ +++     K YHR+C++  Q +
Sbjct:    4 IKALQQWCKQQCDGYRDVSITNMTTSFRDGLAFCAILHKHRPDLINFDLLSKENVYDNNHMAFSVAEEKLGIPALLDAEDMVKLRVPDRLSILTYVSQYYNYFHGRSPIGGLAGVKRPPPDTVEEPAGKKVTNDVLPTPQATSRAPQPVPRTNVPVLKSNTVIENPPVRAGIREIDSNSSVSSNCMICGKHVHLVQRHMADGKLYHRNCFKCKQCS 219          

HSP 2 Score: 75.8702 bits (185), Expect = 1.890e-13
Identity = 43/130 (33.08%), Postives = 78/130 (60.00%), Query Frame = 1
Query: 1840 EFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            E+IP E +  QL+ +  +   +E +G  ++  L   D + S+ +  +  W  L+ +K  L  +E EL+ I K+Q LED+ ++++ ELR LM+K +  KT A+  RE++L++Q+L  VN R+ + E  ++D
Sbjct:  781 EYIPEEEIQRQLQIIEQELDALEQQGVEMEKQLRSCDGDESEDT-LMVDWFKLIHEKQLLLRQESELNYISKQQALEDKQSNVDTELRNLMNKPDDLKTPADREREKQLLDQLLVIVNDRSGIVECLDED 909          
BLAST of MICAL-like 1 vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 118.627 bits (296), Expect = 6.418e-28
Identity = 48/111 (43.24%), Postives = 74/111 (66.67%), Query Frame = 1
Query:   76 NSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKK 408
            N+N   + L +WC  +T+ Y+++ I NF++SW +G+ FCA++H F P+  DY+ LNP+N  +N DLAF+ AEKH   P LL  +DM  M+ PD  C+ TY+ ++Y  L +K
Sbjct:  283 NANSIKQMLLDWCKAKTRGYEHVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEKHADCPQLLDAEDMVRMREPDWKCVYTYIQEFYRCLVQK 393          
BLAST of MICAL-like 1 vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 119.013 bits (297), Expect = 1.184e-27
Identity = 48/111 (43.24%), Postives = 74/111 (66.67%), Query Frame = 1
Query:   76 NSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKK 408
            N+N   + L +WC  +T+ Y+++ I NF++SW +G+ FCA++H F P+  DY+ LNP+N  +N DLAF+ AEKH   P LL  +DM  M+ PD  C+ TY+ ++Y  L +K
Sbjct:  346 NANSIKQMLLDWCKAKTRGYEHVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEKHADCPQLLDAEDMVRMREPDWKCVYTYIQEFYRCLVQK 456          
BLAST of MICAL-like 1 vs. Ensembl Mouse
Match: Micall2 (MICAL-like 2 [Source:MGI Symbol;Acc:MGI:2444818])

HSP 1 Score: 151.369 bits (381), Expect = 4.495e-37
Identity = 74/217 (34.10%), Postives = 115/217 (53.00%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP--------KSKPENQKLLSSIENLNNNVKVIEQK---------------IIKEDDNENDPS-----VSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
            IK L  WC  Q + Y+++ ITN T S+++GL FCAILHR  PDLI++  L  ENIYEN  LAF VAE+  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P        +   ++ + LS  + L+   K+                   + + +     PS      +   S + +C +C + ++ +++     + YHRSC+R  Q ++
Sbjct:    4 IKALQEWCRQQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFSALRKENIYENNKLAFQVAEEQLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGIKRPSSDSTEELSGKKGLSQPAKLPSPAQTQRSPLSPARTNPVVQRNEGGSQRPSPKAAPGTAGSSVSSICGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSS 220          

HSP 2 Score: 72.4034 bits (176), Expect = 2.083e-12
Identity = 43/130 (33.08%), Postives = 73/130 (56.15%), Query Frame = 1
Query: 1840 EFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            ++IP E L  QL+++  +   +E+ G  L+  L   + + S+ S  +  W  L+ +K  L   E EL    K Q LE++  DL+ ELR LM K E  K+  +  RE+EL++Q ++TVN R+ + +  ++D
Sbjct:  839 DYIPQEELQRQLQDIESQLDALELRGVELEKRLRAAEGDASEDS-LMVDWFRLIHEKQLLLRLESELMYKSKDQRLEEQQLDLQGELRRLMDKPEGLKSPQDRQREQELLSQYVNTVNDRSDIVDFLDED 967          
BLAST of MICAL-like 1 vs. Ensembl Mouse
Match: Micall1 (microtubule associated monooxygenase, calponin and LIM domain containing -like 1 [Source:MGI Symbol;Acc:MGI:105870])

HSP 1 Score: 141.739 bits (356), Expect = 1.211e-36
Identity = 83/246 (33.74%), Postives = 131/246 (53.25%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNAL--SKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSE---NHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNLKIRNKTLERPTVPVSDQTNPLNTKEKDTLLVR---SRQSSGNKSPKTVYKSQRK 813
            L  WC  Q + Y+ + I + ++S+++GL FCAILHR  PDL+D+ +L+ EN++EN  LAF VAEK  GIP+LL P DM  M  PD L ++TY+SQYYN    S +   S P+  K  +     + +  V   +  + DD   D S+SE+  +   +  C  C + ++ +++     + YHR C+R  Q ++      TL    VP S  + P    E+ T +     +R   G++S   +   QR+
Sbjct:    8 LLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKPGKDPAPPSPTSTSPAVQPGEEAQGDDLSPD-SLSEQGKQQPPSSACAACGQRVHLVQRYLAEGRLYHRHCFRCRQCSS------TL----VPGSYSSGP----EEGTFVCAERCTRLGPGSRSGTRLLSQQRQ 238          
BLAST of MICAL-like 1 vs. Ensembl Mouse
Match: Micall1 (microtubule associated monooxygenase, calponin and LIM domain containing -like 1 [Source:MGI Symbol;Acc:MGI:105870])

HSP 1 Score: 146.747 bits (369), Expect = 9.964e-36
Identity = 70/192 (36.46%), Postives = 110/192 (57.29%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNAL--SKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSE---NHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
             L  WC  Q + Y+ + I + ++S+++GL FCAILHR  PDL+D+ +L+ EN++EN  LAF VAEK  GIP+LL P DM  M  PD L ++TY+SQYYN    S +   S P+  K  +     + +  V   +  + DD   D S+SE+  +   +  C  C + ++ +++     + YHR C+R  Q ++
Sbjct:    7 ALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKPGKDPAPPSPTSTSPAVQPGEEAQGDDLSPD-SLSEQGKQQPPSSACAACGQRVHLVQRYLAEGRLYHRHCFRCRQCSS 197          

HSP 2 Score: 75.485 bits (184), Expect = 1.948e-13
Identity = 46/142 (32.39%), Postives = 78/142 (54.93%), Query Frame = 1
Query: 1777 KAPAPSRPLP-PKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR 2199
            + PAP    P  KR+V+ D   ++IP E +Y ++  +  +   +E  G +L+  L      GS+  + L  W  L+ +K+ L  +E EL  + K+Q LE R AD+E+ELR L++K E   T  + ARE+ L+ +++  +  R
Sbjct:  665 RPPAPGHGFPLIKRKVQAD---QYIPEEDIYGEMDNIERQLDALEHSGVLLEEKLRGGANEGSE-DDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTDEDRAREKVLMQELMTLIEQR 802          
BLAST of MICAL-like 1 vs. Ensembl Mouse
Match: Mical3 (microtubule associated monooxygenase, calponin and LIM domain containing 3 [Source:MGI Symbol;Acc:MGI:2442733])

HSP 1 Score: 120.939 bits (302), Expect = 2.385e-27
Identity = 47/109 (43.12%), Postives = 72/109 (66.06%), Query Frame = 1
Query:   64 IMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYY 390
            +  N S  +   L  WC  QT+ Y  + +T+ T SWK+GL  CAI+HR+ PDLID+D+L+ +N+ +N  LAF +AEK  GI  +++ K+M  +  PD+L M+ YL+Q+Y
Sbjct:  512 LTRNESVARSSKLLGWCQRQTEGYSGVNVTDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKEMASVGEPDKLSMVMYLTQFY 620          

HSP 2 Score: 62.7734 bits (151), Expect = 1.946e-9
Identity = 40/121 (33.06%), Postives = 66/121 (54.55%), Query Frame = 1
Query: 1870 QLKEVNYKQSEIEIEGRVLQNIL-WETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR---AQLFEQQ 2220
            QL++V  KQ ++E  G  ++  L  E         + +Q+W  LVQ+KN +   E EL    +  ELEDR + L+ ELR  M+ ++  KT  E + E++++N++L+ V  R     L E+Q
Sbjct: 1869 QLEQVEEKQRQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEGELSEEKKILNEMLEVVEQRDSLVALLEEQ 1989          
BLAST of MICAL-like 1 vs. Ensembl Mouse
Match: Mical3 (microtubule associated monooxygenase, calponin and LIM domain containing 3 [Source:MGI Symbol;Acc:MGI:2442733])

HSP 1 Score: 120.939 bits (302), Expect = 2.418e-27
Identity = 47/109 (43.12%), Postives = 72/109 (66.06%), Query Frame = 1
Query:   64 IMSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYY 390
            +  N S  +   L  WC  QT+ Y  + +T+ T SWK+GL  CAI+HR+ PDLID+D+L+ +N+ +N  LAF +AEK  GI  +++ K+M  +  PD+L M+ YL+Q+Y
Sbjct:  512 LTRNESVARSSKLLGWCQRQTEGYSGVNVTDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKEMASVGEPDKLSMVMYLTQFY 620          

HSP 2 Score: 62.7734 bits (151), Expect = 1.959e-9
Identity = 40/121 (33.06%), Postives = 66/121 (54.55%), Query Frame = 1
Query: 1870 QLKEVNYKQSEIEIEGRVLQNIL-WETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR---AQLFEQQ 2220
            QL++V  KQ ++E  G  ++  L  E         + +Q+W  LVQ+KN +   E EL    +  ELEDR + L+ ELR  M+ ++  KT  E + E++++N++L+ V  R     L E+Q
Sbjct: 1848 QLEQVEEKQRQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEGELSEEKKILNEMLEVVEQRDSLVALLEEQ 1968          
BLAST of MICAL-like 1 vs. UniProt/SwissProt
Match: sp|D3ZEN0|MILK2_RAT (MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 2.229e-37
Identity = 81/218 (37.16%), Postives = 116/218 (53.21%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSS--IENLNNNVKVIEQ--KIIKEDDNENDP--------------SVSEK-----------RSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
            IK L  WC  Q + Y+++ ITN T S+++GL FCAILHR  PDLI+++ L  ENIYEN  LAF VAE+  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P       K  SS   E L+   KV  Q  K+      +  P               VSE+            S + +C +C + ++ +++     + YHRSC+R  Q ++
Sbjct:    4 IKALQEWCRQQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFNALRKENIYENNKLAFQVAEEQLGIPALLDAEDMVALKIPDRLSILTYVSQYYNYFHGRSPIGGMAGMKRPSSDSTEELSGKKKVPSQPAKLSSPVPTQRLPLSPARTNPVVQRNEGVSERPSPKAAPGTVGSSVSSICGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSS 221          

HSP 2 Score: 72.7886 bits (177), Expect = 1.029e-11
Identity = 43/129 (33.33%), Postives = 71/129 (55.04%), Query Frame = 1
Query: 1843 FIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            +I  E L  QL+++  +   +E+ G  L+  L   + + S+    +  W  L+ +K  L  +E EL    K Q LE+R  DL+ ELR LM K E  K+  +  RE+EL+NQ ++TVN R+ + +  ++D
Sbjct:  845 YISQEELQRQLQDIERQLDALELRGVELEKRLRAAEGDASE-DGLMVDWFRLIHEKQLLLRRESELMYKSKDQCLEERQLDLQGELRRLMEKPEGLKSPQDRKREQELLNQYVNTVNDRSDIVDNLDED 972          
BLAST of MICAL-like 1 vs. UniProt/SwissProt
Match: sp|Q3TN34|MILK2_MOUSE (MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.144e-36
Identity = 74/217 (34.10%), Postives = 115/217 (53.00%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP--------KSKPENQKLLSSIENLNNNVKVIEQK---------------IIKEDDNENDPS-----VSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
            IK L  WC  Q + Y+++ ITN T S+++GL FCAILHR  PDLI++  L  ENIYEN  LAF VAE+  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P        +   ++ + LS  + L+   K+                   + + +     PS      +   S + +C +C + ++ +++     + YHRSC+R  Q ++
Sbjct:    4 IKALQEWCRQQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFSALRKENIYENNKLAFQVAEEQLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGIKRPSSDSTEELSGKKGLSQPAKLPSPAQTQRSPLSPARTNPVVQRNEGGSQRPSPKAAPGTAGSSVSSICGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSS 220          

HSP 2 Score: 72.4034 bits (176), Expect = 1.457e-11
Identity = 43/130 (33.08%), Postives = 73/130 (56.15%), Query Frame = 1
Query: 1840 EFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            ++IP E L  QL+++  +   +E+ G  L+  L   + + S+ S  +  W  L+ +K  L   E EL    K Q LE++  DL+ ELR LM K E  K+  +  RE+EL++Q ++TVN R+ + +  ++D
Sbjct:  839 DYIPQEELQRQLQDIESQLDALELRGVELEKRLRAAEGDASEDS-LMVDWFRLIHEKQLLLRLESELMYKSKDQRLEEQQLDLQGELRRLMDKPEGLKSPQDRQREQELLSQYVNTVNDRSDIVDFLDED 967          
BLAST of MICAL-like 1 vs. UniProt/SwissProt
Match: sp|D3ZQL6|MILK1_RAT (MICAL-like protein 1 OS=Rattus norvegicus OX=10116 GN=Micall1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.779e-35
Identity = 70/192 (36.46%), Postives = 111/192 (57.81%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNAL--SKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEK---RSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
             L  WC  Q + Y+ + I + ++S+++GL FCAILHR  PDL+D+ +L+ EN++EN  LAF VAEK  GIP+LL P DM  M  PD L ++TY+SQYYN    S +   S P+  K  ++    + +  V   +  + DD   D S+SE+   +  +  C  C + ++ +++     + YHR C+R  Q ++
Sbjct:    7 ALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKPGKDPAAPSPTSTSPAVQPGEEAQGDDLSPD-SLSEQGKPQPPSSACAACGQRVHLVQRYLAEGRLYHRHCFRCRQCSS 197          

HSP 2 Score: 75.8702 bits (185), Expect = 9.417e-13
Identity = 46/142 (32.39%), Postives = 78/142 (54.93%), Query Frame = 1
Query: 1777 KAPAPSRPLP-PKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR 2199
            + PAP    P  KR+V+ D   ++IP E +Y ++  +  +   +E  G +L+  L      GS+  + L  W  L+ +K+ L  +E EL  + K+Q LE R AD+E+ELR L++K E   T  + ARE+ L+ +++  +  R
Sbjct:  650 RPPAPGHGFPLIKRKVQAD---QYIPEEDIYGEMDSIERQLDALEHSGVLLEEKLRGGANEGSE-DDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTDDDRAREKVLMQELMTLIEQR 787          
BLAST of MICAL-like 1 vs. UniProt/SwissProt
Match: sp|E1BBG2|MILK1_BOVIN (MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 5.688e-35
Identity = 69/191 (36.13%), Postives = 111/191 (58.12%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPK--SKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEK---RSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
            L  WC  Q + Y+ + I + ++S+++GL FCAILHR  PDL+D+D+L+ +N++EN  LAF VAEK  GIP+LL P DM  M  PD L ++TY+SQYYN  +   P   S P    +LSS  +  +       +   E+ +    S+S++   R+ +  C  C + ++ +++     K YHR C+R  + ++
Sbjct:    8 LLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFAGSGPAGVSSPRKGLVLSSPPSEASTPADPGDRAQGEECSSG--SLSKQGSHRTPSSTCAACQQHVHLVQRYLADGKLYHRHCFRCRRCSS 196          

HSP 2 Score: 70.0922 bits (170), Expect = 7.086e-11
Identity = 44/142 (30.99%), Postives = 76/142 (53.52%), Query Frame = 1
Query: 1777 KAPAPSRPLP-PKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR 2199
            + PAP    P  KR+V+ D   ++IP E ++ ++  +  +   +E  G +L+  L      G +  + L  W  L+ +K+ L  +E EL  + K+Q LE R AD+EYELR L++K E   T  +  RE+ L+ +++  +  R
Sbjct:  648 RPPAPGHGFPLIKRKVQSD---QYIPEEDIHGEIDTIERQLDALEHRGVLLEEKLRGGVNEGRE-DDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRGREKVLMQELVTLIEQR 785          
BLAST of MICAL-like 1 vs. UniProt/SwissProt
Match: sp|Q8BGT6|MILK1_MOUSE (MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 6.970e-35
Identity = 70/192 (36.46%), Postives = 110/192 (57.29%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNAL--SKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSE---NHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNN 657
             L  WC  Q + Y+ + I + ++S+++GL FCAILHR  PDL+D+ +L+ EN++EN  LAF VAEK  GIP+LL P DM  M  PD L ++TY+SQYYN    S +   S P+  K  +     + +  V   +  + DD   D S+SE+  +   +  C  C + ++ +++     + YHR C+R  Q ++
Sbjct:    7 ALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKPGKDPAPPSPTSTSPAVQPGEEAQGDDLSPD-SLSEQGKQQPPSSACAACGQRVHLVQRYLAEGRLYHRHCFRCRQCSS 197          

HSP 2 Score: 75.485 bits (184), Expect = 1.362e-12
Identity = 46/142 (32.39%), Postives = 78/142 (54.93%), Query Frame = 1
Query: 1777 KAPAPSRPLP-PKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR 2199
            + PAP    P  KR+V+ D   ++IP E +Y ++  +  +   +E  G +L+  L      GS+  + L  W  L+ +K+ L  +E EL  + K+Q LE R AD+E+ELR L++K E   T  + ARE+ L+ +++  +  R
Sbjct:  665 RPPAPGHGFPLIKRKVQAD---QYIPEEDIYGEMDNIERQLDALEHSGVLLEEKLRGGANEGSE-DDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTDEDRAREKVLMQELMTLIEQR 802          
BLAST of MICAL-like 1 vs. TrEMBL
Match: A0A0B7BLS7 (Calponin-homology (CH) domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF193263 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 7.827e-43
Identity = 80/203 (39.41%), Postives = 121/203 (59.61%), Query Frame = 1
Query:   88 KIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLS---------SIENLNNNVKVIEQKIIKEDDNENDPSVSEK---RSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNL 660
            KIKGL  WC   T  Y ++ ++NFT SW++G+ FCA++HRF PDLIDY++L PEN+++NC LAF VAE+   IP+ L  +DM  +++PD+L +ITY+SQYYN LS       P  + ++S         S ++ +      ++  + E   EN   V +K    S   +C IC   +Y LE+     K YHRSC+R ++L+ +
Sbjct:    5 KIKGLQQWCRRMTDGYDHVDVSNFTTSWRDGMAFCALIHRFRPDLIDYESLVPENVFDNCKLAFEVAEQELDIPAFLEAEDMARLRAPDKLSVITYVSQYYNILSPLPQLGGPGVRSVVSHRTVSATKRSTDSTSQYSPATKRAPVME-TKENAAPVMQKAVSASIGDICGICHRRVYLLERHMEGGKLYHRSCFRHSELSAV 206          
BLAST of MICAL-like 1 vs. TrEMBL
Match: A0A0B7BLS2 (Calponin-homology (CH) domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF193230 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.269e-42
Identity = 80/203 (39.41%), Postives = 121/203 (59.61%), Query Frame = 1
Query:   88 KIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLS---------SIENLNNNVKVIEQKIIKEDDNENDPSVSEK---RSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNL 660
            KIKGL  WC   T  Y ++ ++NFT SW++G+ FCA++HRF PDLIDY++L PEN+++NC LAF VAE+   IP+ L  +DM  +++PD+L +ITY+SQYYN LS       P  + ++S         S ++ +      ++  + E   EN   V +K    S   +C IC   +Y LE+     K YHRSC+R ++L+ +
Sbjct:    5 KIKGLQQWCRRMTDGYDHVDVSNFTTSWRDGMAFCALIHRFRPDLIDYESLVPENVFDNCKLAFEVAEQELDIPAFLEAEDMARLRAPDKLSVITYVSQYYNILSPLPQLGGPGVRSVVSHRTVSATKRSTDSTSQYSPATKRAPVME-TKENAAPVMQKAVSASIGDICGICHRRVYLLERHMEGGKLYHRSCFRHSELSAV 206          
BLAST of MICAL-like 1 vs. TrEMBL
Match: A0A2C9JFT6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106054470 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.779e-41
Identity = 84/201 (41.79%), Postives = 121/201 (60.20%), Query Frame = 1
Query:   88 KIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIE---------QKIIKEDDNENDPSVSEKRSENHM---CEICSEIIYFLEKMTIADKFYHRSCYRQNQLN 654
            KIKGL  WC   T+ Y N+ I NFT SW+NGL FCAI+HRF PDLID+D+L+P+++++NC LAF +AEK   IP+ L   DM  +K PD+L +ITY+SQYYN L        P  +  +SS +N++   +  E         +K   +   EN   ++EK  +  +   C IC + +Y LE+     K YHRSC+R ++L+
Sbjct:    4 KIKGLQMWCKKMTEGYPNVDIANFTTSWRNGLAFCAIIHRFRPDLIDFDSLSPDDVFDNCKLAFELAEKELQIPAFLEASDMARLKVPDKLSIITYVSQYYNYLHALPQLGGPGVKAKVSS-KNISGTKRPPEVDVSLAPTTKKASTDLAKENSTPMAEKNPKEPLVNKCAICQKQVYLLERHMEGGKLYHRSCFRHSELS 203          

HSP 2 Score: 62.003 bits (149), Expect = 7.045e-6
Identity = 49/161 (30.43%), Postives = 84/161 (52.17%), Query Frame = 1
Query: 1825 GDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWE---TDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDDLTIKSSTNERLKSKNTLRSFFTI 2298
            G  S   I    L  QL +++ + +++EI GR L++ + +   +D N     E + +W  L+ +KNDL  KE +L  I + QELE+    +EY+LR+L++  E  K+  E   EE LI +       + +L EQ+N  + + S   +RL+ +   R   T+
Sbjct: 1291 GKKSPGHISVIELQQQLMDIDSRLTDLEIRGRDLEDSIRKVSTSDDNDDD--ELMIEWFSLITEKNDLVRKEADLVYISREQELENEQEKIEYQLRYLLNIDEHLKSPEEKKEEEYLIQR-------KVELVEQRN--VIVDSIDEDRLRYEEEDRQIKTV 1440          
BLAST of MICAL-like 1 vs. TrEMBL
Match: A0A433U1Z2 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_004514 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.641e-40
Identity = 81/203 (39.90%), Postives = 117/203 (57.64%), Query Frame = 1
Query:   88 KIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVK-----------VIEQKIIKEDDNENDPSVSEKRSENHM---CEICSEIIYFLEKMTIADKFYHRSCYRQNQLN 654
            KIKGL  WC   T  Y ++ + NFT +W++G+ FCAI+HRF PDLIDYD+L+P+N+++NC +AF VAE+   IP+ L  +DM  +K PD+L +ITY+SQYYN L+       P  +  +SS  N     K             ++     D  EN  + +EK  +  +   C IC   +Y LE+     K YHRSCYR ++L+
Sbjct:    5 KIKGLQMWCRRMTDGYAHVDVANFTTAWRDGMAFCAIIHRFRPDLIDYDSLSPDNVFDNCKMAFEVAERELNIPAFLEAEDMARLKVPDKLSVITYVSQYYNFLNALPQLGGPGVKCKVSS--NNTGGTKRPPDIDTSQGPSTKKPATAADGKENISAGNEKTRQGSLGDKCNICQNRVYLLERHIEDGKLYHRSCYRHSELS 205          
BLAST of MICAL-like 1 vs. TrEMBL
Match: A0A1W2W0M8 (MICAL-like protein 1 isoform X1 OS=Ciona intestinalis OX=7719 GN=LOC100185097 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.052e-38
Identity = 81/209 (38.76%), Postives = 123/209 (58.85%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKV--IEQKIIKE----------DDNENDPSVSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNLKIRNKTL 681
            +K L  WC    + YK++ I N T SW++GL FCA++HRF PDLID+D+L+ EN+  N  LAFTV EK  GI +LL  +DM  M+ PD+L +ITY+SQYYN L K +P    +  K  S++++    VK+   E + +K+          + N   PS+  K     +CEIC + ++ +E+     K YHR C+R   L+ +  R+K++
Sbjct:    6 MKALQTWCQRNVEGYKDVNIVNMTTSWRDGLAFCALIHRFRPDLIDFDSLSKENVLHNNQLAFTVGEKELGIAALLDAEDMVAMQVPDKLSIITYVSQYYNRLHKMKPADDEKPLKRKSTLQSTPEFVKIKRKEPEPVKKVGSTSQPLAINSNFTRPSLPSKPQVFSVCEICKKKVHLVERFIDEGKVYHRQCHRTKSLSGMYRRDKSI 214          
BLAST of MICAL-like 1 vs. Ensembl Cavefish
Match: micall1a (MICAL like 1 [Source:NCBI gene;Acc:103030047])

HSP 1 Score: 157.147 bits (396), Expect = 5.334e-39
Identity = 76/188 (40.43%), Postives = 117/188 (62.23%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVK----VIEQKIIKEDDNENDPSVSEKRSE-NHMCEICSEIIYFLEKMTIADKFYHRSCYR 639
            +K L  WC  Q +DY +++I N ++S+++GL FCAI+HR  PDLID+++L+ EN+YEN  LAF VAE+  GIP+LL P+DME MK PDRL +ITY+SQYYN  + K   + P   K  S   ++   +K     +E +  + + N +      KRS  +  C  C + ++ +++  +  K YHR+C+R
Sbjct:    4 LKALQEWCRLQCEDYNDVEIKNMSSSFRDGLAFCAIIHRHRPDLIDFNSLSKENVYENNRLAFEVAERELGIPALLDPEDMENMKVPDRLSIITYVSQYYNFFTNKS-HANPPLIKRPSGTGHIEPALKRPPTPLENRTPQAESNADG---QLKRSTLSSTCAACGKHVHLVQRFLVDGKLYHRNCFR 187          

HSP 2 Score: 70.0922 bits (170), Expect = 6.499e-12
Identity = 42/140 (30.00%), Postives = 76/140 (54.29%), Query Frame = 1
Query: 1810 KREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            KR+V+ D   ++IP E ++ ++  +  +  E+E  G  L+  L +   N       L  W  L+ +K+ L  +E EL    K+Q LE+R AD+EYELR L++K E + +  +  RE++L+ +++  +  R Q+    + D
Sbjct:  724 KRKVQSD---QYIPVEDIHVEMGGLERQLDELEHRGVELEQRLRDCS-NEEHEERLLVDWFTLIHEKHLLVRREAELVYTAKQQNLEERQADVEYELRCLLNKPEKEWSDDDRDREKQLMAELVTIIEQRNQIINSMDQD 859          
BLAST of MICAL-like 1 vs. Ensembl Cavefish
Match: micall2a (mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-5409])

HSP 1 Score: 128.257 bits (321), Expect = 1.264e-30
Identity = 53/108 (49.07%), Postives = 75/108 (69.44%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP 414
            IK L  WC  Q   Y+++ I N T S+++GL FCA++H+F PDLI ++ L+ +N+Y+N  LAF VAE H GIP+LL  +DM  +  PDRL ++TY+SQYYN  S + P
Sbjct:    4 IKALQQWCKLQCDGYRDVSIINMTTSFRDGLAFCALIHKFRPDLIKFETLSKDNVYDNNHLAFRVAEDHLGIPALLDAEDMVALPVPDRLSILTYVSQYYNYFSGRSP 111          
BLAST of MICAL-like 1 vs. Ensembl Cavefish
Match: micall2a (mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-5409])

HSP 1 Score: 128.257 bits (321), Expect = 1.650e-30
Identity = 53/108 (49.07%), Postives = 75/108 (69.44%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP 414
            IK L  WC  Q   Y+++ I N T S+++GL FCA++H+F PDLI ++ L+ +N+Y+N  LAF VAE H GIP+LL  +DM  +  PDRL ++TY+SQYYN  S + P
Sbjct:    4 IKALQQWCKLQCDGYRDVSIINMTTSFRDGLAFCALIHKFRPDLIKFETLSKDNVYDNNHLAFRVAEDHLGIPALLDAEDMVALPVPDRLSILTYVSQYYNYFSGRSP 111          
BLAST of MICAL-like 1 vs. Ensembl Cavefish
Match: micall2a (mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-5409])

HSP 1 Score: 128.257 bits (321), Expect = 2.385e-30
Identity = 53/108 (49.07%), Postives = 75/108 (69.44%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP 414
            IK L  WC  Q   Y+++ I N T S+++GL FCA++H+F PDLI ++ L+ +N+Y+N  LAF VAE H GIP+LL  +DM  +  PDRL ++TY+SQYYN  S + P
Sbjct:    4 IKALQQWCKLQCDGYRDVSIINMTTSFRDGLAFCALIHKFRPDLIKFETLSKDNVYDNNHLAFRVAEDHLGIPALLDAEDMVALPVPDRLSILTYVSQYYNYFSGRSP 111          
BLAST of MICAL-like 1 vs. Ensembl Cavefish
Match: micall2a (mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-5409])

HSP 1 Score: 128.257 bits (321), Expect = 2.989e-30
Identity = 53/108 (49.07%), Postives = 75/108 (69.44%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP 414
            IK L  WC  Q   Y+++ I N T S+++GL FCA++H+F PDLI ++ L+ +N+Y+N  LAF VAE H GIP+LL  +DM  +  PDRL ++TY+SQYYN  S + P
Sbjct:    4 IKALQQWCKLQCDGYRDVSIINMTTSFRDGLAFCALIHKFRPDLIKFETLSKDNVYDNNHLAFRVAEDHLGIPALLDAEDMVALPVPDRLSILTYVSQYYNYFSGRSP 111          
BLAST of MICAL-like 1 vs. Ensembl Sea Lamprey
Match: mical3b (Danio rerio microtubule associated monooxygenase, calponin and LIM domain containing 3b (mical3b), mRNA. [Source:RefSeq mRNA;Acc:NM_001353875])

HSP 1 Score: 119.398 bits (298), Expect = 8.339e-28
Identity = 46/108 (42.59%), Postives = 73/108 (67.59%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSK 423
            L +WC  QT+ Y+ +++ +FT SWK+GL  CAI+HR+ PDLID+D+L+  N+  N  LAF VAE+ FGI  +++ +++  +  PD+L M+ YLSQ+Y       P ++
Sbjct:  522 LLSWCQRQTEGYRGVRVVDFTGSWKSGLALCAIIHRYRPDLIDFDSLDERNVAGNNQLAFDVAEREFGISPIITGQEVAGVADPDKLSMVMYLSQFYEMFRDTLPPAE 629          
BLAST of MICAL-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 1.170e-23
Identity = 49/114 (42.98%), Postives = 68/114 (59.65%), Query Frame = 1
Query:   94 KGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQ 435
            +GL  WC  +T  YKN+ + NF  SWK+GL F A++HR  PDLIDYD L  ++   N + AF VAEK+  IP +L  +D+     PD   ++TY+S YY+A S  Q      N+
Sbjct:  117 EGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAFSGAQKAETAANR 230          
BLAST of MICAL-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 5.130e-23
Identity = 52/139 (37.41%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   94 KGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKP------------ENQKLLSSIENLNNNV 474
            +GL  WC  +T  YKN+ + NF  SWK+GL F A++HR  PDLIDY+ L  ++   N + AF VAEK+  IP +L  +D+     PD   ++TY+S YY+A S  Q                 EN+KL+   E++ +++
Sbjct:  113 EGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNQENEKLMEDYEHMASDL 251          
BLAST of MICAL-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 1.204e-22
Identity = 48/131 (36.64%), Postives = 79/131 (60.31%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQ 489
             L  WC  +T  Y N+++ NFT SW++GL F A++H+  PDLID+D L+P + Y N   AF VAE+  G+  LL  +D+ + + PD   +ITY+  YY+  SK +  +  E +++   +E+     ++IE+
Sbjct:  130 ALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAEDIAV-EHPDEKSVITYVVTYYHYFSKMKALA-VEGKRIGKVLESAMETDQMIEK 258          
BLAST of MICAL-like 1 vs. Ensembl Sea Lamprey
Match: mical1 (microtubule associated monooxygenase, calponin and LIM domain containing 1 [Source:NCBI gene;Acc:568573])

HSP 1 Score: 102.064 bits (253), Expect = 1.276e-22
Identity = 45/106 (42.45%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIM-KSPDRLCMITYLSQYYNALSKKQP 414
            L  WC   T+ Y  + IT+ T SW+NGL  CA++HRF PDLI++  L+ EN  EN   AF VAE+  GI  + + ++M      PD L M+ YL+++YN L    P
Sbjct:  525 LIRWCQECTRGYPGVNITDLTTSWQNGLALCALIHRFYPDLIEFIKLDAENAVENNRQAFEVAERELGIAPITTAEEMGCQDGGPDLLAMVAYLTRFYNLLGNTPP 630          
BLAST of MICAL-like 1 vs. Ensembl Nematostella
Match: EDO47999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ7])

HSP 1 Score: 123.25 bits (308), Expect = 1.018e-28
Identity = 51/109 (46.79%), Postives = 73/109 (66.97%), Query Frame = 1
Query:   94 KGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKS 420
            + L  W   QT  YK++ + N T SW++GL FCAI+HR+ PDLID++ L+ ENI EN  LAF++ ++HF IP+LL   DM    +PD+L +I+Y+SQ +N    K P S
Sbjct:   32 RALLLWSRQQTDGYKDVNVYNMTTSWRDGLAFCAIIHRYRPDLIDFEKLSKENIVENNTLAFSICDRHFEIPALLDVADMVECTAPDKLTVISYVSQLFNYFKDKTPGS 140          

HSP 2 Score: 58.151 bits (139), Expect = 1.484e-8
Identity = 36/140 (25.71%), Postives = 78/140 (55.71%), Query Frame = 1
Query: 1855 ESLYSQLKEVNYKQSEIEIEGRVLQNIL---WETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDDLTIKSSTNERLK 2265
            E + ++LK +     ++E+ G  ++ +L    E+D       E L++WL L+ +KN +  +E EL  +++  + E+R+  +E ELR L+S ++  K++ +  RE +L+ ++L+ V  R+ + +   +D   +   +E +K
Sbjct:  976 EEMTAELKALETLNYDLELRGVEMEKLLRHSMESDHPLDNEDEILREWLTLIHEKNVILRRESELIYLMQFHQYEERYWAVECELRGLVSMRDEVKSSDDVRRERDLLAELLNLVQKRSFIVDSLEEDRIREKQEDENIK 1115          
BLAST of MICAL-like 1 vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 114.39 bits (285), Expect = 5.102e-26
Identity = 50/105 (47.62%), Postives = 70/105 (66.67%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQ 411
            GL  WC  +T  YKN+ + NFT S+K+GL FCA++HR  PDLIDYD+L  E+   N + AF VAE++  IP +L P+DM   + PD   ++TY+S YY+A +  Q
Sbjct:  145 GLLLWCQRKTAPYKNVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAFTSSQ 249          
BLAST of MICAL-like 1 vs. Ensembl Nematostella
Match: EDO38282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDB7])

HSP 1 Score: 112.849 bits (281), Expect = 6.747e-26
Identity = 47/100 (47.00%), Postives = 68/100 (68.00%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNAL 399
            L  WC  QTK YK++ I + ++SWK+GL FCAI+HRF PDL+++D+L P +   NC LAF  AE+  GIP  +S  +M    +PD L +++Y+SQYY + 
Sbjct:  521 LLKWCQKQTKSYKHVDINDMSSSWKDGLAFCAIIHRFRPDLLNFDSLKPGDTETNCKLAFETAEEQLGIPPQISASEMVTSGNPDPLMIMSYISQYYESF 620          
BLAST of MICAL-like 1 vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 96.6709 bits (239), Expect = 1.612e-21
Identity = 47/113 (41.59%), Postives = 64/113 (56.64%), Query Frame = 1
Query:   67 MSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSK 405
            MS       + L  WC   T+ Y ++ I NF+ SW+NGL F A+LH+  PDLIDY  L P     N + AFTVAE+  GI  LL  +D++  +  DR  M TY++ YY   +K
Sbjct:  138 MSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVM-TYVAAYYQYFAK 249          
BLAST of MICAL-like 1 vs. Ensembl Nematostella
Match: EDO41099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D1])

HSP 1 Score: 97.8265 bits (242), Expect = 3.522e-21
Identity = 43/101 (42.57%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  100 LFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALS 402
            L +WC N TK YK + +TNFT SW++GL F A++HR+ PDL  YD L   +   NC+ AF VA    G+ SLL  +D+ +   PD+  +I Y++   + LS
Sbjct:  130 LLSWCQNTTKGYKGVSVTNFTTSWRDGLAFNAVIHRYRPDLFSYDALVGSSPMSNCEHAFKVARDSLGVDSLLDAEDV-VRDRPDKKSIIMYVTMLCHKLS 229          
BLAST of MICAL-like 1 vs. Ensembl Medaka
Match: micall1a (MICAL like 1 [Source:NCBI gene;Acc:101158997])

HSP 1 Score: 152.91 bits (385), Expect = 1.116e-37
Identity = 73/193 (37.82%), Postives = 114/193 (59.07%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNEN---------DPSVSEKRSE-NHMCEICSEIIYFLEKMTIADKFYHRSCYR 639
            +K L  WC  Q + Y  +++ + + S+++GL FCAI+HR  PDLID+D+L+ EN+YEN  LAF VAE   GIP+LL P+DM  MK PDRL +ITY+SQYYN  + +   + P  ++L  + +      K +  K     +NE+         +P+   KRS  +  C  C + ++ +++  +  K YHR+C+R
Sbjct:    4 LKALQEWCRLQCQGYSGVEVRDMSASFRDGLAFCAIIHRHRPDLIDFDSLSEENVYENNRLAFEVAESQLGIPALLDPEDMVSMKVPDRLSIITYVSQYYNFFNDRSTANPPSVKRLAPAGQTEPALKKPLGPKDSDATENESVQPAQTAGVEPAA--KRSTLSSTCSACHKHVHLVQRFLVDGKLYHRNCFR 194          

HSP 2 Score: 75.485 bits (184), Expect = 1.698e-13
Identity = 43/140 (30.71%), Postives = 77/140 (55.00%), Query Frame = 1
Query: 1810 KREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDD 2229
            KR+V+ D+   +IP E ++ ++ ++  +  E+E+ G  L+  L  ++ +       L  W  L+  K+ L  +E EL    K+Q LE+R AD+EYELR L++K E   T  + +RE+EL+  ++  +  R Q+    + D
Sbjct:  709 KRKVQSDD---YIPVEDIHGEMAQLEKQLDELELRGVELEKKL-RSNPSDEDEEHLLVDWFTLIHDKHLLIRREAELVYTAKQQNLEERQADVEYELRCLLNKPEKDWTEEDKSREQELMADLVTIIEQRNQIVNSMDQD 844          
BLAST of MICAL-like 1 vs. Ensembl Medaka
Match: micall2b (MICAL-like protein 2 [Source:NCBI gene;Acc:101158422])

HSP 1 Score: 138.658 bits (348), Expect = 1.990e-33
Identity = 74/215 (34.42%), Postives = 118/215 (54.88%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKS------KPENQKLLSSIENLNNNV--KVI-EQKIIKEDD-----NENDPSVSEKRSENHM-----------------CEICSEIIYFLEKMTIADKFYHRSCYRQ 642
            +K L  WC  Q + Y+++ ITN T S+++GL FCA++H+  P+LI++++L+ E++YEN  LAF VAE+  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P        +P +  +  +    N+ V  KV    K  +E+      N   PS S K+S N +                 C  C+  ++ +++  +  K YHR+C RQ
Sbjct:    4 VKALQQWCRVQCEGYRDVSITNMTTSFRDGLAFCALIHKHRPELINFNSLSKEDVYENNKLAFKVAEEKLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRNPIGGMGAIKRPADGPMGETPGKKNSAVASKVFPGSKDARENSPPPFLNRTRPSPSPKQSRNALQDVNAEKPSQTGTLSNKCASCNTHVHLVQRHLLDGKLYHRNCARQ 218          
BLAST of MICAL-like 1 vs. Ensembl Medaka
Match: micall2b (MICAL-like protein 2 [Source:NCBI gene;Acc:101158422])

HSP 1 Score: 138.658 bits (348), Expect = 2.695e-33
Identity = 74/215 (34.42%), Postives = 118/215 (54.88%), Query Frame = 1
Query:   91 IKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKS------KPENQKLLSSIENLNNNV--KVI-EQKIIKEDD-----NENDPSVSEKRSENHM-----------------CEICSEIIYFLEKMTIADKFYHRSCYRQ 642
            +K L  WC  Q + Y+++ ITN T S+++GL FCA++H+  P+LI++++L+ E++YEN  LAF VAE+  GIP+LL  +DM  +K PDRL ++TY+SQYYN    + P        +P +  +  +    N+ V  KV    K  +E+      N   PS S K+S N +                 C  C+  ++ +++  +  K YHR+C RQ
Sbjct:    4 VKALQQWCRVQCEGYRDVSITNMTTSFRDGLAFCALIHKHRPELINFNSLSKEDVYENNKLAFKVAEEKLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRNPIGGMGAIKRPADGPMGETPGKKNSAVASKVFPGSKDARENSPPPFLNRTRPSPSPKQSRNALQDVNAEKPSQTGTLSNKCASCNTHVHLVQRHLLDGKLYHRNCARQ 218          
BLAST of MICAL-like 1 vs. Ensembl Medaka
Match: ENSORLT00000033391.1 (pep primary_assembly:ASM223467v1:23:23949842:23952793:-1 gene:ENSORLG00000021810.1 transcript:ENSORLT00000033391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 2.305e-29
Identity = 50/123 (40.65%), Postives = 74/123 (60.16%), Query Frame = 1
Query:   97 GLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKS------KPENQKLLS 447
             L  W   QT+ Y+ + + + T+SWK+GL  CA+LHR+ PDL+D+ +L      EN  LAF VAE+ FGIP LL+ ++M  ++ PD L MI YLSQ++  L    P +       P  QK+++
Sbjct:    3 ALLTWFQEQTRGYRGVSVRDLTSSWKDGLALCALLHRYRPDLVDFQSLVRSRGEENLRLAFHVAEEEFGIPPLLTVEEMASVEEPDSLSMIMYLSQFHQLLKHSPPPAGSAAHPSPHQQKIIA 125          
BLAST of MICAL-like 1 vs. Ensembl Medaka
Match: mical3a (microtubule associated monooxygenase, calponin and LIM domain containing 3 [Source:NCBI gene;Acc:101162445])

HSP 1 Score: 118.242 bits (295), Expect = 1.330e-26
Identity = 50/114 (43.86%), Postives = 71/114 (62.28%), Query Frame = 1
Query:   73 NNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQP 414
            N S  +   L NWC  QT+ YKN+ + + T SWK+GL  CA++HR+ PDLID+D+L+  +   N  LAF VAE+ FGI   ++ K+M  +  PD+L M+ YLSQ+Y       P
Sbjct:  521 NESIARSSKLLNWCQRQTEGYKNVSVKDLTMSWKSGLALCALIHRYRPDLIDFDSLDERDQERNNQLAFDVAEREFGICPCMTGKEMSSVVEPDKLSMVMYLSQFYEMFKDTVP 634          

HSP 2 Score: 63.929 bits (154), Expect = 6.876e-10
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = 1
Query: 1870 QLKEVNYKQSEIEIEGRVLQNIL-WETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNAR---AQLFEQQ 2220
            QL++V  KQ ++E  G  ++  L  E         + +Q+W  LVQ+KN L   E EL    +  ELEDR + L+ ELR  M+ ++  K+  E A E++++N++L+ V  R     L E+Q
Sbjct: 1822 QLEQVEEKQRQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNALVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKSEKELAEEKQILNEMLEVVEQRDALVALLEEQ 1942          
BLAST of MICAL-like 1 vs. Planmine SMEST
Match: SMESG000065945.1 (SMESG000065945.1)

HSP 1 Score: 1388.63 bits (3593), Expect = 0.000e+0
Identity = 771/778 (99.10%), Postives = 774/778 (99.49%), Query Frame = 1
Query:   67 MSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNLKIRNKTLERPTVPVSDQTNPLNTKEKDTLLVRSRQSSGNKSPKTVYKSQRKPSLDSNMFENNKATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNSDIPQNINSNVHMFSNKLQPXXXXXXXXXXXXXXXKKRHAXXXXXXXLSVKPRHSFLKPTQTNLPIPNKTKLILYPEELNPFAGDXXXXXXXXXSTKPVSSDINSTNPFAEFMTDENLNILDKPVIKPRKRPAPKLPGKVPVVTSKINEPSGNNMNSSVLHSTIVNDSNIDKTQIVLRSFPNSEQNISNKTGKDTESNKSDIPEQEPGKIDKSPIKIPEDSKFLSYDSEHQTPLSNNPIISRPVEEENLKKIGKLSKSDQKINKLSSSRHTVQKAPAPSRPLPPKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDDLTIKSSTNERLKSKNTLRSFFTIKHRSSSVGKIGXXXXXXXXXXXXXXGETFVSHML 2400
            MSNNSNDKIKGLFNWCINQTKDYKN+QITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDP VSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNLKIRNKTLERPTVPVSDQTNPLNTKE+DTLLVRSRQSSGNKSPKTVYKSQRKPSLDSNM ENNKATSLNSHSEDHSSQSASSINVISINASSVESISQNNSDIPQNINSNVHMFSNKLQPSSLDNSSNSLNSSFSKKRHAPPPPPPPLSVKPRHSFLKPTQTNLPIPNKTKLILYPEELNPFAGDEEEKEEIIKSTKPVSSDINSTNPFAEFMTDENLNILDKPVIKPRKRPAPKLP KVPVV+SKINEPSGNNMNSSVLHSTIVNDSNIDKTQIVLRSFPNSEQNISNKTGKDTESNKSDIPEQEPGKIDKSPIKIPEDSKFLSYDSEHQTPLSNNPIISRPVEEENLKKIGKLSKSDQKINKLSSSRHTVQKAPAPSRPLPPKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDDLTIKSSTNERLKSKNTLR FFTIKHRSSSVGKIGSNKSTTFKFNKKKKGETFVSHML
Sbjct:    1 MSNNSNDKIKGLFNWCINQTKDYKNVQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPLVSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNLKIRNKTLERPTVPVSDQTNPLNTKEEDTLLVRSRQSSGNKSPKTVYKSQRKPSLDSNMSENNKATSLNSHSEDHSSQSASSINVISINASSVESISQNNSDIPQNINSNVHMFSNKLQPSSLDNSSNSLNSSFSKKRHAPPPPPPPLSVKPRHSFLKPTQTNLPIPNKTKLILYPEELNPFAGDEEEKEEIIKSTKPVSSDINSTNPFAEFMTDENLNILDKPVIKPRKRPAPKLPEKVPVVSSKINEPSGNNMNSSVLHSTIVNDSNIDKTQIVLRSFPNSEQNISNKTGKDTESNKSDIPEQEPGKIDKSPIKIPEDSKFLSYDSEHQTPLSNNPIISRPVEEENLKKIGKLSKSDQKINKLSSSRHTVQKAPAPSRPLPPKREVRGDNSYEFIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEELINQILDTVNARAQLFEQQNDDLTIKSSTNERLKSKNTLRRFFTIKHRSSSVGKIGSNKSTTFKFNKKKKGETFVSHML 778          
BLAST of MICAL-like 1 vs. Planmine SMEST
Match: SMESG000041713.1 (SMESG000041713.1)

HSP 1 Score: 164.851 bits (416), Expect = 6.149e-42
Identity = 85/196 (43.37%), Postives = 115/196 (58.67%), Query Frame = 1
Query:   85 DKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNENDPSVSEKRSENHM----CEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNL 660
            +KI+GL  WC +Q  +Y NI I NF+ SWKNGL F A++H+F PDLI++  L+   I+ N   AF  AE HFGIPSLL  KDM   +SP+RL +ITY+SQ+YN L +     KPE    ++   N NN              N +  ++S + S N +    C ICSE +Y LE+    DK YHR CYR +Q+ N+
Sbjct:    2 NKIEGLLKWCQSQLSEYPNISIQNFSTSWKNGLAFNALIHKFKPDLINFHGLDSSQIFYNNYKAFKTAEIHFGIPSLLDAKDMVNCESPERLSIITYVSQFYNCLKEM----KPEGGYKINRFINTNNG-------------NSDFENISSRASINRLSKLTCSICSEKVYLLERYIADDKLYHRKCYRTHQIKNI 180          

HSP 2 Score: 78.9518 bits (193), Expect = 9.441e-15
Identity = 51/149 (34.23%), Postives = 87/149 (58.39%), Query Frame = 1
Query: 1843 FIPYESLYSQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKNDLFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAEN-----AREEELINQILDTVNARAQLFEQQNDD----LTIKSSTNERL 2262
            F  Y     +L+E+N KQS+IEI+ R +Q  LW+ + + S +   L KWL+LV++K+ +F +E  L+  +K  +L++  + LE ++R L S      TA  N      +E+EL+ +++DTVN RA+L +  +++    L I  S +E L
Sbjct:  587 FRDYAEFKERLEELNTKQSDIEIKARNIQQKLWKENVDTSLYDSLLVKWLNLVEEKDRIFYEENALYSWIKDLKLQEMKSKLETQIRLLPS------TANSNDPNLIEKEKELVAKLIDTVNKRAELVDAMHEENIRRLEIIKSRDEAL 729          
BLAST of MICAL-like 1 vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 127.487 bits (319), Expect = 8.316e-30
Identity = 64/147 (43.54%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   94 KGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKP------------ENQKLLSSIENLNNN-VKVIEQKI 495
            +GL  WC  +T  YKN++++NF  S+K+GL FCA++HR  PDLIDY+NL+ +N  EN +LAF VAEKH  IP +L  +DM     PD L ++ Y+S YY+A S  Q                 EN+KL++  E L+ N +K IE+ I
Sbjct:  146 EGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMI 292          
BLAST of MICAL-like 1 vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 127.102 bits (318), Expect = 9.087e-30
Identity = 64/147 (43.54%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   94 KGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKP------------ENQKLLSSIENLNNN-VKVIEQKI 495
            +GL  WC  +T  YKN++++NF  S+K+GL FCA++HR  PDLIDY+NL+ +N  EN +LAF VAEKH  IP +L  +DM     PD L ++ Y+S YY+A S  Q                 EN+KL++  E L+ N +K IE+ I
Sbjct:  146 EGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMI 292          
BLAST of MICAL-like 1 vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 127.102 bits (318), Expect = 9.145e-30
Identity = 64/147 (43.54%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   94 KGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDPDLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCMITYLSQYYNALSKKQPKSKP------------ENQKLLSSIENLNNN-VKVIEQKI 495
            +GL  WC  +T  YKN++++NF  S+K+GL FCA++HR  PDLIDY+NL+ +N  EN +LAF VAEKH  IP +L  +DM     PD L ++ Y+S YY+A S  Q                 EN+KL++  E L+ N +K IE+ I
Sbjct:  146 EGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMI 292          
The following BLAST results are available for this feature:
BLAST of MICAL-like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MICALL11.656e-3533.86MICAL like 1 [Source:HGNC Symbol;Acc:HGNC:29804][more]
MICALL21.142e-3434.58MICAL like 2 [Source:HGNC Symbol;Acc:HGNC:29672][more]
MICAL36.121e-2835.03microtubule associated monooxygenase, calponin and... [more]
MICAL33.322e-2741.18microtubule associated monooxygenase, calponin and... [more]
MICAL34.050e-2735.03microtubule associated monooxygenase, calponin and... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atn-15.297e-2439.13AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-17.093e-2439.13AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-11.055e-2244.55AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-11.277e-2244.55AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
T15B12.14.578e-2142.45pep chromosome:WBcel235:III:5294501:5298361:1 gene... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MICAL-like2.670e-3638.12gene:FBgn0036333 transcript:FBtr0075898[more]
Ehbp15.935e-2740.46gene:FBgn0034180 transcript:FBtr0114628[more]
Ehbp17.283e-2740.46gene:FBgn0034180 transcript:FBtr0087019[more]
Ehbp17.527e-2740.46gene:FBgn0034180 transcript:FBtr0340073[more]
Ehbp18.196e-2740.46gene:FBgn0034180 transcript:FBtr0114627[more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micall1a5.177e-4040.43MICAL-like 1a [Source:ZFIN;Acc:ZDB-GENE-110119-1][more]
micall1a6.195e-4040.43MICAL-like 1a [Source:ZFIN;Acc:ZDB-GENE-110119-1][more]
micall2b2.928e-3634.45mical-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-580... [more]
micall2b2.928e-3634.45mical-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-580... [more]
micall2b4.655e-3634.45mical-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-580... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc145.079e-3940.00tetratricopeptide repeat domain 14 [Source:Xenbase... [more]
dlg51.510e-3333.80discs large homolog 5 [Source:Xenbase;Acc:XB-GENE... [more]
dlg52.384e-3333.33discs large homolog 5 [Source:Xenbase;Acc:XB-GENE... [more]
smtn6.418e-2843.24ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn1.184e-2743.24ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Micall24.495e-3734.10MICAL-like 2 [Source:MGI Symbol;Acc:MGI:2444818][more]
Micall11.211e-3633.74microtubule associated monooxygenase, calponin and... [more]
Micall19.964e-3636.46microtubule associated monooxygenase, calponin and... [more]
Mical32.385e-2743.12microtubule associated monooxygenase, calponin and... [more]
Mical32.418e-2743.12microtubule associated monooxygenase, calponin and... [more]
back to top
BLAST of MICAL-like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3ZEN0|MILK2_RAT2.229e-3737.16MICAL-like protein 2 OS=Rattus norvegicus OX=10116... [more]
sp|Q3TN34|MILK2_MOUSE3.144e-3634.10MICAL-like protein 2 OS=Mus musculus OX=10090 GN=M... [more]
sp|D3ZQL6|MILK1_RAT3.779e-3536.46MICAL-like protein 1 OS=Rattus norvegicus OX=10116... [more]
sp|E1BBG2|MILK1_BOVIN5.688e-3536.13MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICA... [more]
sp|Q8BGT6|MILK1_MOUSE6.970e-3536.46MICAL-like protein 1 OS=Mus musculus OX=10090 GN=M... [more]
back to top
BLAST of MICAL-like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7BLS77.827e-4339.41Calponin-homology (CH) domain-containing protein (... [more]
A0A0B7BLS21.269e-4239.41Calponin-homology (CH) domain-containing protein (... [more]
A0A2C9JFT62.779e-4141.79Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A433U1Z22.641e-4039.90Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1W2W0M81.052e-3838.76MICAL-like protein 1 isoform X1 OS=Ciona intestina... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micall1a5.334e-3940.43MICAL like 1 [Source:NCBI gene;Acc:103030047][more]
micall2a1.264e-3049.07mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-540... [more]
micall2a1.650e-3049.07mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-540... [more]
micall2a2.385e-3049.07mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-540... [more]
micall2a2.989e-3049.07mical-like 2a [Source:ZFIN;Acc:ZDB-GENE-030131-540... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mical3b8.339e-2842.59Danio rerio microtubule associated monooxygenase, ... [more]
ENSPMAT00000000684.11.170e-2342.98pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000009295.15.130e-2337.41pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
ENSPMAT00000004049.11.204e-2236.64pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
mical11.276e-2242.45microtubule associated monooxygenase, calponin and... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MICAL-like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479991.018e-2846.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ALPHA-ACTININ5.102e-2647.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382826.747e-2647.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291011.612e-2141.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410993.522e-2142.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MICAL-like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micall1a1.116e-3737.82MICAL like 1 [Source:NCBI gene;Acc:101158997][more]
micall2b1.990e-3334.42MICAL-like protein 2 [Source:NCBI gene;Acc:1011584... [more]
micall2b2.695e-3334.42MICAL-like protein 2 [Source:NCBI gene;Acc:1011584... [more]
ENSORLT00000033391.12.305e-2940.65pep primary_assembly:ASM223467v1:23:23949842:23952... [more]
mical3a1.330e-2643.86microtubule associated monooxygenase, calponin and... [more]
back to top
BLAST of MICAL-like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065945.10.000e+099.10SMESG000065945.1[more]
SMESG000041713.16.149e-4243.37SMESG000041713.1[more]
SMESG000026000.18.316e-3043.54SMESG000026000.1[more]
SMESG000026000.19.087e-3043.54SMESG000026000.1[more]
SMESG000026000.19.145e-3043.54SMESG000026000.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003512 ID=SMED30003512|Name=MICAL-like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2472bp
ATTTTCAGTAAAAATTAATAAACTTCATTTTAAAATTCATTTCATGACTT
GATTAAAATATTAATAATGTCTAATAATTCGAATGATAAAATAAAAGGTC
TTTTTAATTGGTGTATTAATCAAACTAAAGATTATAAAAATATTCAAATC
ACAAATTTCACTAATTCTTGGAAAAATGGGTTAGGGTTTTGTGCAATACT
TCATCGATTTGATCCGGATTTAATTGATTATGATAACTTAAATCCAGAAA
ATATTTATGAGAATTGCGATTTAGCTTTCACAGTTGCAGAGAAACATTTT
GGTATTCCGTCATTATTAAGTCCTAAAGACATGGAGATTATGAAATCACC
AGATAGATTATGCATGATAACATATCTTTCTCAATATTATAACGCATTAT
CAAAAAAACAGCCAAAATCGAAGCCTGAAAATCAAAAGTTACTGAGTTCA
ATAGAAAATTTAAATAATAATGTCAAAGTTATTGAACAAAAGATTATTAA
GGAAGATGATAATGAAAATGATCCCTCGGTATCTGAAAAACGATCGGAAA
ACCATATGTGTGAAATATGCTCAGAGATCATATATTTTTTAGAAAAGATG
ACTATTGCCGATAAATTTTATCATCGTTCATGTTATCGACAAAATCAACT
AAACAATCTTAAAATTCGAAATAAAACTCTAGAAAGACCTACTGTTCCAG
TGTCAGATCAAACAAATCCTTTAAATACTAAAGAAAAAGATACGCTTCTT
GTGCGATCGAGGCAGTCTTCAGGAAATAAGTCTCCAAAAACAGTTTACAA
ATCACAACGAAAACCTTCTCTTGACAGTAATATGTTCGAGAATAATAAAG
CCACGTCGCTAAATAGTCATTCAGAAGACCACAGCTCTCAAAGTGCATCT
TCTATAAATGTTATTTCTATAAACGCATCTTCAGTTGAATCAATAAGTCA
AAACAATTCCGATATACCTCAAAATATTAACTCAAATGTACACATGTTCT
CAAATAAATTACAGCCGAGTTCGCTAGATAATTCATCTAATTCTTTAAAT
TCTTCTTTTAGTAAAAAACGCCATGCTCCACCGCCTCCACCGCCACCTTT
GTCAGTTAAGCCAAGACATAGTTTTCTAAAACCGACTCAAACAAACCTCC
CAATACCAAATAAAACCAAACTAATTTTATATCCAGAAGAATTAAATCCT
TTTGCCGGGGACGAAGAAGAAAAAGAAGAAATTATAAAATCAACTAAACC
CGTCTCATCTGACATTAATAGTACTAATCCATTTGCTGAATTCATGACTG
ATGAAAATCTTAACATTCTCGACAAACCCGTGATAAAACCACGTAAGCGT
CCAGCTCCTAAGCTACCGGGAAAAGTGCCAGTAGTGACAAGTAAAATAAA
TGAACCTAGCGGTAACAATATGAACTCGTCTGTTTTGCATTCAACTATTG
TGAACGATTCGAACATTGACAAAACCCAAATCGTTTTACGTTCATTTCCG
AATTCAGAACAAAATATATCCAATAAAACTGGCAAGGATACTGAAAGTAA
CAAAAGTGACATCCCTGAACAAGAACCTGGTAAAATAGATAAATCTCCAA
TTAAAATCCCTGAAGATTCAAAATTTTTAAGTTACGATTCAGAACACCAG
ACTCCATTGTCAAACAATCCGATAATTTCTCGGCCTGTTGAAGAGGAAAA
TCTGAAAAAAATTGGAAAACTCTCTAAATCAGATCAGAAAATTAATAAAT
TATCTTCTTCAAGACATACAGTTCAAAAAGCTCCAGCTCCATCTCGACCG
TTACCACCGAAACGAGAAGTTCGTGGCGATAACAGTTATGAGTTCATTCC
ATACGAATCTCTTTATTCGCAACTGAAGGAAGTGAATTACAAACAATCAG
AAATCGAAATTGAAGGCAGAGTGTTGCAGAATATTCTCTGGGAAACTGAT
CAAAACGGAAGTCAGTTTAGTGAATTCCTTCAAAAATGGCTGGATTTAGT
TCAGAAGAAAAATGATCTCTTTGTGAAAGAAGGAGAATTGCATGAGATAT
TGAAACGTCAGGAACTAGAAGATCGCCACGCTGATCTCGAATATGAACTT
CGTTTTCTTATGAGTAAACAAGAGTCTCAGAAAACAGCAGCGGAAAATGC
AAGAGAAGAAGAACTAATAAATCAAATATTGGATACTGTGAATGCTAGAG
CACAGCTATTTGAGCAGCAAAATGACGACTTAACAATCAAGTCTTCTACA
AACGAAAGGCTGAAATCCAAGAATACTCTAAGAAGTTTTTTCACAATCAA
GCATCGCTCGTCTTCTGTTGGAAAAATCGGCTCAAATAAATCTACGACAT
TCAAATTTAATAAAAAGAAAAAAGGGGAAACTTTTGTTTCTCACATGTTG
TGATAACTTAGTCGGGTTTTAATTTGATAATGTGATTTTACTTTAAATAC
ATTTTATTTCGTTACTTTAACA
back to top

protein sequence of SMED30003512-orf-1

>SMED30003512-orf-1 ID=SMED30003512-orf-1|Name=SMED30003512-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=779bp
MSNNSNDKIKGLFNWCINQTKDYKNIQITNFTNSWKNGLGFCAILHRFDP
DLIDYDNLNPENIYENCDLAFTVAEKHFGIPSLLSPKDMEIMKSPDRLCM
ITYLSQYYNALSKKQPKSKPENQKLLSSIENLNNNVKVIEQKIIKEDDNE
NDPSVSEKRSENHMCEICSEIIYFLEKMTIADKFYHRSCYRQNQLNNLKI
RNKTLERPTVPVSDQTNPLNTKEKDTLLVRSRQSSGNKSPKTVYKSQRKP
SLDSNMFENNKATSLNSHSEDHSSQSASSINVISINASSVESISQNNSDI
PQNINSNVHMFSNKLQPSSLDNSSNSLNSSFSKKRHAPPPPPPPLSVKPR
HSFLKPTQTNLPIPNKTKLILYPEELNPFAGDEEEKEEIIKSTKPVSSDI
NSTNPFAEFMTDENLNILDKPVIKPRKRPAPKLPGKVPVVTSKINEPSGN
NMNSSVLHSTIVNDSNIDKTQIVLRSFPNSEQNISNKTGKDTESNKSDIP
EQEPGKIDKSPIKIPEDSKFLSYDSEHQTPLSNNPIISRPVEEENLKKIG
KLSKSDQKINKLSSSRHTVQKAPAPSRPLPPKREVRGDNSYEFIPYESLY
SQLKEVNYKQSEIEIEGRVLQNILWETDQNGSQFSEFLQKWLDLVQKKND
LFVKEGELHEILKRQELEDRHADLEYELRFLMSKQESQKTAAENAREEEL
INQILDTVNARAQLFEQQNDDLTIKSSTNERLKSKNTLRSFFTIKHRSSS
VGKIGSNKSTTFKFNKKKKGETFVSHML*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0017137Rab GTPase binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR001715CH-domain
IPR001781Znf_LIM
IPR022735bMERB_dom
Vocabulary: biological process
TermDefinition
GO:0032456endocytic recycling
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 705..725
NoneNo IPR availableCOILSCoilCoilcoord: 122..149
NoneNo IPR availableCOILSCoilCoilcoord: 664..684
NoneNo IPR availableSMARTSM01203DUF3585_4coord: 593..726
e-value: 2.7E-26
score: 103.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 476..490
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..278
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..346
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 556..571
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..333
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 555..581
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 476..514
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 491..514
NoneNo IPR availablePANTHERPTHR23167FAMILY NOT NAMEDcoord: 12..732
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 159..190
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 8..107
e-value: 1.2E-18
score: 78.0
IPR001715Calponin homology domainPFAMPF00307CHcoord: 10..111
e-value: 5.7E-22
score: 78.0
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 6..112
score: 22.394
IPR001715Calponin homology domainCDDcd00014CHcoord: 10..111
e-value: 8.52811E-19
score: 80.4327
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 4..119
e-value: 7.2E-41
score: 140.6
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 9..110
IPR022735bMERB domainPFAMPF12130DUF3585coord: 601..721
e-value: 3.2E-24
score: 85.6
IPR022735bMERB domainPROSITEPS51848BMERBcoord: 583..714
score: 16.587