Adenylate kinase 9

Overview
NameAdenylate kinase 9
Smed IDSMED30003507
Uniprot Best hitAdenylate kinase 9 OS=Homo sapiens OX=9606 GN=AK9 PE=1 SV=2 (E=7.91793e-155)
Length (bp)5794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylate kinase 9 (SMED30003507) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylate kinase 9 (SMED30003507) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenylate kinase 9 (SMED30003507) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenylate kinase 9 (SMED30003507) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003507

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003507SMESG000043841.1 SmedASXL_017543SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003507SMESG000043841.1 dd_Smed_v6_9617_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003507SMESG000043841.1 dd_Smed_v6_9617_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30003507SMESG000043841.1 dd_Smed_v4_9617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylate kinase 9 vs. Ensembl Human
Match: AK9 (adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33814])

HSP 1 Score: 524.242 bits (1349), Expect = 9.405e-165
Identity = 276/646 (42.72%), Postives = 404/646 (62.54%), Query Frame = 3
Query: 3807 EIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIE-LPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAFLPEH-------LPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
            E+ E F+ DT+ +  + +      IP   +    +  IVQY L  KLK L++ R S+FE+C+P+    A+K++   +KY+S FG W PV L +E     P+ +  +PI+PVI+R YIYF  SK+T++ FM NP+KY++QP PK  VPI++ I+G PKSGKTT+A++   EYGL  ++ G ALR VLN +  TELA  +  +L KG+  P EL I+A+EL LM S C T G V+DGYP+   Q+ ++  + IIP  +FEL    +E+  R   ++   + LP+P+H+S++I+A+    Y  NI EIR++Y E+H N   ID     W++W +   +V+    ++Q YL   + GKAA I  LCI P E  +RL + +++CPVSL++++EL   +    L FAAE+RG+YYKM  +E+L+ F +N E  L    L  H       +P ++  + ++  FP   +LQGYCPV + DG  RYE L+ G+   Y +EY  ++Y       +  F++ P K+W  +LP KLPP++  + + SLPLPGYLEQ +A +L  A+ A G LKPK+PF+   RSALLYIALHLKA+NPK  E+ R+KYK K+E+F  SCELI YL   MT KYKE + R + FD K+  FL LR ++
Sbjct:  104 ELGEKFEADTHNLQIIQDELERYLIPIISINGARRNHIVQYTLNMKLKPLVENRASIFEKCHPIPAPLAQKMLTFTYKYISSFGYWDPVKL-SEGETIKPVENAENPIYPVIHRQYIYFLSSKETKEKFMKNPIKYIRQPKPKPTVPIRIIIVGPPKSGKTTVAKKITSEYGLKHLSIGGALRYVLNNHPETELALMLNWHLHKGMTAPDELAIQALELSLMESVCNTAGVVIDGYPVTKHQMNLLEARSIIPMVIFELSVPSKEIFKRLLLEKENEQRLPYPLHNSAQIVAVNNVKYRKNIGEIRQYYQEQHQNWYVIDGFHSKWWVWNEVIKNVQMVNKYMQTYLERIKAGKAACIDKLCITPQELLSRLGEFEQFCPVSLAESQELFDCSATDSLEFAAEFRGHYYKMSSQEKLNKFLENPE--LYVPPLAPHPLPSADMIPKRLTLSELKSRFPKCAELQGYCPVTYKDGNQRYEALVPGSI-NYALEYHNRIYICENKEKLQKFLRSPLKYWEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNAAGCLKPKFPFLSIRRSALLYIALHLKAFNPKGSEYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFLSLRNID 745          

HSP 2 Score: 53.5286 bits (127), Expect = 3.935e-6
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 3
Query: 2685 LGETNYWCPVTLKTHKVLCP----GNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISF 2966
            +    YW PV L   + + P     NP     +   IY+ S +E++EKF+++P++Y+       +  +R+II+G   SGKTT  +KI  +  L H+S 
Sbjct:  183 ISSFGYWDPVKLSEGETIKPVENAENPIYPVIHRQYIYFLSSKETKEKFMKNPIKYIRQPKPKPTVPIRIIIVGPPKSGKTTVAKKITSEYGLKHLSI 280          
BLAST of Adenylate kinase 9 vs. Ensembl Human
Match: AK9 (adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33814])

HSP 1 Score: 528.48 bits (1360), Expect = 1.649e-155
Identity = 280/652 (42.94%), Postives = 406/652 (62.27%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCP------RELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAFLPEH-------LPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
             E+ E F+ DT+ +  + +      IP   +    +  IVQY L  KLK L++ R S+FE+C+P+    A+K++   +KY+S FG W PV L +E     P+ +  +PI+PVI+R YIYF  SK+T++ FM NP+KY++QP PK  VPI++ I+G PKSGKTT+A++   EYGL  ++ G ALR VLN +  TELA  +  +L KG+  P EL I+A+EL LM S C T G V+DGYP+   Q+ ++  + IIP  +FEL S P      R L+ + N+ R    LP+P+H+S++I+A+    Y  NI EIR++Y E+H N   ID     W++W +   +V+    ++Q YL   + GKAA I  LCI P E  +RL + +++CPVSL++++EL   +    L FAAE+RG+YYKM  +E+L+ F +N E  L    L  H       +P ++  + ++  FP   +LQGYCPV + DG  RYE L+ G+   Y +EY  ++Y       +  F++ P K+W  +LP KLPP++  + + SLPLPGYLEQ +A +L  A+ A G LKPK+PF+   RSALLYIALHLKA+NPK  E+ R+KYK K+E+F  SCELI YL   MT KYKE + R + FD K+  FL LR ++
Sbjct: 1265 GELGEKFEADTHNLQIIQDELERYLIPIISINGARRNHIVQYTLNMKLKPLVENRASIFEKCHPIPAPLAQKMLTFTYKYISSFGYWDPVKL-SEGETIKPVENAENPIYPVIHRQYIYFLSSKETKEKFMKNPIKYIRQPKPKPTVPIRIIIVGPPKSGKTTVAKKITSEYGLKHLSIGGALRYVLNNHPETELALMLNWHLHKGMTAPDELAIQALELSLMESVCNTAGVVIDGYPVTKHQMNLLEARSIIPMVIFEL-SVPSKEIFKRLLLEKENEQR----LPYPLHNSAQIVAVNNVKYRKNIGEIRQYYQEQHQNWYVIDGFHSKWWVWNEVIKNVQMVNKYMQTYLERIKAGKAACIDKLCITPQELLSRLGEFEQFCPVSLAESQELFDCSATDSLEFAAEFRGHYYKMSSQEKLNKFLENPE--LYVPPLAPHPLPSADMIPKRLTLSELKSRFPKCAELQGYCPVTYKDGNQRYEALVPGSI-NYALEYHNRIYICENKEKLQKFLRSPLKYWEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNAAGCLKPKFPFLSIRRSALLYIALHLKAFNPKGSEYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFLSLRNID 1907          

HSP 2 Score: 261.151 bits (666), Expect = 2.884e-69
Identity = 172/487 (35.32%), Postives = 273/487 (56.06%), Query Frame = 3
Query:  273 SSQDK--EYKL-DPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKTESLA 1724
            +SQ+K  EY   D + + E E  FL SKP CF++ GKPG G TTLA+     ++C  +    ++E+ I  +TE G  LQ++L  G  I +E+VI L+ +K+ SPEV H GY+I   P+ +   +T  +Q  ++K+  ++PD++I +K PD DL  R+  QR    TG +Y +  +DP+      +      KKE   D + EEEEEEEE+EE                 +  E +  L++RPED+L+ +E  ++ Y E     + + +   N   +I LN N P   LF  + +RL+YL+++ AA+  +L     +  EEE  D  + DELF+ L      AP ++W +S+W   CPV L +G +  G P ++V FL K+Y +SS++ +  F+ NPRPYLLP  P  PCK+ ++GP  SGKT L  +LA  YK +V++   L++P  D+A+   + N + ++T  AI+ V  K+ ++++  K    A
Sbjct:    2 TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEV-----IENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQ--------MVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKL-----QGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVVDYAQLVQPRFDKARETLVENTIAEATAAAIKVVKEKLLRELQARKQAETA 470          

HSP 3 Score: 188.348 bits (477), Expect = 4.806e-47
Identity = 141/372 (37.90%), Postives = 211/372 (56.72%), Query Frame = 3
Query: 2361 PPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEKIFKPIAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLE 3476
            P  PE+   +++I  +   W  + + IS +  +I+++     DRT +EL Q   + +EK F+  A EL   D +E+ E  + E   +E+ EEEE+E  E+  + +KR LG+T ++CPV LK + +L PGN E AAKY  KIYYFS  E++EKF++ P  Y+  +   ++P LR+ ++G +GSGKT  GR++A+KL +FHI F+E+LQE +L K  KK+GPE++                  E S +E A K E   E A      VE E+NTK      K     +  E E  IK +L   + L  E+LE +L ++W K+P    GF+L+GFPR  EEAQFL +   F D  + +   + DI  RLLP ++E
Sbjct:  823 PDVPEMEPFKEKIGSFIILWKQLEATISEA--YIKILNLEIADRTPQELLQKVVETMEKPFQYTAWELTGEDYEEETEDYQTEAEVDEELEEEEEEEGEDKMKERKRHLGDTKHFCPVVLKENFILQPGNTEEAAKYREKIYYFSSAEAKEKFLEHPEDYVAHEEPLKAPPLRICLVGPQGSGKTMCGRQLAEKLNIFHIQFEEVLQEKLLLKTEKKVGPEFE------------------EDSENEQAAKQEL-EELAIQANVKVE-EENTK------KQLPEVQLTEEEEVIKSSLMENEPLPPEILEVILSEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPAQIE 1166          

HSP 4 Score: 60.077 bits (144), Expect = 5.067e-8
Identity = 34/120 (28.33%), Postives = 61/120 (50.83%), Query Frame = 3
Query: 1923 VDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAAR 2282
            V   +PEV  ++ + ++ ++        E + E L++ +  +  + + + P +  +GGW++DN P  +E W AL+    +K ++PD VI + D   N + L  R Y   K  IDS I  R
Sbjct:  574 VTADHPEVVTMIEETIKMSQDINFEQPYEKHAEILQEVLGEVMEENKDRFPGAPKYGGWIVDNCPIVKELWMALI----KKGIIPDLVIYLSDTENNGKCLFNRIYLQKKSEIDSKILER 689          

HSP 5 Score: 57.7658 bits (138), Expect = 2.636e-7
Identity = 31/81 (38.27%), Postives = 46/81 (56.79%), Query Frame = 3
Query: 1323 NYCPVALFEG-ILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQP--EIPCKISVVGPNGSGKTILSQLLANR 1556
            ++CPV L E  ILQPG  + A  +  K+Y  SS +    F+ +P  Y+   +P    P +I +VGP GSGKT+  + LA +
Sbjct:  934 HFCPVVLKENFILQPGNTEEAAKYREKIYYFSSAEAKEKFLEHPEDYVAHEEPLKAPPLRICLVGPQGSGKTMCGRQLAEK 1014          

HSP 6 Score: 54.299 bits (129), Expect = 2.924e-6
Identity = 31/94 (32.98%), Postives = 51/94 (54.26%), Query Frame = 3
Query: 2697 NYWCPVTLKTHKVLCP----GNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISF 2966
             YW PV L   + + P     NP     +   IY+ S +E++EKF+++P++Y+       +  +R+II+G   SGKTT  +KI  +  L H+S 
Sbjct: 1349 GYWDPVKLSEGETIKPVENAENPIYPVIHRQYIYFLSSKETKEKFMKNPIKYIRQPKPKPTVPIRIIIVGPPKSGKTTVAKKITSEYGLKHLSI 1442          
BLAST of Adenylate kinase 9 vs. Ensembl Human
Match: AK9 (adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33814])

HSP 1 Score: 262.692 bits (670), Expect = 3.707e-73
Identity = 172/487 (35.32%), Postives = 273/487 (56.06%), Query Frame = 3
Query:  273 SSQDK--EYKL-DPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKTESLA 1724
            +SQ+K  EY   D + + E E  FL SKP CF++ GKPG G TTLA+     ++C  +    ++E+ I  +TE G  LQ++L  G  I +E+VI L+ +K+ SPEV H GY+I   P+ +   +T  +Q  ++K+  ++PD++I +K PD DL  R+  QR    TG +Y +  +DP+      +      KKE   D + EEEEEEEE+EE                 +  E +  L++RPED+L+ +E  ++ Y E     + + +   N   +I LN N P   LF  + +RL+YL+++ AA+  +L     +  EEE  D  + DELF+ L      AP ++W +S+W   CPV L +G +  G P ++V FL K+Y +SS++ +  F+ NPRPYLLP  P  PCK+ ++GP  SGKT L  +LA  YK +V++   L++P  D+A+   + N + ++T  AI+ V  K+ ++++  K    A
Sbjct:    2 TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEV-----IENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQ--------MVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKL-----QGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVVDYAQLVQPRFDKARETLVENTIAEATAAAIKVVKEKLLRELQARKQAETA 470          

HSP 2 Score: 60.077 bits (144), Expect = 4.677e-8
Identity = 34/120 (28.33%), Postives = 61/120 (50.83%), Query Frame = 3
Query: 1923 VDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAAR 2282
            V   +PEV  ++ + ++ ++        E + E L++ +  +  + + + P +  +GGW++DN P  +E W AL+    +K ++PD VI + D   N + L  R Y   K  IDS I  R
Sbjct:  574 VTADHPEVVTMIEETIKMSQDINFEQPYEKHAEILQEVLGEVMEENKDRFPGAPKYGGWIVDNCPIVKELWMALI----KKGIIPDLVIYLSDTENNGKCLFNRIYLQKKSEIDSKILER 689          
BLAST of Adenylate kinase 9 vs. Ensembl Human
Match: AK9 (adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33814])

HSP 1 Score: 251.136 bits (640), Expect = 1.597e-72
Identity = 161/438 (36.76%), Postives = 246/438 (56.16%), Query Frame = 3
Query:  273 SSQDK--EYKL-DPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVIN 1577
            +SQ+K  EY   D + + E E  FL SKP CF++ GKPG G TTLA+     ++C  +    ++E+ I  +TE G  LQ++L  G  I +E+VI L+ +K+ SPEV H GY+I   P+ +   +T  +Q  ++K+  ++PD++I +K PD DL  R+  QR    TG +Y +  +DP+      +      KKE   D + EEEEEEEE+EE                 +  E +  L++RPED+L+ +E  ++ Y E     + + +   N   +I LN N P   LF  + +RL+YL+++ AA+  +L     +  EEE  D  + DELF+ L      AP ++W +S+W   CPV L +G +  G P ++V FL K+Y +SS++ +  F+ NPRPYLLP  P  PCK+ ++GP  SGKT L  +LA  YK +V N
Sbjct:    2 TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEV-----IENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQ--------MVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKL-----QGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN 421          
BLAST of Adenylate kinase 9 vs. Ensembl Human
Match: AK9 (adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33814])

HSP 1 Score: 246.128 bits (627), Expect = 3.679e-72
Identity = 132/319 (41.38%), Postives = 195/319 (61.13%), Query Frame = 3
Query: 4779 WYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAE---EILRTAFLP--EHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
            W++W +   +V+    ++Q YL   +              +E  +RL + +++CPVSL++++EL   +    L FAAE+RG+YYKM  +E+L+ F +N E     L    LP  + +P ++  + ++  FP   +LQGYCPV + DG  RYE L+ G+   Y +EY  ++Y       +  F++ P K+W  +LP KLPP++  + + SLPLPGYLEQ +A +L  A+ A G LKPK+PF+   RSALLYIALHLKA+NPK  E+ R+KYK K+E+F  SCELI YL   MT KYKE + R + FD K+  FL LR ++
Sbjct:    5 WWVWNEVIKNVQMVNKYMQTYLERIK--------------AELLSRLGEFEQFCPVSLAESQELFDCSATDSLEFAAEFRGHYYKMSSQEKLNKFLENPELYVPPLAPHPLPSADMIPKRLTLSELKSRFPKCAELQGYCPVTYKDGNQRYEALVPGSIN-YALEYHNRIYICENKEKLQKFLRSPLKYWEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNAAGCLKPKFPFLSIRRSALLYIALHLKAFNPKGSEYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFLSLRNID 308          
BLAST of Adenylate kinase 9 vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 71.2478 bits (173), Expect = 5.164e-13
Identity = 50/167 (29.94%), Postives = 85/167 (50.90%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDE-FQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGD 857
            I +G PG+G  T A  F  + F C    G +L+   +   +E GK+L+  ++ G L+S+E+V  LI QK+E PE  + G+++DGFP  +     + E   IL+  K   D ++   I D  L  R+  +     +G     ++Y  +F      PP++ +K + TG+
Sbjct:   30 IFIGPPGSGKGTQAPAFAQKYFSCHLATG-DLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECKY-GFILDGFPRTSGQAEKLDE---ILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASG-----RSYHLEFK-----PPKVPMKDDLTGE 181          
BLAST of Adenylate kinase 9 vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 71.2478 bits (173), Expect = 5.164e-13
Identity = 50/167 (29.94%), Postives = 85/167 (50.90%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDE-FQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGD 857
            I +G PG+G  T A  F  + F C    G +L+   +   +E GK+L+  ++ G L+S+E+V  LI QK+E PE  + G+++DGFP  +     + E   IL+  K   D ++   I D  L  R+  +     +G     ++Y  +F      PP++ +K + TG+
Sbjct:   30 IFIGPPGSGKGTQAPAFAQKYFSCHLATG-DLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECKY-GFILDGFPRTSGQAEKLDE---ILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASG-----RSYHLEFK-----PPKVPMKDDLTGE 181          
BLAST of Adenylate kinase 9 vs. Ensembl Celegans
Match: F38B2.4 (Adenylate kinase isoenzyme 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20140])

HSP 1 Score: 55.8398 bits (133), Expect = 5.177e-8
Identity = 32/130 (24.62%), Postives = 71/130 (54.62%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQK-IESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQ 743
            F ++G PG+G  T     + ++   +++  +L+   ++  +  G +L  I+E G L+  E+V+DL+++  +++ E   +G+LIDG+P     +V   +QF   +S   +  ++++  + +  L  RLL +
Sbjct:   23 FFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIEKGSKGFLIDGYPR----EVAQGQQF---ESEIQEAKLVLFFDVAEETLVKRLLHR 145          

HSP 2 Score: 51.9878 bits (123), Expect = 1.017e-6
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 3
Query: 4224 PSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAI-ELLLMNSQCATKGYVLDGYPLAIEQ 4532
            P     VPI   I+G P SGK T  ++ V +YGL  ++ G  LR  +     +    ++ + +  G +VP E+V+  + E +L   +  +KG+++DGYP  + Q
Sbjct:   14 PLKAAGVPI-FFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKS--GSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIEKGSKGFLIDGYPREVAQ 114          
BLAST of Adenylate kinase 9 vs. Ensembl Celegans
Match: ZK673.2 (Probable adenylate kinase isoenzyme ZK673.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09629])

HSP 1 Score: 51.2174 bits (121), Expect = 2.312e-6
Identity = 40/143 (27.97%), Postives = 64/143 (44.76%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQ---CEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRG--YLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVY 773
            +L G  G+G  T+A++ + EF+     Y    + I  HI   TE G + Q+ L  G     E V D I       E+   G   ++DG+P   S    + EQ  +        ++++ LK+P   L +RL  Q + P +G  Y
Sbjct:    5 LLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIARGTEFGVRAQSFLNKG-----EHVPDSILNGAILAEMLKAGPRVVLDGYPRNMSQLKMVEEQAPL--------NLIVELKVPRKVLIDRLSKQLVHPASGRAY 134          
BLAST of Adenylate kinase 9 vs. Ensembl Fly
Match: Adk2 (gene:FBgn0283494 transcript:FBtr0072163)

HSP 1 Score: 72.0182 bits (175), Expect = 3.134e-13
Identity = 42/161 (26.09%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKK 842
            IL+G PG+G  T A L  ++F   +++  +++   I   +++G +L+ +++ G L+S+++V+D+I   ++ PE  + G+L+DGFP    T V   +   +L   K   D +I   I D  L  R+  + +   +G  Y ++   P  P + +V  + ++++
Sbjct:   22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPECKN-GFLLDGFPR---TVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRR 178          
BLAST of Adenylate kinase 9 vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082331)

HSP 1 Score: 68.1662 bits (165), Expect = 4.407e-12
Identity = 42/164 (25.61%), Postives = 85/164 (51.83%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPN--ANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            +++G PG+G  T+++L      C +I+  +++ Q+I   TE+GKK +  + +G L+ + +V   +  +I   EV +R Y++DGFP   A +  +   EQ           D +I L +P   + +R+ ++ +   +G VY     +P  P   +V  + ++++E
Sbjct:    9 VIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARIT--EVGNRSYILDGFPRNIAQAEALAAREQI----------DAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQRE 160          

HSP 2 Score: 65.0846 bits (157), Expect = 5.080e-11
Identity = 40/126 (31.75%), Postives = 67/126 (53.17%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDR 4628
            +  I+G P SGK T++E   K +G + I+ G  LR   N   NTEL K+ K Y+ +G +VP  +V K   +L   ++   + Y+LDG+P  I Q   +  ++ I + +   +  P  +I+   K+R
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQ--NIIKNTELGKKAKQYIAEGKLVPDAIVTKT--MLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVI--TLDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase 9 vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339379)

HSP 1 Score: 68.1662 bits (165), Expect = 4.407e-12
Identity = 42/164 (25.61%), Postives = 85/164 (51.83%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPN--ANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            +++G PG+G  T+++L      C +I+  +++ Q+I   TE+GKK +  + +G L+ + +V   +  +I   EV +R Y++DGFP   A +  +   EQ           D +I L +P   + +R+ ++ +   +G VY     +P  P   +V  + ++++E
Sbjct:    9 VIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARIT--EVGNRSYILDGFPRNIAQAEALAAREQI----------DAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQRE 160          

HSP 2 Score: 65.0846 bits (157), Expect = 5.080e-11
Identity = 40/126 (31.75%), Postives = 67/126 (53.17%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDR 4628
            +  I+G P SGK T++E   K +G + I+ G  LR   N   NTEL K+ K Y+ +G +VP  +V K   +L   ++   + Y+LDG+P  I Q   +  ++ I + +   +  P  +I+   K+R
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQ--NIIKNTELGKKAKQYIAEGKLVPDAIVTKT--MLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVI--TLDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase 9 vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082330)

HSP 1 Score: 68.1662 bits (165), Expect = 4.407e-12
Identity = 42/164 (25.61%), Postives = 85/164 (51.83%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPN--ANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            +++G PG+G  T+++L      C +I+  +++ Q+I   TE+GKK +  + +G L+ + +V   +  +I   EV +R Y++DGFP   A +  +   EQ           D +I L +P   + +R+ ++ +   +G VY     +P  P   +V  + ++++E
Sbjct:    9 VIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARIT--EVGNRSYILDGFPRNIAQAEALAAREQI----------DAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQRE 160          

HSP 2 Score: 65.0846 bits (157), Expect = 5.080e-11
Identity = 40/126 (31.75%), Postives = 67/126 (53.17%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDR 4628
            +  I+G P SGK T++E   K +G + I+ G  LR   N   NTEL K+ K Y+ +G +VP  +V K   +L   ++   + Y+LDG+P  I Q   +  ++ I + +   +  P  +I+   K+R
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQ--NIIKNTELGKKAKQYIAEGKLVPDAIVTKT--MLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVI--TLDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase 9 vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339378)

HSP 1 Score: 68.1662 bits (165), Expect = 4.407e-12
Identity = 42/164 (25.61%), Postives = 85/164 (51.83%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPN--ANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            +++G PG+G  T+++L      C +I+  +++ Q+I   TE+GKK +  + +G L+ + +V   +  +I   EV +R Y++DGFP   A +  +   EQ           D +I L +P   + +R+ ++ +   +G VY     +P  P   +V  + ++++E
Sbjct:    9 VIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARIT--EVGNRSYILDGFPRNIAQAEALAAREQI----------DAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQRE 160          

HSP 2 Score: 65.0846 bits (157), Expect = 5.080e-11
Identity = 40/126 (31.75%), Postives = 67/126 (53.17%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDR 4628
            +  I+G P SGK T++E   K +G + I+ G  LR   N   NTEL K+ K Y+ +G +VP  +V K   +L   ++   + Y+LDG+P  I Q   +  ++ I + +   +  P  +I+   K+R
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQ--NIIKNTELGKKAKQYIAEGKLVPDAIVTKT--MLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVI--TLDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase 9 vs. Ensembl Zebrafish
Match: ak9 (adenylate kinase 9 [Source:ZFIN;Acc:ZDB-GENE-041014-337])

HSP 1 Score: 479.945 bits (1234), Expect = 1.019e-139
Identity = 257/642 (40.03%), Postives = 392/642 (61.06%), Query Frame = 3
Query: 3807 EIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPM-HDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAF---LP--EHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRK 5714
            EI E F+ D + ++++ +  ++ QIPR  + AG    IV+Y+L K++K L++ R+S+F+ C P+S   A +L+ C  KY S FG W PV    E     P  D  H  FPVI   +IYF  SK+TR+ F+ NP+KYL+QP P  ++PIK+ I+G PKSGKTT+A+ F +EYGL R++ G A+R VLN    T+LA +++ +L +G  VP EL I+ +E+ +MN  C T+G+VLDG+P+   Q  ++ +  IIP  V EL     E++ R  +DR        + HDS + + I+ + +      +R     ++ N   +DA K  W++ E+   +V+  + HI +YL    +G+AA I  LCI P E ++RL +   YCPVSL+  + LV  + ++ L  AAE++G +YKM   E L+ F ++ E+ +       LP    LP+K+   +++  FP Q++++G+CPV +LDGK RYE L+ GN E Y  EYR K+Y F  +     F++ P  +W  +LP KLPP++  + + SLP+ GYLEQ++A  +  A+T  G LKPK+PF+   RSA+LY+A HLKA+N ++ E++R+KYK KL++FE  CELI YLS  M   YK   + P  F +K+  FL L K
Sbjct: 1111 EISERFEKDDDNLTSMTDLLSDNQIPRLVISAGRLPRIVRYQLLKEIKPLMENRDSLFQTCQPISYSLARRLLYCSFKYPSAFGCWDPVKY-TEGDLIQPPQDSYHSTFPVILHQFIYFFASKETRNTFILNPIKYLRQPRPNPSLPIKLAIIGPPKSGKTTVAQAFAREYGLTRLSIGDAIRMVLNSQAKTDLACQVQIHLKQGQTVPDELAIQCVEVAVMNLVCTTRGFVLDGFPVTKHQAELL-ESCIIPMVVVELQLDTVEVLKRGLRDREKNNRSHQVHHDSLQALNIRNSCFRQEAEALRLHLHNQYHNWTPVDAHKSKWWVQERILDEVRISMRHIHSYLERIHKGQAACINRLCITPQELQSRLGEFGHYCPVSLALHRHLVDCSHNTSLELAAEFKGQFYKMASREFLERFLESPEQFVAPGCPYPLPPASLLPHKLSAGQVKSRFPQQVEMKGFCPVTYLDGKQRYEALLRGNME-YAAEYRNKIYIFESEKKQEQFLRSPETYWDQKLPHKLPPLEEPVLLTSLPILGYLEQSVAVPIIKAMTDVGQLKPKFPFLSVKRSAILYLAFHLKAFNSRNSEYIRQKYKKKLQKFEEGCELISYLSTTMK-TYKSPLNLPTEFLQKLDRFLALEK 1748          

HSP 2 Score: 274.633 bits (701), Expect = 1.029e-73
Identity = 172/472 (36.44%), Postives = 271/472 (57.42%), Query Frame = 3
Query:  297 LDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKT 1712
            +D   + E E   L SKP+CFI++GKPG G +TLAK     + C  I+  +++  HI  +T+ GK+L  IL +G  + EEM+++LI  +++SP++ H GY++   P+ +   + I EQ +++K+ K+ PD +I +K  D DL  RL  +R  PETG V+ K+ +DPD             KKE    +   EEEEEEEEE   E  E+      +   L  + I +L++  E++ + + ++I+ Y +     + DY+   N   +  L+ N  P  LF+ +   L ++++R  AVPV+L       E+ E  D  + +ELF+ L    + APGF W  S WA  CPVAL EG +  G+P+FAVGF++K+Y++SS D +  F+ NPR YLL  +P +PC++SV+GP  SGK+ +  LLA +Y A V++++ LM+ ++   K+  L  V   +T   +E V AK    MELE T
Sbjct:   13 VDKLIEDEAERAILLSKPACFIIIGKPGVGKSTLAKKIAKTWNCILIDDTDVLNNHINNETDQGKQLFRILAEGKAVPEEMMVNLIVDRLKSPDIKHYGYVLACLPSISEEYMKIQEQIDLIKTLKMSPDFIINIKCADRDLIRRLSEERQHPETGCVFPKEKWDPD-------------KKESLMKQSNMEEEEEEEEEGEEETTEDLEVEEIEEIQLQKDVIAQLVRVTENYPENVTSRIKCYKDNILRPLEDYMAGHNPPYLFELDGNTDPEELFESVMSHLEFMAVRCPAVPVQLMPT----EDAELTDQMEPEELFRTLSSCRNVAPGFPWRTSRWAFNCPVALKEGKVIKGKPEFAVGFMDKIYVLSSDDALQKFMANPRCYLLQPKPHVPCRVSVIGPPRSGKSTMCGLLAEKYGALVVDVRELMERNQGLLKQDMLNKVRHDATIAGLEKVRAK----MELEAT 463          

HSP 3 Score: 235.343 bits (599), Expect = 1.226e-61
Identity = 188/574 (32.75%), Postives = 289/574 (50.35%), Query Frame = 3
Query: 1917 IFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARV-------------------------------------------GDKIKDAGTAKPDQEVVL-SVDSNLPPPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEKIFKPIAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNR-SKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALK 3503
            I V E +P+VQ  V +A++EA +   P   ELY++ LEK +K IE +      +++   GW+LD  P++R     + E +    L P+ +  +KD     + +L R Y  NKE +D A+  R+                                            DK  D G      EVVL +V  N  P GPE++  + E+  +  DW  +   I+ S   +E+      ++T + + Q     +EK FK  A+  +  D +E++EA       E+Q +   +E ++E    + KR LG+T ++CPV LK   +L P   E AAKY  K+YYFS +E+ EKF+Q+P  Y+  K + + PALR+ +LG +GSGKTTHG+ +AQ+L +FHI F+E LQE I  K  K++ P  D  PP             L+  A   + +S +  +N T  E    G  + K           E   E+E AIK  L+N   L +E+LE LL  +WN++P++  GF+LEGFP+N EE  F+AE+ LF D V  ++    +++ RLLP RL +W+ R+  K
Sbjct:  465 IEVTEDHPDVQAFVEEAIKEAAES--PAPRELYLDALEKHIKEIEAE----DADAESKRGWILD-IPSSRSHLITIEEIH--GALTPEIIFCLKDNDREGRTVLTRMYERNKEEVDQAVMTRLQNQRNLQKTQDHETLKHSEDSKKDSQYSDTLSKLETVHEESESSDKSDDEGKTPSKNEVVLPTVWENGHPDGPEMDVFKVELKQFVTDWESMEQTITCSYAVLEI-----NNKTPQGILQEMTDHMEKPFKHKAIMTSSADLEEEEEAIHMLIQAEKQDDVVNEEEEQESEEFNFKRQLGDTKHFCPVVLKEKGLLQPCLDEYAAKYRDKVYYFSSKEALEKFLQNPELYISNKELLKPPALRVSMLGVRGSGKTTHGKWLAQQLGIFHIQFRERLQELIQRKTQKRVSPADDSEPPEEPPEELQSL---LKAQARIQSAESPTDQDNTTSLEETASGSPDAK---------EEEALTEDEEAIKAYLQNGDPLPSEILEMLLFQWWNQEPYKSTGFILEGFPQNHEEVSFMAEHHLFPDVVAVMSVEVSEVVRRLLPSRLNRWRERRERK 1012          

HSP 4 Score: 56.9954 bits (136), Expect = 3.249e-7
Identity = 35/98 (35.71%), Postives = 50/98 (51.02%), Query Frame = 3
Query: 4050 RFGRW---CPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRI 4334
            R  RW   CPV+L  + G  +    +  P F V + + IY   S      FM NP  YL QP P   VP +V ++G P+SGK+T+     ++YG L +
Sbjct:  332 RTSRWAFNCPVAL--KEGKVI----KGKPEFAVGFMDKIYVLSSDDALQKFMANPRCYLLQPKPH--VPCRVSVIGPPRSGKSTMCGLLAEKYGALVV 421          

HSP 5 Score: 56.225 bits (134), Expect = 5.162e-7
Identity = 34/101 (33.66%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 2694 TNYW---CPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYL--PIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQ 2981
            T+ W   CPV LK  KV+  G PE A  ++ KIY  S +++ +KF+ +P  YL  P  H+P     R+ ++G   SGK+T    +A+K     +  +E+++
Sbjct:  333 TSRWAFNCPVALKEGKVI-KGKPEFAVGFMDKIYVLSSDDALQKFMANPRCYLLQPKPHVP----CRVSVIGPPRSGKSTMCGLLAEKYGALVVDVRELME 428          

HSP 6 Score: 54.299 bits (129), Expect = 1.779e-6
Identity = 32/91 (35.16%), Postives = 52/91 (57.14%), Query Frame = 3
Query: 1293 GFKWLKSEWANYCPVALFE-GILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIP--CKISVVGPNGSGKTILSQLLANR 1556
             FK    +  ++CPV L E G+LQP   ++A  + +KVY  SSK+ +  F++NP  Y+   +   P   ++S++G  GSGKT   + LA +
Sbjct:  747 NFKRQLGDTKHFCPVVLKEKGLLQPCLDEYAAKYRDKVYYFSSKEALEKFLQNPELYISNKELLKPPALRVSMLGVRGSGKTTHGKWLAQQ 837          
BLAST of Adenylate kinase 9 vs. Ensembl Zebrafish
Match: ak9 (adenylate kinase 9 [Source:ZFIN;Acc:ZDB-GENE-041014-337])

HSP 1 Score: 233.032 bits (593), Expect = 2.001e-67
Identity = 132/347 (38.04%), Postives = 203/347 (58.50%), Query Frame = 3
Query: 3876 QIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPM-HDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKA 4913
            QIPR  + AG    IV+Y+L K++K L++ R+S+F+ C P+S   A +L+ C  KY S FG W PV    E     P  D  H  FPVI   +IYF  SK+TR+ F+ NP+KYL+QP P  ++PIK+ I+G PKSGKTT+A+ F +EYGL R++ G A+R VLN    T+LA +++ +L +G  VP EL I+ +E+ +MN  C T+G+VLDG+P+   Q  ++ +  IIP  V EL     E++ R  +DR        + HDS + + I+ + +      +R     ++ N   +DA K  W++ E+   +V+  + HI +YL    +G++  I + C   S  K+
Sbjct:    2 QIPRLVISAGRLPRIVRYQLLKEIKPLMENRDSLFQTCQPISYSLARRLLYCSFKYPSAFGCWDPVKY-TEGDLIQPPQDSYHSTFPVILHQFIYFFASKETRNTFILNPIKYLRQPRPNPSLPIKLAIIGPPKSGKTTVAQAFAREYGLTRLSIGDAIRMVLNSQAKTDLACQVQIHLKQGQTVPDELAIQCVEVAVMNLVCTTRGFVLDGFPVTKHQAELL-ESCIIPMVVVELQLDTVEVLKRGLRDREKNNRSHQVHHDSLQALNIRNSCFRQEAEALRLHLHNQYHNWTPVDAHKSKWWVQERILDEVRISMRHIHSYLERIHKGESMQIMHSCQTSSTVKS 346          
BLAST of Adenylate kinase 9 vs. Ensembl Zebrafish
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 64.3142 bits (155), Expect = 4.618e-10
Identity = 52/200 (26.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query: 4230 PKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKE-IKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIF 4826
            P    P  + I+G P SGK T   +    Y    ++ G  LR  L  +  ++   E I   +  G + P E  I+ ++   +  Q A KG+++DG+P  I Q     ++   P  V  L    ++L  R  K  +    P    D+S  I  ++  + +NIN I ++Y +E   I  +DA++    ++    + VKE++F
Sbjct:  129 PSKPRPHIIFIIGGPGSGKGTQTAKIALRYDFEHVSVGEILRNQLLHHAPSDRKWELIAQIIANGELAPQETTIEELKQQFIKKQDA-KGFIVDGFPREISQAFTFEEQIGSPDLVILLACSNQQLRQRLEKRASQQGRP---DDNSHAIEKRLDTFKHNINLIAKYY-QERGLIVRVDADREEDDIFTDISAIVKERLF 323          
BLAST of Adenylate kinase 9 vs. Ensembl Zebrafish
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:553671])

HSP 1 Score: 65.0846 bits (157), Expect = 5.003e-10
Identity = 40/149 (26.85%), Postives = 73/149 (48.99%), Query Frame = 3
Query: 4143 YRNYIYFTKSKQTRDLFMTNPLKYLKQP--SPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFEL 4583
            Y N +    + Q      +  L ++  P  SP    P ++ + G P +GK+  A+   ++YG++ I  G  L+ V  +   + + + IK YL     VP  +V++ +   L    C T+G+VL G+P  +E+  +++     P+RVF L
Sbjct:  232 YHNCLKIINADQPHVDVFSQVLNFICTPRHSPSPYTP-RILLFGPPGAGKSLQAKLIAQKYGIINICCGELLKAVSADE--SHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTTQGWVLYGFPRDVEEAELLHKSNFTPNRVFFL 377          

HSP 2 Score: 61.6178 bits (148), Expect = 7.408e-9
Identity = 36/139 (25.90%), Postives = 70/139 (50.36%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVY 773
             IL+G P +G  T+AK   +  Q  +I   ++++      +++ +  Q+  +    + +++ I LI+Q++  P+   RG++++  P      + + E         I PD ++ L+ PD  L  R   +R+DP TGDVY
Sbjct:   60 IILLGPPASGKRTVAKKLCEHTQAIHITFSDILK----DDSDLTRAAQS-YDKKQNVPKDLWIQLIQQRLSKPDCVQRGWVLEAIPKTQDEALCLQEA-------GITPDHVVMLEAPDVVLIERSSGKRIDPVTGDVY 186          

HSP 3 Score: 55.0694 bits (131), Expect = 7.055e-7
Identity = 40/154 (25.97%), Postives = 76/154 (49.35%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEV 818
             +L G PGAG +  AKL   ++    I   EL++     ++ +G+ ++  LE    +   +V+ ++ +++   +   +G+++ GFP     DV   E+  +L      P+ + +L+I D     RL  + +DP TG+ ++   Y P  PP  EV
Sbjct:  270 ILLFGPPGAGKSLQAKLIAQKYGIINICCGELLKAVSADESHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTTQGWVLYGFPR----DV---EEAELLHKSNFTPNRVFFLEITDDIAIERLALRAVDPVTGE-WYHSVYKP--PPGPEV 413          

HSP 4 Score: 51.9878 bits (123), Expect = 7.118e-6
Identity = 39/144 (27.08%), Postives = 71/144 (49.31%), Query Frame = 3
Query: 4200 NPLKYLKQPSPKDAVPI-KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDR 4628
            +P++YL     +D V + ++ +LG P SGK T+A++  +    + IT    L+       +++L +  +SY  K   VP +L I+ I+  L    C  +G+VL+  P   ++   + +  I P  V  L +    LI R++  R
Sbjct:   41 DPIQYLINFLERDNVDVPRIILLGPPASGKRTVAKKLCEHTQAIHITFSDILKD------DSDLTRAAQSY-DKKQNVPKDLWIQLIQQRLSKPDCVQRGWVLEAIPKTQDEALCLQEAGITPDHVVMLEAPDVVLIERSSGKR 177          
BLAST of Adenylate kinase 9 vs. Ensembl Zebrafish
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:553671])

HSP 1 Score: 65.0846 bits (157), Expect = 6.501e-10
Identity = 39/149 (26.17%), Postives = 72/149 (48.32%), Query Frame = 3
Query: 4143 YRNYIYFTKSKQTRDLFMTNPLKYLKQP--SPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFEL 4583
            Y N +    + Q      +  L ++  P  SP    P ++ + G P +GK+  A+   ++YG++ I  G  L+ V  +   + + + IK YL     VP  +V++ +   L    C  +G+VL G+P  +E+  +++     P+RVF L
Sbjct:  233 YHNCLKIINADQPHVDVFSQVLNFICTPRHSPSPYTP-RILLFGPPGAGKSLQAKLIAQKYGIINICCGELLKAVSADE--SHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTARGWVLHGFPRDVEEAELLHKSNFTPNRVFFL 378          

HSP 2 Score: 64.3142 bits (155), Expect = 9.029e-10
Identity = 36/139 (25.90%), Postives = 69/139 (49.64%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVY 773
             IL+G P +G  T+AK   +  Q  +I   ++++      +++ +  Q+  +    + +++ I LI+Q +  P+   RG++++  P      + + E         I PD ++ L+ PD  L  R   +R+DP TGDVY
Sbjct:   60 IILLGPPASGKRTVAKKLCEHTQAIHITFSDILK----DDSDLTRAAQSYYDKKQNVPKDLWIQLIQQHLSKPDCVQRGWVLEAIPKTQDEALCLQEA-------GITPDHVVMLEAPDVVLIERSSGKRIDPVTGDVY 187          

HSP 3 Score: 58.151 bits (139), Expect = 7.480e-8
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEV 818
             +L G PGAG +  AKL   ++    I   EL++     ++ +G+ ++  LE    +   +V+ ++ +++   +   RG+++ GFP     DV   E+  +L      P+ + +L+I D     RL  + +DP TG+ ++   Y P  PP  EV
Sbjct:  271 ILLFGPPGAGKSLQAKLIAQKYGIINICCGELLKAVSADESHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTARGWVLHGFPR----DV---EEAELLHKSNFTPNRVFFLEITDDIAIERLALRAVDPVTGE-WYHSVYKP--PPGPEV 414          

HSP 4 Score: 55.8398 bits (133), Expect = 4.111e-7
Identity = 39/144 (27.08%), Postives = 71/144 (49.31%), Query Frame = 3
Query: 4200 NPLKYLKQPSPKDAVPI-KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDR 4628
            +P++YL     +D V + ++ +LG P SGK T+A++  +    + IT    L+       +++L +  +SY  K   VP +L I+ I+  L    C  +G+VL+  P   ++   + +  I P  V  L +    LI R++  R
Sbjct:   41 DPIQYLINFLERDNVDVPRIILLGPPASGKRTVAKKLCEHTQAIHITFSDILKD------DSDLTRAAQSYYDKKQNVPKDLWIQLIQQHLSKPDCVQRGWVLEAIPKTQDEALCLQEAGITPDHVVMLEAPDVVLIERSSGKR 178          
BLAST of Adenylate kinase 9 vs. Ensembl Xenopus
Match: AK9 (adenylate kinase 9 [Source:NCBI gene;Acc:100144994])

HSP 1 Score: 502.671 bits (1293), Expect = 2.766e-148
Identity = 263/627 (41.95%), Postives = 395/627 (63.00%), Query Frame = 3
Query: 3855 IESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEIL-----RTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
            +E+   ++IP   +  G K  IV Y+L++KL+ L++ RES+FE+ YP+S   A K+++  +K  S FGRW PV L ++     P   + +P FP++YR YIYF  +K+ R+LFM NP+KY++Q  PK +VPI++ ++G PKSGKT++A+ F   YGL R++ G A+R+VL    NTELA E+ S L KGLV+P +L +K +E+ LM+    T G V DG+P+   Q+ ++    IIP ++FEL +  +E++ R  +D+     P+P+HDS++I+ ++ + Y   +   +  Y + H N   +D+ +  W++  K   +V++ I  IQ+YL   +EG AA I + CI P E  +RL +  +YCPV L+Q  ELV  + +  L FAAE+RG+YYKM  ++ELD F  + E  +     R    PE LP  +    ++  FP   +++GYCPV ++DG  RYE L+ G+ E   VEYR K+Y F     +  FM++P K++  +LP KLPP    + + SLPL GYLEQ  A AL  A+   G LKPKYP+++  +SALLYIA HLKA+NP++ +++R KYK KLE+F   CELI YL D MT KYKE + RP+ FD KM  FL L+ ++
Sbjct:  981 LETVKRLKIPVVTINGGRKRHIVHYQLYEKLRNLVENRESLFEKSYPISLAVANKMLQMSYKQPSVFGRWDPVKL-SQGEVIKPFFTQENPGFPLLYRQYIYFFSTKENRNLFMKNPIKYIQQAKPKPSVPIRIAVVGPPKSGKTSVAKMFTSLYGLKRLSIGDAIRSVLENQPNTELATELNSILRKGLVLPDDLSVKCLEVALMDLTSNTNGVVFDGFPVTKHQVDLLEACSIIPIKIFELQAPIKEVLKRGLEDKKNSNRPYPVHDSAQILVVRNSCYKQEVILTKEHYSKLHQNWCEVDSLRSKWWVSNKITGEVQKSINQIQSYLERIKEGMAAGIADFCITPQELVSRLGEFGQYCPVCLAQRGELVDCSGNPSLQFAAEFRGHYYKMASQKELDAFLKSPELYVPPLAPRPIPPPELLPKTLTVADVKAKFPKNAEMKGYCPVTYVDGNKRYEALVPGHIEN-AVEYRDKIYIFETKEKLQKFMRLPEKYYNQKLPCKLPPKIEPVLLTSLPLTGYLEQGAATALIKAMNDVGCLKPKYPYLNIKQSALLYIAFHLKAFNPRNSDYIRNKYKKKLEQFVERCELITYLGDTMTRKYKEPQRRPIDFDFKMQSFLSLKGMD 1605          

HSP 2 Score: 231.106 bits (588), Expect = 3.026e-60
Identity = 181/575 (31.48%), Postives = 297/575 (51.65%), Query Frame = 3
Query: 1860 GQKSFEEEIVR--DLPEKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARV----GDKIKDAGTAKPDQ-------EVVLSVDSNLP-------PPGPELNTARKEISDWYQDWNGVLSIISNSP----THIEVIESNFEDRTIEELYQFTEKEIEKIFKPIA--VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKD 3506
            G+ +F+E  +      E L EI  D  +PEV ++V +A++ A +  + +  +LYM  LE+A+  +  + +++  +    GGWVLDNFPN+   W A+     ++  LPD VI ++D ++N ++LL R Y  N++ I+  I  R+      K+++   A+  Q         +L ++  LP       P  PE+   ++ I+ + + W  +  I++++     T++E+     ++++ E + Q T   +EK FK     +   D+DE+ +D   E +  E+EQ E E +   EE    + R  G++ ++CPV LK + VL PG  E AA Y  K+YY S  E+R+KF+ +P  Y+  K   ++P LR++++G  G+GKT   R +A+KL +FHI F+E LQE +L K  +KIGP+Y E             ++E   S              AT +E  +  E+                      A+K  LE+   L  ELL+ ++ D+W+++PF   GF+L+GFP  AEE Q+L E   F D  + L   E  I  RLLPPRL KWK R+  K+
Sbjct:  370 GKVTFQERFIAFGVTAEVLEEITAD--HPEVLEIVAEAVKAASETPVTITPDLYMAALEQAINKLHEENKERFTSDPPAGGWVLDNFPNSPNCWLAM----ADRGFLPDTVICLRDSADNGKYLLNRLYLMNEQDINDNIIQRLQKERARKLQEEEEARYSQYHPLTNIAFILLLEIILPEVPEGGFPDVPEMEPLKEFITKFNEGWILIEPILNDAGNPILTYLEI-----KEKSPETMLQETISSMEKPFKYYGWEMTSEDIDEEAEDMQAELDSEEQEQEENENESGGEEEEEVRFRNYGDSKHFCPVALKDNFVLYPGESEYAAVYREKLYYCSTPEARDKFLDNPENYIINKEPLKAPPLRVLLIGNSGAGKTVCARWLAEKLGIFHIQFREYLQEIMLSKLQRKIGPQYAE------------EVKERRASGLMVIFFF-----CATKEEVVLTDEEE---------------------AVKSYLEDASPLPAELLDQIVTDWWSEEPFRSTGFILDGFPNTAEETQYLGEKGFFPDIAVFLDVEESAICDRLLPPRLAKWKERQMRKE 895          

HSP 3 Score: 119.783 bits (299), Expect = 3.657e-26
Identity = 64/174 (36.78%), Postives = 97/174 (55.75%), Query Frame = 3
Query:  273 SSQDKEYKLDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDP 794
            +SQ++    D + + E +  FL SKP+CF+++GKPG G  TL K     +   +I G + +                 +    +I EE+V  LI  KI SPEVAH GY++ GFP+     V I +Q  ++K+FK+ PDI+I +K PD DL  RL   + DP TG +Y ++++DP
Sbjct:    2 ASQERPTFADIFDEDEAQQSFLMSKPTCFLIVGKPGTGKATLGKKISQAWNSIFIEGNKYL-------------YFIFILLSRIIPEELVTHLILDKINSPEVAHLGYVLCGFPSLCEEYVKIPQQIELIKNFKLTPDIIINIKCPDTDLGKRLCGLKQDPNTGIIYQREDWDP 162          

HSP 4 Score: 106.686 bits (265), Expect = 3.346e-22
Identity = 53/108 (49.07%), Postives = 73/108 (67.59%), Query Frame = 3
Query: 1248 DELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQV 1571
            D+L + L   S  AP ++W +S W   CPVAL EG ++ G  +FAV FL+K+YLMSS++ +  F++NPR YLLP  P  PCK++VVGP  SGKT L   +AN+Y  +V
Sbjct:  265 DQLLRLLASSSMIAPRYRWRRSRWGQTCPVALKEGFIKRGLVEFAVSFLDKMYLMSSEEALRKFMQNPRQYLLPPMPLPPCKVAVVGPKCSGKTTLCNFIANKYAGKV 372          

HSP 5 Score: 63.1586 bits (152), Expect = 6.018e-9
Identity = 43/160 (26.88%), Postives = 75/160 (46.88%), Query Frame = 3
Query: 4062 WCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTV----LNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIE 4529
            +CPV+L +    F+    E+   +  +YR  +Y+  + + RD F+ NP  Y+    P  A P++V ++G   +GKT  A    ++ G+  I     L+ +    L      + A+E+K     GL+V         E++L + + A K Y+ D  PL  E
Sbjct:  666 FCPVALKDN---FVLYPGESE--YAAVYREKLYYCSTPEARDKFLDNPENYIINKEPLKAPPLRVLLIGNSGAGKTVCARWLAEKLGIFHIQFREYLQEIMLSKLQRKIGPQYAEEVKERRASGLMVIFFFCATKEEVVLTDEEEAVKSYLEDASPLPAE 820          

HSP 6 Score: 52.7582 bits (125), Expect = 8.130e-6
Identity = 29/90 (32.22%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 1311 SEWANYCPVALFEG-ILQP----GQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPE--IPCKISVVGPNGSGKTILSQLLANRY 1559
            S +  + PV L +G +++P      P F + +   +Y  S+K+  NLF++NP  Y+  ++P+  +P +I+VVGP  SGKT ++++  + Y
Sbjct: 1045 SVFGRWDPVKLSQGEVIKPFFTQENPGFPLLYRQYIYFFSTKENRNLFMKNPIKYIQQAKPKPSVPIRIAVVGPPKSGKTSVAKMFTSLY 1134          

HSP 7 Score: 52.7582 bits (125), Expect = 9.303e-6
Identity = 25/81 (30.86%), Postives = 51/81 (62.96%), Query Frame = 3
Query: 1323 NYCPVALFEG-ILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQP--EIPCKISVVGPNGSGKTILSQLLANR 1556
            ++CPVAL +  +L PG+ ++A  +  K+Y  S+ +  + F+ NP  Y++  +P    P ++ ++G +G+GKT+ ++ LA +
Sbjct:  665 HFCPVALKDNFVLYPGESEYAAVYREKLYYCSTPEARDKFLDNPENYIINKEPLKAPPLRVLLIGNSGAGKTVCARWLAEK 745          
BLAST of Adenylate kinase 9 vs. Ensembl Xenopus
Match: AK9 (adenylate kinase 9 [Source:NCBI gene;Acc:100144994])

HSP 1 Score: 501.516 bits (1290), Expect = 6.626e-148
Identity = 262/621 (42.19%), Postives = 392/621 (63.12%), Query Frame = 3
Query: 3873 MQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEIL-----RTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
            ++IP   +  G K  IV Y+L++KL+ L++ RES+FE+ YP+S   A K+++  +K  S FGRW PV L ++     P   + +P FP++YR YIYF  +K+ R+LFM NP+KY++Q  PK +VPI++ ++G PKSGKT++A+ F   YGL R++ G A+R+VL    NTELA E+ S L KGLV+P +L +K +E+ LM+    T G V DG+P+   Q+ ++    IIP ++FEL +  +E++ R  +D+     P+P+HDS++I+ ++ + Y   +   +  Y + H N   +D+ +  W++  K   +V++ I  IQ+YL   +EG AA I + CI P E  +RL +  +YCPV L+Q  ELV  + +  L FAAE+RG+YYKM  ++ELD F  + E  +     R    PE LP  +    ++  FP   +++GYCPV ++DG  RYE L+ G+ E   VEYR K+Y F     +  FM++P K++  +LP KLPP    + + SLPL GYLEQ  A AL  A+   G LKPKYP+++  +SALLYIA HLKA+NP++ +++R KYK KLE+F   CELI YL D MT KYKE + RP+ FD KM  FL L+ ++
Sbjct:  979 LKIPVVTINGGRKRHIVHYQLYEKLRNLVENRESLFEKSYPISLAVANKMLQMSYKQPSVFGRWDPVKL-SQGEVIKPFFTQENPGFPLLYRQYIYFFSTKENRNLFMKNPIKYIQQAKPKPSVPIRIAVVGPPKSGKTSVAKMFTSLYGLKRLSIGDAIRSVLENQPNTELATELNSILRKGLVLPDDLSVKCLEVALMDLTSNTNGVVFDGFPVTKHQVDLLEACSIIPIKIFELQAPIKEVLKRGLEDKKNSNRPYPVHDSAQILVVRNSCYKQEVILTKEHYSKLHQNWCEVDSLRSKWWVSNKITGEVQKSINQIQSYLERIKEGMAAGIADFCITPQELVSRLGEFGQYCPVCLAQRGELVDCSGNPSLQFAAEFRGHYYKMASQKELDAFLKSPELYVPPLAPRPIPPPELLPKTLTVADVKAKFPKNAEMKGYCPVTYVDGNKRYEALVPGHIEN-AVEYRDKIYIFETKEKLQKFMRLPEKYYNQKLPCKLPPKIEPVLLTSLPLTGYLEQGAATALIKAMNDVGCLKPKYPYLNIKQSALLYIAFHLKAFNPRNSDYIRNKYKKKLEQFVERCELITYLGDTMTRKYKEPQRRPIDFDFKMQSFLSLKGMD 1597          

HSP 2 Score: 219.935 bits (559), Expect = 8.638e-57
Identity = 170/521 (32.63%), Postives = 275/521 (52.78%), Query Frame = 3
Query: 2016 MEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARV----GDKIKDAGTAKPDQ-------EVVLSVDSNLP-------PPGPELNTARKEISDWYQDWNGVLSIISNSP----THIEVIESNFEDRTIEELYQFTEKEIEKIFKPIA--VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKD 3506
            +E + +AVK +  + +++  +    GGWVLDNFPN+   W A+     ++  LPD VI ++D ++N ++LL R Y  N++ I+  I  R+      K+++   A+  Q         +L ++  LP       P  PE+   ++ I+ + + W  +  I++++     T++E+     ++++ E + Q T   +EK FK     +   D+DE+ +D   E +  E+EQ E E +   EE    + R  G++ ++CPV LK + VL PG  E AA Y  K+YY S  E+R+KF+ +P  Y+  K   ++P LR++++G  G+GKT   R +A+KL +FHI F+E LQE +L K  +KIGP+Y E   V ++   +  + ELE S  + A+  E+  E    DE                           E A+K  LE+   L  ELL+ ++ D+W+++PF   GF+L+GFP  AEE Q+L E   F D  + L   E  I  RLLPPRL KWK R+  K+
Sbjct:  388 LEIVAEAVKALHEENKERFTSDPPAGGWVLDNFPNSPNCWLAM----ADRGFLPDTVICLRDSADNGKYLLNRLYLMNEQDINDNIIQRLQKERARKLQEEEEARYSQYHPLTNIAFILLLEIILPEVPEGGFPDVPEMEPLKEFITKFNEGWILIEPILNDAGNPILTYLEI-----KEKSPETMLQETISSMEKPFKYYGWEMTSEDIDEEAEDMQAELDSEEQEQEENENESGGEEEEEVRFRNYGDSKHFCPVALKDNFVLYPGESEYAAVYREKLYYCSTPEARDKFLDNPENYIINKEPLKAPPLRVLLIGNSGAGKTVCARWLAEKLGIFHIQFREYLQEIMLSKLQRKIGPQYAE--EVKEYPNEETPLMELENS--DLAIAEENTAEVVLTDE---------------------------EEAVKSYLEDASPLPAELLDQIVTDWWSEEPFRSTGFILDGFPNTAEETQYLGEKGFFPDIAVFLDVEESAICDRLLPPRLAKWKERQMRKE 868          

HSP 3 Score: 151.369 bits (381), Expect = 7.852e-36
Identity = 136/444 (30.63%), Postives = 199/444 (44.82%), Query Frame = 3
Query:  273 SSQDKEYKLDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDP----------ETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHV-VGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQV 1571
            +SQ++    D + + E +  FL SKP+CF+++GKPG G  TL K     +   +I G + +                 +    +I EE+V  LI  KI SPEVAH G                                    K PD DL  RL   + DP TG +Y ++++DP               KEK   ++  EE EEEEEEE  EE     + N      D               KL+ RPEDF + ++ +I+ + +     + D + + +                  +L E      +     P ++F V V   E  E    +  D+L + L   S  AP ++W +S W   CPVAL EG ++ G  +FAV FL+K+YLMSS++ +  F++NPR YLLP  P  PCK++VVGP  SGKT L   +AN+Y  +V
Sbjct:    2 ASQERPTFADIFDEDEAQQSFLMSKPTCFLIVGKPGTGKATLGKKISQAWNSIFIEGNKYL-------------YFIFILLSRIIPEELVTHLILDKINSPEVAHLG------------------------------------KCPDTDLGKRLCGLKQDPNTGIIYQREDWDPAL-------------KEKQKKQQVGEEGEEEEEEEEEEEELEEEQINETLSYFDDFFFHSKEEEMSLTEKLVYRPEDFPENVKERIKLFKDILLRPVEDLMIDHDP----------------HYLIE------LDGNMKPQKIFEVSVMHREATEIHFFTLQDQLLRLLASSSMIAPRYRWRRSRWGQTCPVALKEGFIKRGLVEFAVSFLDKMYLMSSEEALRKFMQNPRQYLLPPMPLPPCKVAVVGPKCSGKTTLCNFIANKYAGKV 361          

HSP 4 Score: 56.6102 bits (135), Expect = 5.922e-7
Identity = 48/209 (22.97%), Postives = 83/209 (39.71%), Query Frame = 3
Query: 4062 WCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALR--------------------------TVLNENWNTELA---------------KEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIP 4565
            +CPV+L +      P   E    +  +YR  +Y+  + + RD F+ NP  Y+    P  A P++V ++G   +GKT  A    ++ G+  I     L+                          T L E  N++LA               + +KSYL     +P EL+ + +          + G++LDG+P   E+   + +K   P
Sbjct:  632 FCPVALKDNF-VLYPGESE----YAAVYREKLYYCSTPEARDKFLDNPENYIINKEPLKAPPLRVLLIGNSGAGKTVCARWLAEKLGIFHIQFREYLQEIMLSKLQRKIGPQYAEEVKEYPNEETPLMELENSDLAIAEENTAEVVLTDEEEAVKSYLEDASPLPAELLDQIVTDWWSEEPFRSTGFILDGFPNTAEETQYLGEKGFFP 835          

HSP 5 Score: 53.1434 bits (126), Expect = 6.582e-6
Identity = 29/90 (32.22%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 1311 SEWANYCPVALFEG-ILQP----GQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPE--IPCKISVVGPNGSGKTILSQLLANRY 1559
            S +  + PV L +G +++P      P F + +   +Y  S+K+  NLF++NP  Y+  ++P+  +P +I+VVGP  SGKT ++++  + Y
Sbjct: 1037 SVFGRWDPVKLSQGEVIKPFFTQENPGFPLLYRQYIYFFSTKENRNLFMKNPIKYIQQAKPKPSVPIRIAVVGPPKSGKTSVAKMFTSLY 1126          

HSP 6 Score: 53.1434 bits (126), Expect = 7.282e-6
Identity = 25/81 (30.86%), Postives = 51/81 (62.96%), Query Frame = 3
Query: 1323 NYCPVALFEG-ILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQP--EIPCKISVVGPNGSGKTILSQLLANR 1556
            ++CPVAL +  +L PG+ ++A  +  K+Y  S+ +  + F+ NP  Y++  +P    P ++ ++G +G+GKT+ ++ LA +
Sbjct:  631 HFCPVALKDNFVLYPGESEYAAVYREKLYYCSTPEARDKFLDNPENYIINKEPLKAPPLRVLLIGNSGAGKTVCARWLAEK 711          
BLAST of Adenylate kinase 9 vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 70.4774 bits (171), Expect = 1.112e-12
Identity = 37/162 (22.84%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            ++MG PG+G  T++   +  F  ++++  +L+  +++ +TE+G   ++ ++ G L+ ++++  L+ Q++   ++    +L+DGFP      V + + F+I        + +I L +P   +K+RL ++ + P +G VY  +   P  P   ++  + +V++E
Sbjct:   10 VIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRTNVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELH--KINETNWLLDGFPRTVPQAVALDKAFHI--------NSVIDLNVPFQTIKDRLTARWIHPASGRVYNTEFNPPKVPEVDDLTGEPLVQRE 161          

HSP 2 Score: 55.4546 bits (132), Expect = 1.507e-7
Identity = 32/101 (31.68%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAI--ELLLMNSQCATKGYVLDGYPLAIEQIAMMN 4547
            +  I+G P SGK T+++R VK + L  ++ G  LRT  N    TE+    KSY+ +G +VP +++ + +  EL  +N       ++LDG+P  + Q   ++
Sbjct:    8 RAVIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRT--NVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINE----TNWLLDGFPRTVPQAVALD 102          
BLAST of Adenylate kinase 9 vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 70.8626 bits (172), Expect = 1.199e-12
Identity = 37/162 (22.84%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            ++MG PG+G  T++   +  F  ++++  +L+  +++ +TE+G   ++ ++ G L+ ++++  L+ Q++   ++    +L+DGFP      V + + F+I        + +I L +P   +K+RL ++ + P +G VY  +   P  P   ++  + +V++E
Sbjct:   10 VIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRTNVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELH--KINETNWLLDGFPRTVPQAVALDKAFHI--------NSVIDLNVPFQTIKDRLTARWIHPASGRVYNTEFNPPKVPEVDDLTGEPLVQRE 161          

HSP 2 Score: 55.8398 bits (133), Expect = 1.457e-7
Identity = 32/101 (31.68%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAI--ELLLMNSQCATKGYVLDGYPLAIEQIAMMN 4547
            +  I+G P SGK T+++R VK + L  ++ G  LRT  N    TE+    KSY+ +G +VP +++ + +  EL  +N       ++LDG+P  + Q   ++
Sbjct:    8 RAVIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRT--NVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINE----TNWLLDGFPRTVPQAVALD 102          
BLAST of Adenylate kinase 9 vs. Ensembl Xenopus
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:448011])

HSP 1 Score: 68.1662 bits (165), Expect = 1.142e-11
Identity = 43/166 (25.90%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGD 857
            IL+G PGAG  T A    +++   ++   +++   +   +E+G +L+  ++ G L+S+EMV++LI + +++P    +G+L+DGFP        + E   +L+  + + D +I  K+ D  L  R+  + +   +G     ++Y  +F      PP+  +K + TG+
Sbjct:   21 ILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPC-KKGFLLDGFPRTVKQAEMLDE---LLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSG-----RSYHEEFN-----PPKEAMKDDVTGE 172          

HSP 2 Score: 58.9214 bits (141), Expect = 1.307e-8
Identity = 34/117 (29.06%), Postives = 63/117 (53.85%), Query Frame = 3
Query: 4227 SPKDAVP---------IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMND 4550
            +P++A P         I+  +LG P +GK T A +  ++Y +  +  G  LR ++     +EL   +K+ +  G +V  E+V++ IE  L    C  KG++LDG+P  ++Q  M+++
Sbjct:    2 APREAAPAERGSVMEGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVAS--GSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPC-KKGFLLDGFPRTVKQAEMLDE 115          
BLAST of Adenylate kinase 9 vs. Ensembl Mouse
Match: Ak9 (adenylate kinase 9 [Source:MGI Symbol;Acc:MGI:2685080])

HSP 1 Score: 546.969 bits (1408), Expect = 3.144e-162
Identity = 281/645 (43.57%), Postives = 415/645 (64.34%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIE-LPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAE-----EILRTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
            NE+ E F+ +TN I ++ + F ++ IP   V    K+ IVQY +  KLK L++ RES+FE+CYPVS   A K++   +K++S FG W PV L +E     P+ +  +P+ PVI+R+YIYF  +KQT++ FM NP+KY++QP PK  +P+++ I+G PKSGKTT+A++   +YGL  ++ G ALR +LN + ++EL+  +  +L KG  VP EL I+A+++ LM S C T G V+DGYP+   Q+ ++  + IIP  +FEL    +E+  R   ++   + + +P+H+SS+IIA K A Y  NINEIR++Y ++H N   ID     W++W +   D+++   +IQ Y+   +EGKAA I  LCI P E  ARL + K++CPVSL+++ EL+  +  S L FAAE+RG+YYKM  +E+L+ F  + E              + LP ++  + ++  FP   +LQGYCPV + DGK RYE L+ GN  +Y +EYR  +Y    +  +  FM+ P ++W  +LP+KLPP+K S+++ SLPLPGYLEQ  A +L  A+ A G LKPK PF+   RS LLYIA HLKA+NPK  E+ R+KYK KLE+F   CELI YLS  MT KYKE + R + FD K+  FL L+ ++
Sbjct: 1248 NELGEKFETETNNIQSIQDEFDKVLIPIIMVNGARKMHIVQYVMNMKLKPLVENRESIFEKCYPVSSHLAHKMLSYTYKHMSSFGYWDPVKL-SEGETIKPVENAENPLNPVIHRHYIYFLSNKQTKEKFMMNPIKYIRQPKPKATMPVRIMIVGPPKSGKTTVAKKLASDYGLRCLSVGDALRGMLNNHPDSELSLMLNWHLHKGKTVPDELAIQALDISLMESVCNTIGVVIDGYPVTPHQMDLLEARSIIPMVIFELHVPSKEIFKRLLLEKKTEQSMSYPLHNSSQIIAYKNAKYHKNINEIRQFYQKQHQNWHVIDGFHSKWWVWNEVLKDIQQMNKYIQTYMKKIKEGKAACIDKLCITPEELIARLGEFKQFCPVSLAESNELIDCSVTSSLEFAAEFRGHYYKMSSQEKLNKFLKDPELYVPPLAPHPLPPDDLLPKRLTLSELKSRFPKCAELQGYCPVTYQDGKQRYEALVPGNI-RYALEYRNCIYICESEEKLQKFMRSPMQYWNQKLPRKLPPLKESIHLTSLPLPGYLEQGTATSLIKAMNAAGNLKPKLPFLSVRRSVLLYIAFHLKAFNPKGSEYSRKKYKKKLEQFVERCELITYLSSKMTRKYKEPQFRAIDFDHKLQTFLSLKNID 1890          

HSP 2 Score: 303.908 bits (777), Expect = 1.439e-82
Identity = 237/709 (33.43%), Postives = 387/709 (54.58%), Query Frame = 3
Query:  273 SSQDKEYKLDPYSD----KEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKI--KKQMELEKTESLAKIAV--------DNLAQSAIDGIE-ENTRDRIINXXXXXXXXXXXXXXXXXTIQGQKSFE---EEIVRDLPEKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARVGDKIKDAGTAKPDQEVVLSV 2345
            +S++K  +L P++D     E +   L SKP+CFI+ GKPGAG TTLA+     ++C  +    ++E+HI  + E G  LQ++L  G  I +E+V  LI +KI+SPEVAH GY++   P+    ++T  +Q  ++K+ ++QPDI+I +K  D DL  R   QR    TG VY ++ +DP+   S     +   K+ K+ +EEEEEE+EEEE      +             +  E ++ L++RPED+L+ +E  ++ Y E   S + + +   N   +I L+ N  P  LF  + ERL+YL++R AAV  +L     +  EEE  D  D +ELF+ +      AP ++W +S+WA  CPV+L +G +  G   + V FL K+Y +SS++ + LF  NPRP+LLP  P  PCK+ + GP   GKT L+ L+A  +KA+VI+   L++P  D A+   + + + ++T  AI+ V  ++  +KQ + ++  +L ++ V        D L++S+ +    ENT  ++       E   + + +SE TI G +  +   EE + ++ E  PE+F       ++D +R A E   +Q    + E+    LE+ +K  E   + + P +  HGGW+++NFP  RE W +L+    EK LLPD V+ + D   N + +L R Y  NK  ID  I  R+ +   +A   K ++E +  V
Sbjct:    2 ASEEKTEELHPFTDIFNEDETDRNCLLSKPTCFIIFGKPGAGKTTLARNIAQAWKCIRVEALSVLEEHIAAEKETGAMLQSLLVSGHSIPDELVTKLILEKIKSPEVAHFGYILTEMPSLAQDNMTSLKQIELVKNLELQPDIIINIKCSDYDLCQRTCGQRQHSTTGYVYTREQWDPEIIESRRRKKRDFPKEGKSEEEEEEEEQEEEEAFIAEMQ-------------MVAEILQHLVQRPEDYLENVEITVKLYKELLLSALEEVMAEHNPQYLIELDGNKSPEELFMTVIERLKYLNVRRAAVITKL-----QGTEEEMTDIIDTEELFRTVSSYKLIAPRYRWYRSKWARSCPVSLKDGNIYSGAADYTVSFLGKMYCLSSEETLKLFSLNPRPFLLPPMPLPPCKVFIFGPEHIGKTTLANLIAEHFKAKVIDYAKLVQPRFDSAREKLIKDTITEATNTAIKVVQQRLLNEKQAKQQEERTLKELQVQYSKREYNDFLSKSSEELPSLENTGSKL----SSLEIGQEDKSKSETTITGDQVKDVSTEESIEEVTENHPEVFAI-----LEDTLRHAKELNFEQPHDKQAEI----LEEVIKETEDN-KNRFPGAPKHGGWIVENFPLVRELWLSLI----EKALLPDLVVYLSDAESNGKHVLNRLYLKNKAEIDGKILERLQE---EAQAKKREEEEIRKV 671          

HSP 3 Score: 183.726 bits (465), Expect = 8.489e-46
Identity = 105/287 (36.59%), Postives = 160/287 (55.75%), Query Frame = 3
Query: 2676 KRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSA----DENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKDLYKRKL 3524
            +R +G+T ++CPV LK + VL PGNP+ A KY  KIYYFS  E++EKF++ P  Y+      ++P LR+ +LG  GSGKT   RK+A+   +FHI F E LQE +L K  +K GPE+++       +  +  +EEL   A    +E+  K + P    T +E                             AIK +L + + L +E+L+++L ++W K+P    GF+L+GFPR+ EEAQFL E   F D  + +   + DI  RLLP +++KWK ++  K L ++KL
Sbjct:  910 RRHMGDTKHFCPVVLKENFVLQPGNPDEAVKYREKIYYFSSTEAKEKFLEHPEDYVSQNEPLKAPPLRICLLGPHGSGKTVCARKLAENFGIFHIQFDEFLQEKMLLKAERKFGPEFEDDSEEEQLVKQE--LEELAAQANVKIEEDTTKKQLPDVQLTEEE----------------------------EAIKLSLTDNEPLPSEILDSILSEWWLKEPIRSTGFILDGFPRHPEEAQFLGERGFFPDAAVIIQVDDQDIFDRLLPAQVQKWKTKQH-KKLERKKL 1165          

HSP 4 Score: 62.7734 bits (151), Expect = 6.086e-9
Identity = 31/82 (37.80%), Postives = 50/82 (60.98%), Query Frame = 3
Query: 1323 NYCPVALFEG-ILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQP--EIPCKISVVGPNGSGKTILSQLLANRY 1559
            ++CPV L E  +LQPG P  AV +  K+Y  SS +    F+ +P  Y+  ++P    P +I ++GP+GSGKT+ ++ LA  +
Sbjct:  918 HFCPVVLKENFVLQPGNPDEAVKYREKIYYFSSTEAKEKFLEHPEDYVSQNEPLKAPPLRICLLGPHGSGKTVCARKLAENF 999          

HSP 5 Score: 56.6102 bits (135), Expect = 3.854e-7
Identity = 30/99 (30.30%), Postives = 51/99 (51.52%), Query Frame = 3
Query: 4038 KYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRI 4334
            +++     +CPV +L E     P     +P   V YR  IY+  S + ++ F+ +P  Y+ Q  P  A P+++C+LG   SGKT  A +  + +G+  I
Sbjct:  911 RHMGDTKHFCPV-VLKENFVLQP----GNPDEAVKYREKIYYFSSTEAKEKFLEHPEDYVSQNEPLKAPPLRICLLGPHGSGKTVCARKLAENFGIFHI 1004          
BLAST of Adenylate kinase 9 vs. Ensembl Mouse
Match: Ak2 (adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:87978])

HSP 1 Score: 74.3294 bits (181), Expect = 6.492e-14
Identity = 44/149 (29.53%), Postives = 81/149 (54.36%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQF-NILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFP 803
            +L+G PGAG  T A    + F   ++   +++   +   +E+GKKL+  ++ G L+S+EMV++LI + +E+P   + G+L+DGFP      V   E   ++++  K + D +I   I D  L  R+  + + P++G  Y ++   P  P
Sbjct:   19 VLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKN-GFLLDGFPRT----VRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEP 162          

HSP 2 Score: 59.6918 bits (143), Expect = 6.133e-9
Identity = 31/101 (30.69%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMND 4550
            I+  +LG P +GK T A +  + + +  +  G  LR ++     +EL K++K+ +  G +V  E+V++ IE  L    C   G++LDG+P  + Q  M++D
Sbjct:   16 IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVAS--GSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKN-GFLLDGFPRTVRQAEMLDD 113          
BLAST of Adenylate kinase 9 vs. Ensembl Mouse
Match: Ak2 (adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:87978])

HSP 1 Score: 74.3294 bits (181), Expect = 8.188e-14
Identity = 44/149 (29.53%), Postives = 81/149 (54.36%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQF-NILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFP 803
            +L+G PGAG  T A    + F   ++   +++   +   +E+GKKL+  ++ G L+S+EMV++LI + +E+P   + G+L+DGFP      V   E   ++++  K + D +I   I D  L  R+  + + P++G  Y ++   P  P
Sbjct:   19 VLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKN-GFLLDGFPRT----VRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEP 162          

HSP 2 Score: 59.6918 bits (143), Expect = 7.212e-9
Identity = 31/101 (30.69%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMND 4550
            I+  +LG P +GK T A +  + + +  +  G  LR ++     +EL K++K+ +  G +V  E+V++ IE  L    C   G++LDG+P  + Q  M++D
Sbjct:   16 IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVAS--GSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKN-GFLLDGFPRTVRQAEMLDD 113          
BLAST of Adenylate kinase 9 vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 63.5438 bits (153), Expect = 3.058e-10
Identity = 42/161 (26.09%), Postives = 81/161 (50.31%), Query Frame = 3
Query:  336 LNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDF-PPSIE 815
            + SK    +++G PG+G  T+ +     F  ++++   L+ ++++  TEVG   +  LE G L+ + ++  L+  ++E+    H  +L+DGFP        +    ++        D++I L IP   LK+RL  + + P +G V     Y+ DF PP ++
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQH--WLLDGFPRTLVQAEALDGICDV--------DLVISLNIPFETLKDRLSRRWIHPSSGRV-----YNLDFNPPQVQ 146          

HSP 2 Score: 58.9214 bits (141), Expect = 1.005e-8
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKG---YVLDGYPLAIEQIAMMN 4547
            ++  ILG P SGK T+ ER  + +GL  ++ G  LR   N    TE+    K YL KGL+VP  ++ +     LM S+  T+    ++LDG+P  + Q   ++
Sbjct:    6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRE--NLKTGTEVGDVAKQYLEKGLLVPDHVITR-----LMMSELETRSAQHWLLDGFPRTLVQAEALD 101          
BLAST of Adenylate kinase 9 vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 63.5438 bits (153), Expect = 3.058e-10
Identity = 42/161 (26.09%), Postives = 81/161 (50.31%), Query Frame = 3
Query:  336 LNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDF-PPSIE 815
            + SK    +++G PG+G  T+ +     F  ++++   L+ ++++  TEVG   +  LE G L+ + ++  L+  ++E+    H  +L+DGFP        +    ++        D++I L IP   LK+RL  + + P +G V     Y+ DF PP ++
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQH--WLLDGFPRTLVQAEALDGICDV--------DLVISLNIPFETLKDRLSRRWIHPSSGRV-----YNLDFNPPQVQ 146          

HSP 2 Score: 58.9214 bits (141), Expect = 1.005e-8
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKG---YVLDGYPLAIEQIAMMN 4547
            ++  ILG P SGK T+ ER  + +GL  ++ G  LR   N    TE+    K YL KGL+VP  ++ +     LM S+  T+    ++LDG+P  + Q   ++
Sbjct:    6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRE--NLKTGTEVGDVAKQYLEKGLLVPDHVITR-----LMMSELETRSAQHWLLDGFPRTLVQAEALD 101          
BLAST of Adenylate kinase 9 vs. UniProt
Match: sp|Q5TCS8|KAD9_HUMAN (Adenylate kinase 9 OS=Homo sapiens OX=9606 GN=AK9 PE=1 SV=2)

HSP 1 Score: 528.48 bits (1360), Expect = 7.918e-155
Identity = 280/652 (42.94%), Postives = 406/652 (62.27%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCP------RELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAFLPEH-------LPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
             E+ E F+ DT+ +  + +      IP   +    +  IVQY L  KLK L++ R S+FE+C+P+    A+K++   +KY+S FG W PV L +E     P+ +  +PI+PVI+R YIYF  SK+T++ FM NP+KY++QP PK  VPI++ I+G PKSGKTT+A++   EYGL  ++ G ALR VLN +  TELA  +  +L KG+  P EL I+A+EL LM S C T G V+DGYP+   Q+ ++  + IIP  +FEL S P      R L+ + N+ R    LP+P+H+S++I+A+    Y  NI EIR++Y E+H N   ID     W++W +   +V+    ++Q YL   + GKAA I  LCI P E  +RL + +++CPVSL++++EL   +    L FAAE+RG+YYKM  +E+L+ F +N E  L    L  H       +P ++  + ++  FP   +LQGYCPV + DG  RYE L+ G+   Y +EY  ++Y       +  F++ P K+W  +LP KLPP++  + + SLPLPGYLEQ +A +L  A+ A G LKPK+PF+   RSALLYIALHLKA+NPK  E+ R+KYK K+E+F  SCELI YL   MT KYKE + R + FD K+  FL LR ++
Sbjct: 1265 GELGEKFEADTHNLQIIQDELERYLIPIISINGARRNHIVQYTLNMKLKPLVENRASIFEKCHPIPAPLAQKMLTFTYKYISSFGYWDPVKL-SEGETIKPVENAENPIYPVIHRQYIYFLSSKETKEKFMKNPIKYIRQPKPKPTVPIRIIIVGPPKSGKTTVAKKITSEYGLKHLSIGGALRYVLNNHPETELALMLNWHLHKGMTAPDELAIQALELSLMESVCNTAGVVIDGYPVTKHQMNLLEARSIIPMVIFEL-SVPSKEIFKRLLLEKENEQR----LPYPLHNSAQIVAVNNVKYRKNIGEIRQYYQEQHQNWYVIDGFHSKWWVWNEVIKNVQMVNKYMQTYLERIKAGKAACIDKLCITPQELLSRLGEFEQFCPVSLAESQELFDCSATDSLEFAAEFRGHYYKMSSQEKLNKFLENPE--LYVPPLAPHPLPSADMIPKRLTLSELKSRFPKCAELQGYCPVTYKDGNQRYEALVPGSI-NYALEYHNRIYICENKEKLQKFLRSPLKYWEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNAAGCLKPKFPFLSIRRSALLYIALHLKAFNPKGSEYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFLSLRNID 1907          

HSP 2 Score: 261.151 bits (666), Expect = 1.385e-68
Identity = 172/487 (35.32%), Postives = 273/487 (56.06%), Query Frame = 3
Query:  273 SSQDK--EYKL-DPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKTESLA 1724
            +SQ+K  EY   D + + E E  FL SKP CF++ GKPG G TTLA+     ++C  +    ++E+ I  +TE G  LQ++L  G  I +E+VI L+ +K+ SPEV H GY+I   P+ +   +T  +Q  ++K+  ++PD++I +K PD DL  R+  QR    TG +Y +  +DP+      +      KKE   D + EEEEEEEE+EE                 +  E +  L++RPED+L+ +E  ++ Y E     + + +   N   +I LN N P   LF  + +RL+YL+++ AA+  +L     +  EEE  D  + DELF+ L      AP ++W +S+W   CPV L +G +  G P ++V FL K+Y +SS++ +  F+ NPRPYLLP  P  PCK+ ++GP  SGKT L  +LA  YK +V++   L++P  D+A+   + N + ++T  AI+ V  K+ ++++  K    A
Sbjct:    2 TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEV-----IENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQ--------MVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKL-----QGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVVDYAQLVQPRFDKARETLVENTIAEATAAAIKVVKEKLLRELQARKQAETA 470          

HSP 3 Score: 188.348 bits (477), Expect = 2.308e-46
Identity = 141/372 (37.90%), Postives = 211/372 (56.72%), Query Frame = 3
Query: 2361 PPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEKIFKPIAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLE 3476
            P  PE+   +++I  +   W  + + IS +  +I+++     DRT +EL Q   + +EK F+  A EL   D +E+ E  + E   +E+ EEEE+E  E+  + +KR LG+T ++CPV LK + +L PGN E AAKY  KIYYFS  E++EKF++ P  Y+  +   ++P LR+ ++G +GSGKT  GR++A+KL +FHI F+E+LQE +L K  KK+GPE++                  E S +E A K E   E A      VE E+NTK      K     +  E E  IK +L   + L  E+LE +L ++W K+P    GF+L+GFPR  EEAQFL +   F D  + +   + DI  RLLP ++E
Sbjct:  823 PDVPEMEPFKEKIGSFIILWKQLEATISEA--YIKILNLEIADRTPQELLQKVVETMEKPFQYTAWELTGEDYEEETEDYQTEAEVDEELEEEEEEEGEDKMKERKRHLGDTKHFCPVVLKENFILQPGNTEEAAKYREKIYYFSSAEAKEKFLEHPEDYVAHEEPLKAPPLRICLVGPQGSGKTMCGRQLAEKLNIFHIQFEEVLQEKLLLKTEKKVGPEFE------------------EDSENEQAAKQEL-EELAIQANVKVE-EENTK------KQLPEVQLTEEEEVIKSSLMENEPLPPEILEVILSEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPAQIE 1166          

HSP 4 Score: 60.077 bits (144), Expect = 2.433e-7
Identity = 34/120 (28.33%), Postives = 61/120 (50.83%), Query Frame = 3
Query: 1923 VDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAAR 2282
            V   +PEV  ++ + ++ ++        E + E L++ +  +  + + + P +  +GGW++DN P  +E W AL+    +K ++PD VI + D   N + L  R Y   K  IDS I  R
Sbjct:  574 VTADHPEVVTMIEETIKMSQDINFEQPYEKHAEILQEVLGEVMEENKDRFPGAPKYGGWIVDNCPIVKELWMALI----KKGIIPDLVIYLSDTENNGKCLFNRIYLQKKSEIDSKILER 689          

HSP 5 Score: 57.7658 bits (138), Expect = 1.266e-6
Identity = 31/81 (38.27%), Postives = 46/81 (56.79%), Query Frame = 3
Query: 1323 NYCPVALFEG-ILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQP--EIPCKISVVGPNGSGKTILSQLLANR 1556
            ++CPV L E  ILQPG  + A  +  K+Y  SS +    F+ +P  Y+   +P    P +I +VGP GSGKT+  + LA +
Sbjct:  934 HFCPVVLKENFILQPGNTEEAAKYREKIYYFSSAEAKEKFLEHPEDYVAHEEPLKAPPLRICLVGPQGSGKTMCGRQLAEK 1014          
BLAST of Adenylate kinase 9 vs. UniProt
Match: sp|Q0J6P7|KAD5_ORYSJ (Probable adenylate kinase 5, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0288200 PE=2 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 6.796e-23
Identity = 52/168 (30.95%), Postives = 101/168 (60.12%), Query Frame = 3
Query:  348 PSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKT 851
            P   ++ G P +G  T  ++ ++++   +I+  +L+   +   TE+GKK +  +++G L+ +++V D++  ++  P+V  RG+L+DG+P +       + Q   L+S KI+PDI I L++PD  L +R + +RLDPETG +Y  +N+ P+   + EV  ++V + + T
Sbjct:   89 PLKVMISGAPASGKGTQCRMIVEKYGLVHISTGDLLRAEVSSGTEIGKKAKEYMDNGMLVPDQVVTDMVVSRLSQPDVRERGWLLDGYPRS-------YAQAQSLESMKIRPDIFIVLEVPDDILIDRCVGRRLDPETGKIYHIKNFPPE---NDEVSARLVTRSDDT 246          

HSP 2 Score: 73.9442 bits (180), Expect = 8.953e-12
Identity = 40/123 (32.52%), Postives = 67/123 (54.47%), Query Frame = 3
Query: 4242 VPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELIL 4610
             P+KV I G P SGK T     V++YGL+ I+ G  LR  ++    TE+ K+ K Y+  G++VP ++V   +   L       +G++LDGYP +  Q   +   KI P  +F ++  P ++++
Sbjct:   88 APLKVMISGAPASGKGTQCRMIVEKYGLVHISTGDLLRAEVSSG--TEIGKKAKEYMDNGMLVPDQVVTDMVVSRLSQPDVRERGWLLDGYPRSYAQAQSLESMKIRPD-IFIVLEVPDDILI 207          
BLAST of Adenylate kinase 9 vs. UniProt
Match: sp|Q31DX5|KAD_HYDCU (Adenylate kinase OS=Hydrogenovibrio crunogenus (strain XCL-2) OX=317025 GN=adk PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.252e-19
Identity = 52/167 (31.14%), Postives = 92/167 (55.09%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGD 857
            FIL+G PGAG  T A+    EF    I+  +++   I+ QT +GK  +  ++ G L+++E++I L++ +I  P+ A+ G+L+DGFP           Q + LK+  ++ D +I + +PD ++ NR+  +R+ P +G  Y    Y+         PP++  K  +TGD
Sbjct:    3 FILLGAPGAGKGTQAQFLTKEFNIPQISTGDMLRAAIKAQTPMGKMAKEFMDAGKLVTDEIIIGLVKDRIAEPDCAN-GFLLDGFPRTVP-------QADALKAAGVEIDAVIEIDVPDSEIVNRMAGRRVHPASGRTYHI-TYN---------PPKVDDKDNETGD 151          

HSP 2 Score: 55.8398 bits (133), Expect = 5.772e-7
Identity = 33/122 (27.05%), Postives = 60/122 (49.18%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILR 4613
            +K  +LG P +GK T A+   KE+ + +I+ G  LR  +     T + K  K ++  G +V  E++I  ++  +    CA  G++LDG+P  + Q   +    +    V E+     E++ R
Sbjct:    1 MKFILLGAPGAGKGTQAQFLTKEFNIPQISTGDMLRAAI--KAQTPMGKMAKEFMDAGKLVTDEIIIGLVKDRIAEPDCAN-GFLLDGFPRTVPQADALKAAGVEIDAVIEIDVPDSEIVNR 119          
BLAST of Adenylate kinase 9 vs. UniProt
Match: sp|P43188|KADC_MAIZE (Adenylate kinase, chloroplastic OS=Zea mays OX=4577 GN=ADK1 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.681e-19
Identity = 43/144 (29.86%), Postives = 83/144 (57.64%), Query Frame = 3
Query:  342 SKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVY 773
            + P   ++ G P +G  T  +L   ++Q  +I+  +L+   I   +E GK+ +  +E G L+ +E+V++++++++  P+    G+L+DG+P + S       Q   L++ +I+PD  I L +PD  L  R++ +RLDP TG +Y
Sbjct:    3 ADPLKVMISGAPASGKGTQCELIKTKYQLAHISAGDLLRAEIAAGSENGKRAKEFMEKGQLVPDEIVVNMVKERLRQPDAQENGWLLDGYPRSYS-------QAMALETLEIRPDTFILLDVPDELLVERVVGRRLDPVTGKIY 139          

HSP 2 Score: 66.2402 bits (160), Expect = 2.246e-10
Identity = 42/124 (33.87%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 4239 AVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELIL 4610
            A P+KV I G P SGK T  E    +Y L  I+ G  LR  +     +E  K  K ++ KG +VP E+V+  ++  L        G++LDGYP +  Q   +   +I P   F L+  P EL++
Sbjct:    3 ADPLKVMISGAPASGKGTQCELIKTKYQLAHISAGDLLRAEIA--AGSENGKRAKEFMEKGQLVPDEIVVNMVKERLRQPDAQENGWLLDGYPRSYSQAMALETLEIRPD-TFILLDVPDELLV 123          
BLAST of Adenylate kinase 9 vs. UniProt
Match: sp|Q6ZC69|KAD2_ORYSJ (Probable adenylate kinase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0109300 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.914e-18
Identity = 43/150 (28.67%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  348 PSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPD 797
            P   ++ G P +G  T  +L   ++   +I+  +L+   I   +E GK+ +  +E G L+ +E+V++++++++  P+   +G+L+DG+P +       + Q   L++  I+PDI I L +PD  L  R++ +RLDP TG +Y  +   P+
Sbjct:   73 PLKVMIAGAPASGKGTQCELIKSKYGLVHISAGDLLRAEIAAGSENGKRAKEFMEKGQLVPDEIVVNMVKERLLQPDAQEKGWLLDGYPRS-------YSQAMALETLNIRPDIFILLDVPDELLVERVVGRRLDPVTGKIYHLKYSPPE 215          

HSP 2 Score: 74.3294 bits (181), Expect = 1.371e-12
Identity = 43/122 (35.25%), Postives = 65/122 (53.28%), Query Frame = 3
Query: 4245 PIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELIL 4610
            P+KV I G P SGK T  E    +YGL+ I+ G  LR  +     +E  K  K ++ KG +VP E+V+  ++  L+      KG++LDGYP +  Q   +    I P  +F L+  P EL++
Sbjct:   73 PLKVMIAGAPASGKGTQCELIKSKYGLVHISAGDLLRAEIA--AGSENGKRAKEFMEKGQLVPDEIVVNMVKERLLQPDAQEKGWLLDGYPRSYSQAMALETLNIRPD-IFILLDVPDELLV 191          
BLAST of Adenylate kinase 9 vs. TrEMBL
Match: gnl|BL_ORD_ID|18203167 (tr|A0A267FA46|A0A267FA46_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023982g1 PE=4 SV=1)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 300/654 (45.87%), Postives = 421/654 (64.37%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPS--PKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEI---LRTAFLP--EHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWIN 5744
            N+I +V+D D N + AV +   EM IPRF VE+G K  IV++ + K L+ L++ R S+FER YPVS K A +L+  G+K+LS FGRWCPV+L +     LPL DE HP FP +Y++++YF  S   RD F  +P +YL   +  P+  VPI+V +LG PKSGKT LA RF K+ GL+R++ G ALR VL E   T LAKEI  +L+ G V P ELV++A+E +LM+++ + +GY+LDG+P ++ Q+ ++    I+P +VF L    +EL++R   DR   + P+ MHDS++++A+K+A Y    + +  WY E+H ++  +D  +  W LWE   ++ K+Q  HIQ Y++  R   AA+I ++CI   EF ARL + ++YCPV L    EL+  ++   L++AAE+RG YYK  G  EL  F D A +    L T  LP  + LP K+  + ++  FPMQL LQGYCPV FL GK RYE L+ GNK+  +VEY  +LY F  +G    FM+ P  +W L+LP KLPP+KN  ++  LP+PGYLEQT+ADALRNA+TA    KPKYPF+   RSA +YI LHLKAYNP SP + ++KY+ KLEEFE  C +I+ L D MTLKYKE   RP   D  +  F  L++  D    W +
Sbjct: 1306 NDINDVYDGDLNSLDAVKDVLEEMLIPRFVVESGKKPHIVRHYITKSLRYLIENRRSIFERVYPVSEKTAARLLTTGYKHLSSFGRWCPVALYDG-DCVLPLADEAHPTFPAVYQSFVYFMSSAARRDSFAADPRRYLDSSAKHPRVVVPIRVAVLGPPKSGKTALASRFAKDLGLVRLSAGDALRRVLQEQRKTSLAKEINRHLLAGGVAPEELVVRAVETVLMDTRTSVRGYILDGFPCSMRQVKLLTQHGIVPHKVFLLNVDHQELMIRGTNDRLRTDKPYVMHDSAQVLAVKLACYRKESDPVANWYREQHRSLCQLDGTQSKWLLWETALAEAKKQTAHIQQYVYRVRRDTAASIADMCITDREFLARLGEYRQYCPVRLQAHGELIDCSETPGLNYAAEFRGRYYKCAGPNELAKFLDGAAKFVPPLATRLLPTDDLLPKKVLQSAVRSKFPMQLHLQGYCPVTFLSGKQRYEALVPGNKD-LLVEYTDRLYCFSDEGARDCFMRKPELYWDLQLPAKLPPLKNPTDVTKLPIPGYLEQTLADALRNAMTAAANFKPKYPFLSQDRSAAIYIGLHLKAYNPSSPAYTKQKYRRKLEEFEAQCRIIQQLGDSMTLKYKEPAKRPPKLDANLEAFQKLKRQIDEPALWTS 1957          

HSP 2 Score: 347.436 bits (890), Expect = 9.012e-93
Identity = 202/471 (42.89%), Postives = 303/471 (64.33%), Query Frame = 3
Query:  273 SSQDKEYKLDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKI 1685
            SS  K   +DP+S+ + EL  LN KP+CF+++GKPG+G TTLAK   D F CE +N  E++   I  +TE+G++L+  LE G ++S+E+V +L+  K++SPEV H GY++DG P +N + + + +Q ++LKS  + PD +++LK+ + DL++R ++ R+D E G +Y K+ YDPD P   E  P     KE+  + + +++EEEEEEEEL EE E    G+ DFPLL PE I++LL+RPED    +   I++Y  +   L+ D + + +   VI LNA L P+++F+ +  +L+ L ++PA  P+ LF     +EE++ P+  D +EL + LG K  PAP ++W +S W  YCPVAL+EG L PG+P+F   FLNK+Y +SS + +  F +NPRPYLLP QP  P K+ V GP  SGKT  + LLA RY A+VI+ + LM P  + A    L  V  ++T  AIE V AK+
Sbjct:   30 SSLIKNEHVDPFSEDDAELLTLNRKPACFLIIGKPGSGKTTLAKKIRDAFNCELVNPTEILNGIIHTETELGEELRKKLEAGEILSDEVVFNLLLDKLKSPEVQHHGYVLDGLPCSNDSFMPMQKQLDLLKSMSLSPDYILHLKLTNEDLQSRRVTVRIDFEDGALYGKEFYDPDKP---EKQP-----KEEKPEPDADDDEEEEEEEELEEEEELELPGSADFPLLAPEVIQRLLRRPEDMPQSVTAGIDDYVARCQRLVEDLMSDHDQQCVIELNATLLPSDIFRQVQLKLQSLGVQPAVTPMRLFE--AGNEEDQPPEDMDTEELMRMLGPKKMPAPRYRWQRSRWLRYCPVALYEGSLVPGKPEFCCSFLNKIYCLSSLEALAKFTKNPRPYLLPPQPRPPVKVVVSGPPHSGKTSTAFLLAERYNAKVIDFEALMLPRIEAADSARLEKVRSEATALAIEIVRAKL 490          

HSP 3 Score: 132.88 bits (333), Expect = 5.972e-27
Identity = 66/121 (54.55%), Postives = 95/121 (78.51%), Query Frame = 3
Query: 2664 NRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEY 3026
            NR K + LGE++++CPV+L  ++V+ PGNPEIAAKY GK+YYF+  E+R+KF++ P  +LP     + P LRL+ILG KGSGKT HG+++A++L LFHISF++ LQE +LPK  K+IGP++
Sbjct:  939 NRGKNKQLGESSFFCPVSLHDNQVMWPGNPEIAAKYRGKVYYFASNEARDKFLEQPELFLPTDTPLKPPPLRLLILGPKGSGKTLHGKQLARRLGLFHISFRDRLQEVVLPKTRKRIGPDH 1059          

HSP 4 Score: 109.383 bits (272), Expect = 7.722e-20
Identity = 51/130 (39.23%), Postives = 85/130 (65.38%), Query Frame = 3
Query: 1902 EKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSK--MHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARV 2285
            E LPE  VD  +PEV  +V   ++EA      +  E+Y+E LE A++ +E + +Q  PN +  + GGWV+DNFP  R+ W A+LE   EK LLPD++++++D S+  ++LL+RWY  N++S+ +++  R+
Sbjct:  582 EPLPE--VDAQHPEVVAIVEAKVKEAASAKATMDAEVYVEVLEDAIRQVEREQRQSAPNDQGPLAGGWVIDNFPLNRDVWNAVLEKGQEKGLLPDELVILRDSSDGGEYLLRRWYQRNRDSVRASVQERL 709          
BLAST of Adenylate kinase 9 vs. TrEMBL
Match: gnl|BL_ORD_ID|18258469 (tr|A0A267F4C5|A0A267F4C5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023982g2 PE=4 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 303/654 (46.33%), Postives = 418/654 (63.91%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPS--PKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEI---LRTAFLPEH--LPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWIN 5744
            N+I +V+D D N + AV +   EM IPRF VE+G K  IV++ + K L+ L++ R S+FER YPVS K A +L+  G+K+LS FG WCPV+L +     LPL DE HP FP +Y++++YF  S   RD F  +P +YL   +  P+  VPI+V +LG PKSGKT LA RF K+ GL+R++ G ALR VL E   T LAKEI  +L+ G V P ELV++A+E +LM++Q + +GYVLDG+P ++ Q+ ++    I+P +VF L    +EL++R   DR   + P+ MHDS++++A+K+A Y    + +  WY E+H ++  +D  +  W LWE   +  K+Q  HIQ Y++  R   AA+I ++CI   EF ARL + ++YCPV L    ELV  ++   L++AAE+RG YYK  G  EL  F D A +    L T  LP    LP K+  + ++  FPMQL LQGYCPV FL GK RYE L+ GNK+  +VEY  +LY F  +G    FM+ P  +W L+LP KLPP+KN  ++  LP+PGYLEQT+ADALRNALTA    KPKYPF+   RSA +YI LHLKAYNP SP + ++KY+ KLEEFE  C +I+ L D MTLKYKE   RP   D  +  F  L++  D    W +
Sbjct:  416 NDINDVYDGDLNSLDAVKDVLEEMLIPRFVVESGKKPHIVRHYITKSLRYLIENRRSIFERVYPVSEKTAARLLTTGYKHLSSFGHWCPVALYDG-DCVLPLADEAHPTFPAVYQSFVYFMSSAARRDSFAADPRRYLDSSAKHPRVVVPIRVAVLGPPKSGKTALASRFAKDLGLVRLSAGDALRRVLQEQRKTSLAKEINRHLLAGGVAPEELVVRAVETVLMDTQTSVRGYVLDGFPCSMRQVKLLTQHGIVPHKVFLLNVDHQELMIRGTNDRLRTDKPYVMHDSAQVLAVKLACYRKESDPVANWYREQHRSLCQLDGTQSKWLLWETALAGAKKQTAHIQQYVYRVRRDTAASIADMCITDREFLARLGEYRQYCPVRLQAHGELVDCSETPGLNYAAEFRGRYYKCAGPNELAKFLDGAAKFVPPLATRLLPTDNLLPKKVLQSAVRSKFPMQLHLQGYCPVTFLSGKQRYEALVPGNKD-LLVEYTDRLYCFSDEGARDCFMRKPELYWDLQLPAKLPPLKNPTDVTKLPIPGYLEQTLADALRNALTAAANFKPKYPFLSQDRSAAIYIGLHLKAYNPSSPAYTKQKYRRKLEEFEAQCRIIQQLGDSMTLKYKEPSKRPPKLDVNLEAFQKLKRQIDEPALWTS 1067          

HSP 2 Score: 213.001 bits (541), Expect = 4.816e-52
Identity = 146/330 (44.24%), Postives = 202/330 (61.21%), Query Frame = 3
Query: 2664 NRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXX----XXXAIKENLEN----QQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKDLYKRKLTEYXXXXXXXXXXXXXXEILANLEEKRNKKYNTEK 3629
            NR K + LGE++++CPV+L  ++V+ PGNPEIAAKY GK+YYF+  E+R+KF++ P  +LP     + P LRL+ILG KGSGKT HG+++A++L LFHISF++ LQE +LPK  K+IGP                         D      E P E     ET+V G D    +  +  ++  EE DE    + + ++EN++N    Q  L+ E LETLL  FW  +PF+  GFVLEGFPR  EEAQFLAE  LFVDG I L   + +IIAR+LPP+LEKW+ R+  K+  K++  E   KKRQ  +++RRKE+L   EE R ++    K
Sbjct:   49 NRGKNKQLGESSFFCPVSLHDNQVMWPGNPEIAAKYRGKVYYFASNEARDKFLEQPELFLPTDTPLKPPPLRLLILGPKGSGKTLHGKQLARRLGLFHISFRDRLQEVVLPKTRKRIGP-------------------------DHEEQLEELPEELPDLPETSVTGPDGEPVEVEEPSEKSPEEPDEEEEISYSDLEENVKNNIEKQDPLTNESLETLLTQFWRSEPFKNTGFVLEGFPRTPEEAQFLAEAGLFVDGAIVLNTGDQEIIARMLPPKLEKWRERRKQKNDIKQRNKEKSQKKRQEAMEKRRKELLKENEEARKERQEQRK 353          
BLAST of Adenylate kinase 9 vs. TrEMBL
Match: gnl|BL_ORD_ID|18325837 (tr|A0A267GDB6|A0A267GDB6_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032464g1 PE=4 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 300/654 (45.87%), Postives = 420/654 (64.22%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPS--PKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEI---LRTAFLP--EHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWIN 5744
            N+I +V+D D N + AV +   EM IPRF VE+G K  IV++ + K L+ L++ R S+FER YPVS K A +L+  G+K+LS FGRWCPV+L +     LPL DE HP FP +Y++++YF  S   RD F  +P +YL   +  P+  VPI+V +LG PKSGKT LA RF K+ GL+R++ G ALR VL E   T LAKEI  +L+ G V P ELV++A+E +LM+++ + +GYV DG+P ++ Q+ ++    I+P +VF L    +EL++R   DR   + P+ MHDS++++A+K+A Y    + +  WY E+H ++  +D  +  W LWE   ++ K+Q  HIQ Y++  R   AA+I ++CI   EF ARL + ++YCPV L    ELV  ++   L++AAE+RG YYK  G  EL  F D A +    L T  LP  + LP K+  + ++  FPMQL LQGYCPV FL GK RYE L+ GNK+  +VEY  +LY F  +G    FM+ P  +W L+LP KLPP+KN  ++  LP+PGYLEQT+ADALRNA+TA    KPKYPF+   RSA +YI LHL+AYNP SP + ++KY+ KLEEFE  C +I+ L D MTLKYKE   RP   D  +  F  L++  D    W +
Sbjct:  121 NDINDVYDGDLNSLDAVKDVLEEMLIPRFVVESGKKPHIVRHYITKSLRYLIENRRSIFERVYPVSEKTAARLLTTGYKHLSSFGRWCPVALYDG-DCVLPLADEAHPTFPAVYQSFVYFMSSAARRDSFAADPRRYLDSSAKHPRVVVPIRVAVLGPPKSGKTALASRFAKDLGLVRLSAGDALRRVLQEQRKTSLAKEINRHLLAGGVAPEELVVRAVETVLMDTRTSVRGYVFDGFPCSMRQVKLLTQHGIVPHKVFLLNVDHQELMIRGTNDRLRTDKPYVMHDSAQVLAVKLACYRKESDPVANWYREQHRSLCQLDGTQSKWLLWETALAEAKKQTAHIQQYVYRVRRDTAASIADMCITDREFLARLGEYRQYCPVRLQAHGELVDCSETPGLNYAAEFRGRYYKCAGPNELAKFLDGAAKFVPPLATRLLPTDDLLPKKVLQSAVRSKFPMQLHLQGYCPVTFLSGKQRYEALVPGNKD-LLVEYTDRLYCFSDEGARDCFMRKPELYWDLQLPAKLPPLKNPTDVTKLPIPGYLEQTLADALRNAMTAAANFKPKYPFLSQDRSAAIYIGLHLRAYNPSSPAYTKQKYRRKLEEFEAQCRIIQQLGDSMTLKYKEPSKRPPKLDVNLEAFQKLKRQIDEPALWTS 772          
BLAST of Adenylate kinase 9 vs. TrEMBL
Match: gnl|BL_ORD_ID|15733765 (tr|R7UGY3|R7UGY3_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_152932 PE=4 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 297/652 (45.55%), Postives = 427/652 (65.49%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAFLPEHLPNK-IDPNRI-----QDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWI 5741
            NE+ EV+DNDTN ++AV E   E+ IPR E++AG K PIV+Y+L K+ +K++  R S+FER YP++   A K+++ G K  SRFGRWCPV L  E     P+    +P +P IYRNYIYF  + Q RD FM +P+ YL  PSPK  VPI++ I+G PKSGKTTLA+RF  E+GL+R++ G A+R+V++    + L + + ++L +G  +P ELV++ IE+ L N QC+T+GY+LDG+PL+  Q+ MM  + IIP RV ++    REL+ RA  DR   +  F  HDS++I AIK+A +   I  IR WY E+H N+ +I+ +   W++W K     KE +  IQ YL    EGKAA+I ++CI P EF  RL D  +YCPVSL+   ELV  +    L +  E+RG+YYK  G++E D F    E+ +     P  LP++ + P R+     ++MFP   ++QGYCPV FLDGK RYE ++ G+ E  VV YR KLY+   +  +  FM++P  +W L LP KLPP K +L + SLP+ GY+EQT+A  +  +LTA G  KPKYPF+ P+RSAL+Y+A +LKA NP++ +++R+KYK KL E+EN+C+LI YL D+MT +YK+ ++RP  FD K+  F+ L+  E     W+
Sbjct:    3 NELAEVYDNDTNRLAAVQEKLEEILIPRIELDAGRKPPIVRYQLAKRTRKIIQFRHSIFERVYPINEVLALKMLRTGFKQPSRFGRWCPVQL-AEGDCIQPMQGPGYPTYPAIYRNYIYFMATSQNRDTFMHDPMTYLTLPSPKPVVPIRLAIIGPPKSGKTTLAKRFADEFGLIRLSAGEAVRSVIDMQPKSALVRTMNAFLYRGRAIPDELVVQCIEVALSNMQCSTRGYILDGFPLSKHQVDMMTQRSIIPVRVLDITVPSRELVNRATIDRYAADKTFIQHDSAQIFAIKLAAWHKEIEPIRTWYQEQHSNLVTIEGQHSKWWVWNKALETAKESVVQIQTYLQRISEGKAASIADMCITPHEFVQRLGDFDQYCPVSLADGGELVDCSTTKSLKYGVEFRGHYYKTCGDKERDCFLKEPEKYV-PPLAPRKLPSQDMRPKRLTGEEARNMFPKSFEIQGYCPVTFLDGKLRYEAIVAGDPE-MVVLYREKLYSLQDEEKLQKFMRLPENYWNLILPHKLPPKKKALPLSSLPMLGYMEQTVAATITKSLTAVGNFKPKYPFLTPTRSALVYVAYNLKANNPRNSDYIRKKYKRKLVEYENTCKLINYLGDNMTRRYKDPQNRPEEFDFKLEMFIQLKDKEPTST-WV 650          
BLAST of Adenylate kinase 9 vs. TrEMBL
Match: gnl|BL_ORD_ID|19699139 (tr|W4YXQ7|W4YXQ7_STRPU Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 297/644 (46.12%), Postives = 423/644 (65.68%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAE-----EILRTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLE 5720
            NEI EV+D DTN IS V E+  E+ IPR E+  G K  IV++ L + L+ + D RES+FE+ YPV    A K+++ G+K+ SRFGRWCPV LL E     P+    +P FP +YR +IYF  + Q R+ F+ +PLKYLKQ SPK  VP+++ I+G PKSGKT LA RF  +YG++R++ G A+R VL +   TELAK I + + KG+ +P EL I+A+E+ L++++ +T+GYVLDGYP++  Q+ +M D  IIP  V EL    REL++R  KDR   E   P HDS++I+++K+A +   I  +R +Y E+H N   +  EK  W++W++     ++ +  IQ+YL    EGKAA+I N+CI P EF +RL D  +YCPVSL++  ELV      +L  AAE+RG YYKM+  E +  F    E     +  R    PE L  +      + MFPMQ++LQGYCPV +LDGK RYE ++ GN +  +VEYRG++Y F  +  +  FM+ P +++ L+LP KLPP ++ L + SLP+ GY+EQT++ A+  ALTATG  KPK+PF+ PSRSALLY+A HLKAYNPKS +++R+KY+ KLE+FE  CELI+YL + M  + +  +  P+ FD KM  FL L+  E
Sbjct:  501 NEIGEVYDEDTNRISGVQETLEEIMIPRMELNGGRKPHIVRFTLEQSLRPVQDFRESLFEKVYPVREMVARKMLQIGYKHQSRFGRWCPVKLL-EGDCIQPMQGHTYPTFPAVYRQHIYFMSTPQAREQFVMHPLKYLKQASPKPVVPVRMAIIGPPKSGKTALANRFASDYGMMRLSIGEAVRFVLTQQPKTELAKLINAQIRKGIPLPDELAIRALEVNLLDTRSSTRGYVLDGYPVSKHQVDLMTDYGIIPVVVLELSVDSRELMVRGMKDRHSSERLLPFHDSAQILSMKIAAWQKEITGVREYYKEQHKNWVRVVGEKSKWWVWKRAADHSQDSVRRIQDYLQRISEGKAASIANMCITPKEFFSRLGDFGQYCPVSLAKDGELVDCAGQVNLDNAAEFRGRYYKMENPEMVKEFLARPELYVPPQAPRALPAPELLTKRRTAMDAKKMFPMQIELQGYCPVTYLDGKLRYEAILPGNPD-LIVEYRGRMYCFDSEEKLQRFMRYPERYFSLKLPHKLPPRRDPLLVTSLPMLGYMEQTISTAITKALTATGCFKPKFPFVSPSRSALLYLAFHLKAYNPKSSDYVRKKYRKKLEQFEEQCELIRYLGNQMGQRLRNPQELPIDFDHKMLLFLNLKGRE 1142          

HSP 2 Score: 186.808 bits (473), Expect = 1.046e-43
Identity = 135/378 (35.71%), Postives = 219/378 (57.94%), Query Frame = 3
Query: 2346 DSNLPPPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEK--IFKPIAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRL 3473
            +  LPP GPE    +++ +D+ ++W  + ++++ +  ++E ++   E++ +E++ + +   +E+   ++P          D D+E E+A    +E+ +E E+E DEE  ++KK+  G+T ++CPV LK   VL PGNPEIAAKY  K+YY S+ E+R+KFI +P  Y+        P +RL++LG KG+GK+ H R +A KL LFHISF++ LQE      L     +   GP   +        +  EG  D   + SE PG+ A  ++T  + E+  ++++    DE  E        IK NL   ++LS + LE  + D+WN +P++  GF+LEGFPR +EEAQF+AE+ LF D  + L   + DI +RLLPP+L
Sbjct:   36 EDQLPPDGPETTKFKEQRNDFEREWPSIQALLTGT-INLEPLQLEIENKQVEDIIKESHNMVEQPYTYRP----WEYNSIDMDEEDEDAAAEADEEGDEMEEEEDEEVTKNKKKQFGDTKHFCPVALKEQNVLWPGNPEIAAKYREKVYYCSNPEARDKFIAEPTSYVAKGKPFVPPPVRLLMLGPKGAGKSLHARAMADKLGLFHISFKDRLQE------LIIKKTKKKIGPEYEEEEEEPEESDAEEGQKDGIPVVSE-PGDGAAAEQTEEDNEEGGEEEQEVELDEFEEN-------IKGNLMGDESLSLDSLEKFVPDWWNLEPYKSTGFILEGFPRTSEEAQFMAEHGLFPDAALLLNVEDSDITSRLLPPKL 394          
BLAST of Adenylate kinase 9 vs. Ensembl Cavefish
Match: ak9 (adenylate kinase 9 [Source:ZFIN;Acc:ZDB-GENE-041014-337])

HSP 1 Score: 477.633 bits (1228), Expect = 5.764e-140
Identity = 255/645 (39.53%), Postives = 395/645 (61.24%), Query Frame = 3
Query: 3807 EIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVS-----LLNEM-GAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEIL-----RTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYL 5708
            EI E FD D + ++ +++   E+QI R  V AG K  IV+Y+L +K++ L++ RE++FE+C P++   A KL++  +K+ S FG W PV      L+  M G F       +P FP I+ ++IYF  S++TR  FM NP+KYL+QP P  ++PIK+ I+G PKSGKTT+A  F +EYGL R++ G  +R VLN    TELA +++ +L +GL VP EL I+ +++ LM+  C+T+ YVLDG+P+   Q  +M    IIP RV EL     E++ R   DR     P+PMHDS   + I+ + +   +  +R+ + +++ N   ++  K  W++W +   + +  + HI NYL   R+G+AA+I  LCI P E ++RL +   YCPVSL+    LV  + ++ L  AAE+RG YYKM   E L+ F +  E+ +          P  LP K++  +++  FP Q++++GYCPV + DG+ +YE L+ G+ + + VEY+ K+Y    +   S F+     +W  +LP KLPP+   +++ +LP+ GYLEQ +A A+   +T  G LKPK+P++   RSALLY+A HLK YN K P+++R+KYK KL +FE++CELI YL   MT K +    +P+ F+ K+  FL L
Sbjct:  961 EISERFDKDDSNVTKMVDLLAELQISRLNVNAGRKPHIVRYQLLQKVQPLVENREALFEKCQPINYSVARKLLQFSYKFFSAFGCWDPVQYAQGDLMQHMQGPF-------NPSFPAIFHSFIYFFTSRETRSTFMQNPIKYLQQPKPNPSLPIKIAIIGPPKSGKTTVARMFAREYGLARLSIGEVMRMVLNTQNKTELANQMQKHLSQGLTVPDELAIQCMDMALMSLACSTR-YVLDGFPMTKRQADLMEAHSIIPVRVIELQLDTVEVLRRGLADRIKSN-PYPMHDSPPNLNIRSSCFKQEVQMLRQHFQQQYHNWVPVNGHKSKWWVWNQVLDEARISMRHINNYLKRIRKGQAASIDRLCITPRELQSRLGEFGHYCPVSLALHHHLVDCSLNTSLELAAEFRGSYYKMASREFLERFLEAPEQFVVPGCPHPLPPPHLLPCKLNAGQVKSRFPQQVEMKGYCPVTYFDGQ-QYEALVRGSVD-FAVEYKEKIYILETEEKQSKFL-----YWDQKLPDKLPPIGEPIHLTTLPVLGYLEQGVAKAIIKGMTEVGNLKPKFPYMSMKRSALLYLAFHLK-YNYKQPDYVRQKYKKKLSQFEDACELISYLGSTMTHKCQPAHDQPLDFEHKLHRFLAL 1588          

HSP 2 Score: 243.047 bits (619), Expect = 3.773e-64
Identity = 172/524 (32.82%), Postives = 260/524 (49.62%), Query Frame = 3
Query: 1923 VDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARVGDKIKDAGTAKPDQEVVLSVDSNLPPPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEKIFKPIAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRK 3494
            V E +PEV  LV +AM++AE+  +    ++ ++ L K +  IE + +    N++   GWVLDNFP TR Q AAL E  P   L+PD +  ++D S+  Q +LKR Y  NKE++D+A+ AR+ ++         D  ++ +      PPGPE++    +I  + Q+W  V S I+ S     V+++N    + ++L Q    +IE                                                R LG+T  +CPV LK    L P   E  AKY  K+YY S  E+R+KF+Q P  Y P   I + PALR+  LG +GSGKTTHG  +AQ+L LFHI F+E LQE IL K  +++ P  D+  P      P+   EEL+    + A          + +++A E E+  K            +  + E AIK  L + + L  E+LE +L   W K+P+   GF+LEGFP + EE  F+ E  L+ D V+ +    ++++ RLLP RL  W+ R+
Sbjct:  449 VTEDHPEVCALVDEAMKQAEQTSVEPTEDMCVDVLLKIITEIEAEDE----NAEFKRGWVLDNFPFTRTQLAALQELQPG--LMPDVMFCLRD-SDGEQTILKRIYKKNKEAVDAAVLARLQEEQIQKSAEYQDTVMLPTSWEQGYPPGPEMSNYELQIRTFMQEWESVESYITCS---YAVLDTN---HSPQDLLQEMVDQIE------------------------------------------------RWLGDTKEYCPVVLKEKGSLVPCIDEFTAKYREKVYYLSSAEARDKFLQTPALYAPPNKILKPPALRIFQLGVRGSGKTTHGCWLAQQLGLFHIQFRERLQELILAKTQRRV-PYADDVEP------PEGPSEELKALLQQQA--------QGSSEQSAAEPENKVK-----------LQLTDEEEAIKLYLSDGEPLPQEILEMVLLQLWTKEPYS-TGFILEGFPHSPEEVSFMTEYHLYPDAVVVMTTEGNEVVRRLLPSRLANWRKRQ 884          

HSP 3 Score: 224.172 bits (570), Expect = 2.751e-58
Identity = 170/470 (36.17%), Postives = 258/470 (54.89%), Query Frame = 3
Query:  297 LDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANV----LEKSTKDAIETVHAKIKKQ 1694
            +D   + E E +FL SKP+CFI++GKPG G +TLA+     ++C  I+  EL+  HI   T  GK+L  +L +G  I EE V+ LI  K++S EV +  Y++   P+ +   + I EQ N++K  K+ PDI+I +K  D DL NRL   R  P TG V  ++ ++P             VKKE    + E EEE E+EEEE  +  E   +       L  + I  L++  E+  ++   +I  Y +     + DY+E+     +  L+ N     LF  +  RL  +++R AAVPV L       ++EE P+  D +EL + L       PGF+W +S W+N CPVAL  G +  G+P+F+V FL+K+Y++SS++ +  F+ NPR YLLP  P  PC+++V+GP  SGK+ +  LLA  Y A +I+++ LMKP         L NV    LEK+ +DA+     K+K Q
Sbjct:    3 VDSLIENEAENEFLLSKPTCFIIIGKPGVGKSTLARKLAQAWRCVLID-TELLSSHIHEDTVQGKELLAMLAEGKSIPEEKVVALILDKLKSQEVENY-YVLSCLPSMSEEYLKIPEQINLIKGLKMPPDIIINIKCADNDLINRLAGMRQHPHTGRVLLREQWEP-------------VKKETPKKKSEAEEENEQEEEEEEQIEEEGQEEEEQ--ELQKDMISHLVQLKENSPEEAHQRILFYKDTILRFLEDYMEDHEPQCLFELDGNKDSEELFVSVMARLECMALRRAAVPVRLL------DKEEAPEEMDTEELLRILSSCKTVVPGFRWYRSRWSNTCPVALKMGKIIKGKPEFSV-FLDKIYVLSSQEALQKFMVNPRRYLLPPMPRPPCRMAVIGPPCSGKSTMCTLLAKHYGAVLIDLEKLMKP--------ILVNVRQEMLEKARQDAVSVALEKVKLQ 440          

HSP 4 Score: 58.5362 bits (140), Expect = 9.459e-8
Identity = 57/244 (23.36%), Postives = 101/244 (41.39%), Query Frame = 3
Query: 4038 KYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKY------LKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRIT---------------------------GGS-ALRTVLNENWN------------------TELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILR 4613
            ++L     +CPV +L E G+ +P +DE    F   YR  +Y+  S + RD F+  P  Y      LK P+      +++  LG+  SGKTT      ++ GL  I                            G S  L+ +L +                     T+  + IK YL  G  +P E +++ + L L   +  + G++L+G+P + E+++ M +  + P  V  + +   E++ R
Sbjct:  640 RWLGDTKEYCPV-VLKEKGSLVPCIDE----FTAKYREKVYYLSSAEARDKFLQTPALYAPPNKILKPPA------LRIFQLGVRGSGKTTHGCWLAQQLGLFHIQFRERLQELILAKTQRRVPYADDVEPPEGPSEELKALLQQQAQGSSEQSAAEPENKVKLQLTDEEEAIKLYLSDGEPLPQE-ILEMVLLQLWTKEPYSTGFILEGFPHSPEEVSFMTEYHLYPDAVVVMTTEGNEVVRR 871          

HSP 5 Score: 55.0694 bits (131), Expect = 9.113e-7
Identity = 30/117 (25.64%), Postives = 59/117 (50.43%), Query Frame = 3
Query: 1320 ANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQP--EIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAI 1664
              Y    L + +  P  P F   F + +Y  +S++  + F++NP  YL   +P   +P KI+++GP  SGKT ++++ A  Y    +++  +M+   +   +  LAN ++K     +
Sbjct: 1049 VQYAQGDLMQHMQGPFNPSFPAIFHSFIYFFTSRETRSTFMQNPIKYLQQPKPNPSLPIKIAIIGPPKSGKTTVARMFAREYGLARLSIGEVMRMVLNTQNKTELANQMQKHLSQGL 1165          

HSP 6 Score: 54.6842 bits (130), Expect = 1.224e-6
Identity = 32/107 (29.91%), Postives = 56/107 (52.34%), Query Frame = 3
Query: 2742 PGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEY----DEGPPVPD 3050
            P NP   A +   IY+F+  E+R  F+Q+P++YL       S  +++ I+G   SGKTT  R  A++  L  +S  E+++  +  +N  ++  +      +G  VPD
Sbjct: 1063 PFNPSFPAIFHSFIYFFTSRETRSTFMQNPIKYLQQPKPNPSLPIKIAIIGPPKSGKTTVARMFAREYGLARLSIGEVMRMVLNTQNKTELANQMQKHLSQGLTVPD 1169          
BLAST of Adenylate kinase 9 vs. Ensembl Cavefish
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:103033473])

HSP 1 Score: 66.6254 bits (161), Expect = 2.199e-11
Identity = 38/162 (23.46%), Postives = 84/162 (51.85%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            ++MG PG+G  T++    D F  ++++  +++  +I+ +TE+G  +++ ++ G L+ ++++  LI   + +  + H  +L+DGFP   +   ++     +        D +I L +P   +K RL S+ L   +G VY      P  P   +V  + ++++E
Sbjct:   10 VIMGPPGSGKGTVSNRITDSFGLKHLSSGDILRANIKAKTELGLLMKSCIDQGQLVPDDVISRLILSNLRN--MDHSSWLLDGFPRTVAQAESLDSMCTV--------DTVINLDVPFQTIKERLTSRWLHLPSGRVYNTDFNPPKIPGLDDVTGEPLIQRE 161          

HSP 2 Score: 50.8322 bits (120), Expect = 3.516e-6
Identity = 30/94 (31.91%), Postives = 51/94 (54.26%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQ 4532
            +  I+G P SGK T++ R    +GL  ++ G  LR   N    TEL   +KS + +G +VP +++ + I   L N   ++  ++LDG+P  + Q
Sbjct:    8 RAVIMGPPGSGKGTVSNRITDSFGLKHLSSGDILRA--NIKAKTELGLLMKSCIDQGQLVPDDVISRLILSNLRNMDHSS--WLLDGFPRTVAQ 97          
BLAST of Adenylate kinase 9 vs. Ensembl Cavefish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:103022510])

HSP 1 Score: 63.5438 bits (153), Expect = 2.192e-10
Identity = 37/142 (26.06%), Postives = 76/142 (53.52%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQP-DILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQ 782
            IL+G PGAG  T A    ++F   ++   +++   +   +E+G++L+  ++ G L+S+EMV++LI + +++P   + G+L+DGFP      V   E  + L   + +  D ++   + D  L  R+  + +   +G  Y ++
Sbjct:   21 ILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVASGSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPCKN-GFLLDGFPRT----VKQAEMLDDLLDKRTEKLDSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEE 157          

HSP 2 Score: 58.9214 bits (141), Expect = 8.938e-9
Identity = 31/101 (30.69%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMND 4550
            I+  +LG P +GK T A R  +++ +  +  G  LR ++     +EL + +K  +  G +V  E+V++ IE  L    C   G++LDG+P  ++Q  M++D
Sbjct:   18 IRAILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVAS--GSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPC-KNGFLLDGFPRTVKQAEMLDD 115          
BLAST of Adenylate kinase 9 vs. Ensembl Cavefish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:103022510])

HSP 1 Score: 63.5438 bits (153), Expect = 2.633e-10
Identity = 37/142 (26.06%), Postives = 76/142 (53.52%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQP-DILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQ 782
            IL+G PGAG  T A    ++F   ++   +++   +   +E+G++L+  ++ G L+S+EMV++LI + +++P   + G+L+DGFP      V   E  + L   + +  D ++   + D  L  R+  + +   +G  Y ++
Sbjct:   21 ILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVASGSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPCKN-GFLLDGFPRT----VKQAEMLDDLLDKRTEKLDSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEE 157          

HSP 2 Score: 58.5362 bits (140), Expect = 1.187e-8
Identity = 31/101 (30.69%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMND 4550
            I+  +LG P +GK T A R  +++ +  +  G  LR ++     +EL + +K  +  G +V  E+V++ IE  L    C   G++LDG+P  ++Q  M++D
Sbjct:   18 IRAILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVAS--GSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPC-KNGFLLDGFPRTVKQAEMLDD 115          
BLAST of Adenylate kinase 9 vs. Ensembl Cavefish
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:553671])

HSP 1 Score: 65.0846 bits (157), Expect = 4.180e-10
Identity = 34/108 (31.48%), Postives = 59/108 (54.63%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRV 4574
            ++ +LG P SG++  A    ++YGL+ I  G  L+ V  +   + + + IK +L  G  VP  +V++ +   L    C T+G+VL G+P  +EQ   + + K  P+RV
Sbjct:  270 RILLLGPPGSGRSLQARLIAQKYGLVNICCGELLKAVAADE--SSMGELIKPFLESGRRVPDSMVLQILTERLSRLDCTTRGWVLHGFPQDLEQAEALQESKFSPNRV 375          

HSP 2 Score: 60.8474 bits (146), Expect = 9.925e-9
Identity = 35/137 (25.55%), Postives = 72/137 (52.55%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGD 767
             +L+G PG+G +  A+L   ++    I   EL++     ++ +G+ ++  LE G  + + MV+ ++ +++   +   RG+++ GFP     D+   EQ   L+  K  P+ +++L++ DG     L    +DP TG+
Sbjct:  271 ILLLGPPGSGRSLQARLIAQKYGLVNICCGELLKAVAADESSMGELIKPFLESGRRVPDSMVLQILTERLSRLDCTTRGWVLHGFPQ----DL---EQAEALQESKFSPNRVVFLEMTDGVAVEGLTLGAIDPVTGE 400          

HSP 3 Score: 60.077 bits (144), Expect = 1.542e-8
Identity = 39/145 (26.90%), Postives = 73/145 (50.34%), Query Frame = 3
Query: 4197 TNPLKYLKQPSPKDAVPI-KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDR 4628
             +P++YL     ++   + +V +LG P SGK T+A++  ++ G + IT  + L+       +++L++    Y  K   +P +L IK I+  L+ + C  +G+VL+  P   E+   + +  I P  V  L +    LI R+   R
Sbjct:   40 ADPIQYLIDMLKRENTDVPRVMLLGPPASGKRTIAKKLCEQIGTIHITASNILKD------DSDLSRAALEYTEKNQEIPQDLWIKLIQQRLLKADCVRRGWVLEAIPKTREEALCLQEAGIAPEHVVMLQAPESVLIERSLGKR 178          

HSP 4 Score: 58.5362 bits (140), Expect = 4.946e-8
Identity = 35/147 (23.81%), Postives = 70/147 (47.62%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPD 797
             +L+G P +G  T+AK   ++    +I    +++      +++ +      E    I +++ I LI+Q++   +   RG++++  P          E+   L+   I P+ ++ L+ P+  L  R L +R+DP TGDVY      P+
Sbjct:   60 VMLLGPPASGKRTIAKKLCEQIGTIHITASNILK----DDSDLSRAALEYTEKNQEIPQDLWIKLIQQRLLKADCVRRGWVLEAIPKTR-------EEALCLQEAGIAPEHVVMLQAPESVLIERSLGKRIDPVTGDVYHVAFMRPE 195          
BLAST of Adenylate kinase 9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004814.1 (pep scaffold:Pmarinus_7.0:GL476574:2348:7207:-1 gene:ENSPMAG00000004374.1 transcript:ENSPMAT00000004814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.546 bits (815), Expect = 1.174e-96
Identity = 163/421 (38.72%), Postives = 248/421 (58.91%), Query Frame = 3
Query: 4470 MNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEI---LRTAFLP--EHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFM-KIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRK 5714
            M   C T G+VLDGYPL   Q+ +++ + I+P  V  L     E++ R  +D       +P  DS + +A+KM+++   +  ++ +Y  +H N   +D  +  W+LW +    V   +  IQ+YL D   G AA I  LC+ P E + RL + +EYCPVSL+   E V  +  S L + AE+ G+YYKM  E +L IF  + E+    L    LP  + LP  + P +++ MFP Q++LQGYCPV +LDG+  Y+ L+ G+ E +  EYRGK+YT   +    +F+ ++P K+  ++LPKKLPP +  +++ SLP+ GYLEQ ++ AL  AL+A G LKPKYPF+   RSALL +A HLK  NP+S EH++ +YK +L  FE  CEL+ +L   M   ++ ++ RP   +  M  FL + K
Sbjct:    1 MQPICHTHGFVLDGYPLTQRQVRLLDARGIVPVIVVALQLASSEVLQRGFQDCKEPGRSYPQLDSPQALAVKMSHHQREVAAVQDFYKRQHQNWILMDGTRSKWWLWTEVLRHVAVSVRQIQDYLHDIGRGWAARIEGLCVTPEECEVRLGEFREYCPVSLALRGEYVCCDAPS-LQWTAEFCGHYYKMASETDLQIFLKSPEQFTAPLAPRALPPSDALPRPLTPAQVKQMFPKQVELQGYCPVTYLDGQLSYDCLVNGSME-FAAEYRGKVYTCLSETARQSFLNRLPEKYSDIKLPKKLPPKRVPISLTSLPMLGYLEQGLSTALVKALSAVGCLKPKYPFLSLHRSALLLVAFHLKTLNPRSSEHVKTEYKQRLRRFEECCELLVHLGSTMPRAFQPIDQRPPALEHSMQTFLAIEK 419          
BLAST of Adenylate kinase 9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004823.1 (pep scaffold:Pmarinus_7.0:GL476574:21704:35297:-1 gene:ENSPMAG00000004380.1 transcript:ENSPMAT00000004823.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.136 bits (640), Expect = 5.933e-71
Identity = 166/462 (35.93%), Postives = 256/462 (55.41%), Query Frame = 3
Query:  306 YSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKK 1691
            + + E E+Q L SKP C +++GKPG G  TLA+     ++C  + G  +I+QHI+ QTE G  LQ  L  G +ISEE V  L+ +K+ SP+VAH GY++ GFP+ +  ++TI +Q  ++KS+ ++PD++I +K P+ DL  R   QR DP TG VY       +     + P      +     E EEE EE EE+EE  E G            LD   + +L++RP D  D +   I  Y +     + D + + +   +I L+ N  PN L   +  RL+ L ++ AAVP    H+ GED+        D DE+ + + G   P    +W +S W   CPVAL +G L+ G+ +FA+ FL+K+YL+SS++    F  NPR YL+  QP+ PC + V+GP+ +GKT L  LLA+ Y A+V+N+  L++P  +E K+  +     ++   A+ETV    +K
Sbjct:    1 FDEDEAEMQMLLSKPLCLLVLGKPGVGKATLARRLTKVWRCVLVEGVAVIQQHIDAQTETGIMLQERLVKGEVISEETVTRLLLEKLASPQVAHYGYVLCGFPSLSEENLTIPQQIELIKSWSLKPDVIINIKCPNDDLHKRRTRQRQDPLTGQVYVLDELGREAARDGKNP------QADNATEREEEGEEMEEKEEEAEAG------------LDKGLLSRLVRRPGDSPDDVMRVITLYNDTLLRPLEDLMADHDPRYLIELDGNESPNALLDGVLARLKMLGLQEAAVP---LHLQGEDDLPSD---LDPDEVLRAVSGWQRPGARHRWRRSRWGAVCPVALQQGSLKIGKAEFAISFLDKMYLLSSEEAQAKFCANPRSYLMVPQPKPPCHVVVMGPSTAGKTTLCHLLADHYGARVVNVAELVRPVIEEEKQRSVELARAEALAVALETVRTLAEK 438          

HSP 2 Score: 72.4034 bits (176), Expect = 7.430e-13
Identity = 41/115 (35.65%), Postives = 62/115 (53.91%), Query Frame = 3
Query: 1923 VDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDS 2267
            V   +PEV+ LV +A+ +AE+  + L  E Y+  L KA+ ++  +            GWVLD+FP  +E WA LL     K L PD+V  + D S   + LL R Y+ +KE +D+
Sbjct:  532 VTAEHPEVRALVTEAVLQAEQAAMGLPAETYVNVLVKALSDMRRETDDVEGAGVAAQGWVLDDFPADQELWATLL----AKGLCPDEVFCLVDPSTKSELLLSRMYSKHKEEVDA 642          

HSP 3 Score: 51.6026 bits (122), Expect = 1.883e-6
Identity = 36/118 (30.51%), Postives = 55/118 (46.61%), Query Frame = 3
Query: 4047 SRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNE--NWNTELAK 4394
            SR+G  CPV+L  + G+      E    F + + + +Y   S++ +  F  NP  YL  P PK   P  V ++G   +GKTTL       YG   +     +R V+ E    + ELA+
Sbjct:  312 SRWGAVCPVAL--QQGSLKIGKAE----FAISFLDKMYLLSSEEAQAKFCANPRSYLMVPQPKP--PCHVVVMGPSTAGKTTLCHLLADHYGARVVNVAELVRPVIEEEKQRSVELAR 421          
BLAST of Adenylate kinase 9 vs. Ensembl Sea Lamprey
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 47.3654 bits (111), Expect = 8.082e-6
Identity = 46/191 (24.08%), Postives = 87/191 (45.55%), Query Frame = 3
Query: 4266 GLPKSGKTTLAERFVKEYGLLRITGGSALRT-VLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELI---LRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIF 4826
            G P SGK T + +  + YGL+ ++ G  LR  VL    +    + I   + KG + P E  I  ++   + +  A  G+V+DG+P  I Q     ++   P  V  L++C  E +   L    DR G        D+ + +  ++A +  +   + + Y +E   + + DA++    L+    + V+ ++F
Sbjct:    1 GGPGSGKGTQSRKLSESYGLVCVSLGEVLRQHVLQRAPSNRKWRLIAQIISKGELAPQETAIWELKQHFLQNPDA-PGFVIDGFPREISQALAFEEQVGAPDAVI-LLACASERLRQRLGERADRHGRP-----DDNPRAVERRLATFRQHTVPLVQHY-QERGLLLTFDADREEGELFGDIGAAVESRLF 183          
BLAST of Adenylate kinase 9 vs. Ensembl Yeast
Match: ADK1 (Adenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence; protein abundance increases in response to DNA replication stress; mutations affecting Adk1p catalytic activity deregulate expression of phosphate utilization genes PHO5 and PHO84; human homolog AK1 can complement yeast adk1 mutant [Source:SGD;Acc:S000002634])

HSP 1 Score: 66.2402 bits (160), Expect = 2.756e-12
Identity = 38/145 (26.21%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGF----PNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFK 779
             +L+G PGAG  T A    + F   ++   +++   I   T++G + + I++ GGL+S+++++++I+ ++ +      G+++DGF    P A   D  + EQ   L+         I LK+ D  L  R+  + + P +G  Y K
Sbjct:    9 MVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKA-------IELKVDDELLVARITGRLIHPASGRSYHK 146          

HSP 2 Score: 49.2914 bits (116), Expect = 1.513e-6
Identity = 26/95 (27.37%), Postives = 50/95 (52.63%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQ 4532
            I++ ++G P +GK T A    + +    +  G  LR+ + +   T+L  E K  + +G +V  ++++  I+  L N+     G++LDG+P  I Q
Sbjct:    7 IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKG--TQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQ 99          
BLAST of Adenylate kinase 9 vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 56.9954 bits (136), Expect = 3.166e-9
Identity = 31/120 (25.83%), Postives = 66/120 (55.00%), Query Frame = 3
Query: 4254 VCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATK-GYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELIL 4610
            + +LG P +GK T  E+ VK+Y  + ++ G  LR        ++  + IK+ + +G +VP E+ +  +   + ++  A K  +++DG+P  ++Q A+  ++ I+ S+      CP +++L
Sbjct:   19 IFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQG-RAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQ-AISFERDIVESKFILFFDCPEDIML 136          
BLAST of Adenylate kinase 9 vs. Ensembl Yeast
Match: ADK2 (Mitochondrial adenylate kinase; catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background [Source:SGD;Acc:S000000972])

HSP 1 Score: 49.6766 bits (117), Expect = 1.187e-6
Identity = 33/151 (21.85%), Postives = 72/151 (47.68%), Query Frame = 3
Query:  369 GKPGAGSTTLAKLFIDEF-QCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIES-----PEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFP 803
            G PG+G  T     + +  Q   I+  +++ Q I+ ++ +G++  T +  G L+ ++++  LI  ++ +     P      +L+DGFP   +    + E   +LK      ++++ L +P+  +  R+ ++ +   +G VY  Q   P  P
Sbjct:   21 GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAM---WLLDGFPRTTAQASALDE---LLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVP 165          
BLAST of Adenylate kinase 9 vs. Ensembl Nematostella
Match: EDO38691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC73])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 289/647 (44.67%), Postives = 412/647 (63.68%), Query Frame = 3
Query: 3804 NEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFL-PLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEIL-----RTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDN 5726
             EI + +D +T  ++ V E+  E+ IPR E+  G K  IV+Y + K L+ ++D RES+F+RC+ +    A K+I  G+K+ SRFGRWCPV L++  G  + P      P +PV+YR ++YF  S++ RD F+  P KYLKQPSPK  VPI++ I+G PKSGKTTLA+RF  EYG++R++ G A+R VLN   +TELA++I   +    VV    +++A+++ L+N    T G+VLDGYPL   Q+ +M ++KIIP +V EL     E+I R   DR       P+HDS +I+AI++  +   +  +R WY  EH N   +D ++  W +W +   + ++ +  IQ YL     G+AA+I ++CI   E  ARL D  +YCPVSL+   ELV  +    L FAAE+RG YYKM    EL+ F  +    +     R    P+ LP +     ++ MFP+Q++LQGYCPV F DGK RYE ++ G+ E  VVEYRGK+Y    +  +  FM++P  + GL+LP KLPP K+ L++ SLP+ GY+EQT++ A+  ALT  G +KPKYP++D  RSALLY+A HLKAYNPKS E++R+KYK KL++FE  CELIKYL   MT  Y+E E RP+ FD K+T FL L+ LE N
Sbjct:   55 TEIGDRYDEETGRLAVVQETLEELLIPRLEINGGRKPRIVRYCIEKALRPVIDYRESLFDRCFAIDMFLANKMIVTGYKFPSRFGRWCPVKLMS--GEVIQPQYGSGLPAYPVVYRQHVYFCCSEEARDEFVLCPAKYLKQPSPKPVVPIRIAIIGPPKSGKTTLAKRFTAEYGVVRLSIGEAIRKVLNNQSHTELARQINLRVGAHRVVDEASMVQAVDITLLNMHFQTGGFVLDGYPLTARQVELMTERKIIPVKVLELRVTDEEVIRRGIADRNDPARLLPLHDSHQILAIRLNCWQKEVAAVRDWYEHEHRNWSLLDGQRSKWKVWNEALEEARQSVRQIQIYLHRISSGRAASITDMCITQKELLARLGDFSQYCPVSLADKGELVDCSITPSLEFAAEFRGRYYKMASRAELEKFLADPTRYVPPNAPRPLPSPDMLPKRRSAADVKAMFPIQIELQGYCPVTFWDGKQRYEHIVPGDPE-LVVEYRGKIYYLESEKKLDKFMRLPELYHGLKLPNKLPPKKDPLSVSSLPMLGYMEQTVSTAITKALTEVGCVKPKYPYLDAKRSALLYVAYHLKAYNPKSSEYVRKKYKQKLQKFEEQCELIKYLGQEMTSLYREPEERPIDFDHKLTNFLALKGLEPN 698          

HSP 2 Score: 55.0694 bits (131), Expect = 2.652e-7
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 3
Query: 1293 GFKWLKSEWANYCPVALFEG-ILQP----GQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYL-LPS-QPEIPCKISVVGPNGSGKTILSQLLANRY 1559
            G+K+  S +  +CPV L  G ++QP    G P + V +   VY   S++  + FV  P  YL  PS +P +P +I+++GP  SGKT L++     Y
Sbjct:  131 GYKF-PSRFGRWCPVKLMSGEVIQPQYGSGLPAYPVVYRQHVYFCCSEEARDEFVLCPAKYLKQPSPKPVVPIRIAIIGPPKSGKTTLAKRFTAEY 225          

HSP 3 Score: 50.8322 bits (120), Expect = 6.257e-6
Identity = 28/100 (28.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query: 2703 WCPVTLKTHKVLCP----GNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFI 2990
            WCPV L + +V+ P    G P     Y   +Y+   EE+R++F+  P +YL          +R+ I+G   SGKTT  ++   +  +  +S  E +++ +
Sbjct:  141 WCPVKLMSGEVIQPQYGSGLPAYPVVYRQHVYFCCSEEARDEFVLCPAKYLKQPSPKPVVPIRIAIIGPPKSGKTTLAKRFTAEYGVVRLSIGEAIRKVL 240          
BLAST of Adenylate kinase 9 vs. Ensembl Nematostella
Match: EDO36193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJB9])

HSP 1 Score: 103.219 bits (256), Expect = 4.551e-22
Identity = 59/138 (42.75%), Postives = 92/138 (66.67%), Query Frame = 3
Query: 1878 EEIVRDLPEKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVK-NIE--TQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAAR 2282
            EE+  + P+K+ EI +D S+PEV  +V Q M +AEK+   L  E Y+  LE+A++   E   +M++  PN    GG+V+DNFP +REQ++A++E    + ++PD V++++D S+N +FLLKRWYANNKE +     AR
Sbjct:  251 EEVPVEEPKKV-EIPIDASHPEVVKMVEQVMVDAEKKEPELAPEEYVSVLEEAIQARCEELIKMREHDPNGPSFGGYVIDNFPRSREQFSAMVE----RGIIPDDVVILRDESDNGEFLLKRWYANNKEELHKVWEAR 383          
BLAST of Adenylate kinase 9 vs. Ensembl Nematostella
Match: EDO42583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S170])

HSP 1 Score: 69.3218 bits (168), Expect = 5.535e-13
Identity = 36/137 (26.28%), Postives = 77/137 (56.20%), Query Frame = 3
Query:  366 MGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRG-YLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVY 773
            MG PG+G  T+++  + +F  E+++  EL+  H++  T++G++ Q  +  G L+ +E+++DLI  +++    A +G +L+DGFP       T+ E+  I        D+++ + +P   + +R+  + +   +G VY
Sbjct:    1 MGPPGSGKGTVSERIVRDFGVEHLSSGELLRHHVQNHTDLGEEAQAYILKGELVPDELMVDLILHELD----AKKGNWLLDGFPRTVGQAETLSEKHKI--------DVVVNMDVPFATIVDRIKQRWVHAVSGRVY 125          

HSP 2 Score: 63.1586 bits (152), Expect = 8.142e-11
Identity = 34/101 (33.66%), Postives = 64/101 (63.37%), Query Frame = 3
Query: 4263 LGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKG-YVLDGYPLAIEQIAMMNDKKII 4562
            +G P SGK T++ER V+++G+  ++ G  LR  +  +  T+L +E ++Y++KG +VP EL++     L+++   A KG ++LDG+P  + Q   +++K  I
Sbjct:    1 MGPPGSGKGTVSERIVRDFGVEHLSSGELLRHHVQNH--TDLGEEAQAYILKGELVPDELMVD----LILHELDAKKGNWLLDGFPRTVGQAETLSEKHKI 95          
BLAST of Adenylate kinase 9 vs. Ensembl Nematostella
Match: EDO43271 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ3])

HSP 1 Score: 67.781 bits (164), Expect = 2.487e-11
Identity = 42/152 (27.63%), Postives = 75/152 (49.34%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSI 812
             ++ G PG+G  ++A +      C  +N   +I    E ++++  K++T       +   + ++LI ++I+  +   +G+L++GFP          EQ   L+   I P   I L  PD  L  R++ +R+DPETGDVY    +DP   P +
Sbjct:   59 IVIHGPPGSGKRSMAVMISKHLDCVCLNVNNIIS---ESESKLASKVRT--NRYTEVPTHIWVNLIAERIKKTDCLTKGWLLEGFPQTR-------EQALALQVEGIIPSHFILLDCPDTVLIERVMGKRVDPETGDVYHT-TFDPPSDPEV 197          
BLAST of Adenylate kinase 9 vs. Ensembl Nematostella
Match: EDO30550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G9])

HSP 1 Score: 58.151 bits (139), Expect = 5.511e-9
Identity = 38/143 (26.57%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  360 ILMGKPGAG-STTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFN-ILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQ 782
            IL+G PG+G  T + +  I    C      +++   +   + +GKK++++++ G L+S+++V++LI   +  PE    G+L+DGFP      V   E+ + +L+    Q D ++   I D  L  R+  + L   +G  Y  +
Sbjct:   18 ILLGPPGSGKGTQVKRRRISIVVCLLFC--DMLRAVVASGSALGKKVKSVMDAGQLVSDDLVVELIDDNLTKPE-CQNGWLLDGFPRT----VAQAEKLDGLLEKRNAQLDAVVEFNIADSLLVKRITGRLLHKSSGRTYHTE 153          
BLAST of Adenylate kinase 9 vs. Ensembl Medaka
Match: ENSORLT00000030303.1 (pep primary_assembly:ASM223467v1:24:7958525:7959895:-1 gene:ENSORLG00000023157.1 transcript:ENSORLT00000030303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.009 bits (554), Expect = 1.085e-62
Identity = 126/322 (39.13%), Postives = 194/322 (60.25%), Query Frame = 3
Query: 3879 IPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYL 4844
            IP   ++A  ++  VQ +L ++++ LL  RES+F+ C PVS + AEKL+   +K+ S FG   PV    E     PL    +  +P+++  Y+YF  +K+ RD FM+NPLKYL+QP P   +PIK+ ++G PKSGKT+ AERF ++YGL R++    + TVLN   +T+LA ++K YLV+GL VP EL I+ + + LM+S C+TK YVLD +P  +EQ  +M+  + IP  + EL    +E+ +R   D+     P  +H+S +I+     NY   +  IR +  E++ N   +DA K  W++WEK   +V   I +I  YL
Sbjct:    3 IPPMAIDASRRLVTVQRQLLQRVQPLLTDRESLFQTCQPVSSRLAEKLLLSSYKFHSGFGCSDPVQY-KERDKIQPLQWPLNTTYPLLFNQYVYFFATKENRDSFMSNPLKYLQQPKPSPKLPIKIAVVGPPKSGKTS-AERFSQKYGLERLSICGCMNTVLNNQGHTDLALKMKKYLVEGLAVPDELAIQCLMVALMHSTCSTK-YVLDDFPKTLEQAELMSSNRFIPMVMTELKMDFQEVQMRGLADKTN---PHMLHESLEILKTADFNYRKEVVLIRSYVQEQYQNWLVLDALKSKWWIWEKIAEEVSISIKNISTYL 318          
BLAST of Adenylate kinase 9 vs. Ensembl Medaka
Match: ENSORLT00000017449.2 (pep primary_assembly:ASM223467v1:24:7956950:7958452:-1 gene:ENSORLG00000013913.2 transcript:ENSORLT00000017449.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 4.252e-58
Identity = 106/264 (40.15%), Postives = 155/264 (58.71%), Query Frame = 3
Query: 4860 GKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTA---FLPEH--LPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHM 5636
            G+A  IY L + P E    L    +YCPV L++   LV  ++ +     AEYR  YYK+  E+ L+ F  + ++ +       LP+   LP K+    +++ FP   +L+G+CPV + +GK R+E L+ G K KY VEYR +LY F        F++ P  FW  +LPKK+P +   + + SLP  GY+EQ MA+ L  A+TA G L+PKYPF+   +S L+Y+ L+LKA+NP+S E+ R++ K KL  FE  C LI YLS  M
Sbjct:    7 GQATCIYRLSLTPDEVARGLGTFDQYCPVCLARHCHLVDCSRTTSFALVAEYRKLYYKLCSEKHLEEFLSSPDQFVPPGCPHMLPQPHLLPKKLTEVEVKNRFPQHPELKGFCPVTYQEGKQRFEALVQG-KAKYAVEYREQLYVFASQQKQEKFLRTPEAFWNQKLPKKVPALCEPVLLTSLPTLGYMEQGMANPLIKAMTAAGCLRPKYPFLSAQKSVLIYVGLYLKAFNPRSSEYSRQRCKKKLASFEEDCTLIPYLSAKM 269          
BLAST of Adenylate kinase 9 vs. Ensembl Medaka
Match: ENSORLT00000017464.3 (pep primary_assembly:ASM223467v1:24:7963340:7969929:-1 gene:ENSORLG00000013926.3 transcript:ENSORLT00000017464.3 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 4.565e-25
Identity = 62/170 (36.47%), Postives = 92/170 (54.12%), Query Frame = 3
Query: 1182 PVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKK 1691
            P+ L  + G    EE    ++ D +   L      APGF W  S W   CPVAL EG    G  +F+VGF +K+YL+SS++    F+ NPR YLLP  P  PC++S++G   +GK+ L +L+A  Y   V++++ L++P       V+     E+  K  +ET  A IKK
Sbjct:  207 PMYLLELDGNSTPEEQLQVTNED-ILTSLSSSRTVAPGFWWRWSRWGQTCPVALKEGKNLTGSAEFSVGFQDKLYLLSSREAHQKFLTNPRQYLLPPMPRTPCRVSIIGAPLTGKSTLCRLVAQHYGGVVLDVEELLQP-------VFAMAEQERFEKIKVETTRAAIKK 368          

HSP 2 Score: 105.531 bits (262), Expect = 9.940e-23
Identity = 51/160 (31.87%), Postives = 91/160 (56.88%), Query Frame = 3
Query:  312 DKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYD 791
            + E E + L +KP+CF+++GKPG G +TLAK   + ++C  ++  +L+               +IL +G  I++++V+ LI  ++ SP+V H GY++   P  +     IH+Q  ++++ K+ PD +I +K PD DL  RL   +  PETG  Y +  ++
Sbjct:   19 NDEAEKERLQAKPTCFLIVGKPGVGKSTLAKKMAESWKCVLVDDFQLL---------------SILSEGKSITDDVVLQLILARLNSPDVKHYGYVLSCLPFLSDDHQNIHKQLELIQNLKLPPDFVINIKCPDSDLVQRLSGLKKHPETGQSYSRDQWE 163          

HSP 3 Score: 57.7658 bits (138), Expect = 1.100e-7
Identity = 33/92 (35.87%), Postives = 51/92 (55.43%), Query Frame = 3
Query: 4047 SRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYG 4322
            SR+G+ CPV+L  + G  L    E    F V +++ +Y   S++    F+TNP +YL  P P+   P +V I+G P +GK+TL     + YG
Sbjct:  249 SRWGQTCPVAL--KEGKNLTGSAE----FSVGFQDKLYLLSSREAHQKFLTNPRQYLLPPMPR--TPCRVSIIGAPLTGKSTLCRLVAQHYG 332          

HSP 4 Score: 55.0694 bits (131), Expect = 6.951e-7
Identity = 33/92 (35.87%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 2706 CPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQ 2981
            CPV LK  K L  G+ E +  +  K+Y  S  E+ +KF+ +P QYL +  +P +P  R+ I+G   +GK+T  R +AQ      +  +E+LQ
Sbjct:  255 CPVALKEGKNL-TGSAEFSVGFQDKLYLLSSREAHQKFLTNPRQYL-LPPMPRTPC-RVSIIGAPLTGKSTLCRLVAQHYGGVVLDVEELLQ 343          
BLAST of Adenylate kinase 9 vs. Ensembl Medaka
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:101175146])

HSP 1 Score: 70.0922 bits (170), Expect = 1.093e-12
Identity = 38/137 (27.74%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  363 LMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVY 773
            ++G PG+G  T++K     F  +Y++  + +   I   TE G +++T +E G  + + +V  L+  K+E  +++   +L+DGFP   +  + ++  +        Q D++I L IP   LK+RL  + + P +G VY
Sbjct:    9 ILGPPGSGKGTISKRIAQSFGLQYVSSGDYLRAGIPANTEAGVQMKTYIERGLSVPDHVVTGLVLPKLE--QLSSHSWLLDGFPRTLAQALVLNNVY--------QLDLVISLNIPYETLKDRLSDRWIHPASGRVY 135          

HSP 2 Score: 61.6178 bits (148), Expect = 8.762e-10
Identity = 32/100 (32.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMND 4550
            +  ILG P SGK T+++R  + +GL  ++ G  LR  +    NTE   ++K+Y+ +GL VP  +V   +  L    Q ++  ++LDG+P  + Q  ++N+
Sbjct:    6 RAAILGPPGSGKGTISKRIAQSFGLQYVSSGDYLRAGIPA--NTEAGVQMKTYIERGLSVPDHVVTGLV--LPKLEQLSSHSWLLDGFPRTLAQALVLNN 101          
BLAST of Adenylate kinase 9 vs. Ensembl Medaka
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:101160331])

HSP 1 Score: 67.3958 bits (163), Expect = 8.951e-12
Identity = 41/162 (25.31%), Postives = 85/162 (52.47%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            ++MG PG+G  T++   +  F  ++I+  +++  +I+ QTE+G  +++ ++ G L+ + ++  LI + ++S E  H  +L+DGFP   S    + + + +        D +I L +P   +K RL S+     +G VY      P  P   +V  + +V+++
Sbjct:   11 VIMGPPGSGKGTVSARIVKSFGVKHISSGDILRANIKQQTELGLLVRSCMDQGQLVPDGLMSRLILKDLKSME--HISWLLDGFPRTVSQAEALDQAYTL--------DTVINLNVPFQTIKERLTSRWTHISSGRVYNTDFNPPKVPGFDDVTGEPLVQRD 162          

HSP 2 Score: 52.7582 bits (125), Expect = 9.041e-7
Identity = 31/100 (31.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMN 4547
            ++  I+G P SGK T++ R VK +G+  I+ G  LR   N    TEL   ++S + +G +VP  L+ + I   L + +  +  ++LDG+P  + Q   ++
Sbjct:    8 LRAVIMGPPGSGKGTVSARIVKSFGVKHISSGDILRA--NIKQQTELGLLVRSCMDQGQLVPDGLMSRLILKDLKSMEHIS--WLLDGFPRTVSQAEALD 103          
BLAST of Adenylate kinase 9 vs. Planmine SMEST
Match: SMESG000043841.1 (SMESG000043841.1)

HSP 1 Score: 3312.7 bits (8588), Expect = 0.000e+0
Identity = 1840/1840 (100.00%), Postives = 1840/1840 (100.00%), Query Frame = 3
Query:  225 MSSADLDIDSKKTHSRSSQDKEYKLDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDXXXXXXXXXXXXXXXXXXGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSXXXXXXXXXXXXXXXFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKTESLAKIAVDNLAQSAIDGIEENTRDRIINXXXXXXXXXXXXXXXXXTIQGQKSFEEEIVRDLPEKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARVGDKIKDAGTAKPDQEVVLSVDSNLPPPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEKIFKPIAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKXXXXXXXXXXXXXXXXXXXAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKDLYKRKLTEYXXXXXXXXXXXXXXEILANLEEKRNKKYNTEKPVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRXXXXXXXXXDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWIN 5744
            MSSADLDIDSKKTHSRSSQDKEYKLDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDEEEEEEEEEEEEEELLEEGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSLNVINLNANLPPNNLFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKTESLAKIAVDNLAQSAIDGIEENTRDRIINEEYEEEESDKRELRSEDTIQGQKSFEEEIVRDLPEKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARVGDKIKDAGTAKPDQEVVLSVDSNLPPPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEKIFKPIAVELADLDEDEDDEAEEAEENEEEQPEEEEQENDEEPNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKKQEIQIKDEIIEEWDENENAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKDLYKRKLTEYKAKKRQLKLDRRRKEILANLEEKRNKKYNTEKPVKNESDEDNEEEEEEDEDLEEEVNVDDMLAEEFEEEEEEAEDDEEEDSEEDAREKIENEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRLFKKLKKLLDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWIN
Sbjct:    1 MSSADLDIDSKKTHSRSSQDKEYKLDPYSDKEIELQFLNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKEKTGDEEEEEEEEEEEEEELLEEGENAAKGNPDFPLLDPETIRKLLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSLNVINLNANLPPNNLFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGGKSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKDRMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVINMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKTESLAKIAVDNLAQSAIDGIEENTRDRIINEEYEEEESDKRELRSEDTIQGQKSFEEEIVRDLPEKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEELEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLLPDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARVGDKIKDAGTAKPDQEVVLSVDSNLPPPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIESNFEDRTIEELYQFTEKEIEKIFKPIAVELADLDEDEDDEAEEAEENEEEQPEEEEQENDEEPNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYLGKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHGRKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAIEELEGSADENAMKSESPGENATGDETAVEGEDNTKKQEIQIKDEIIEEWDENENAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEEAQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKDLYKRKLTEYKAKKRQLKLDRRRKEILANLEEKRNKKYNTEKPVKNESDEDNEEEEEEDEDLEEEVNVDDMLAEEFEEEEEEAEDDEEEDSEEDAREKIENEIREVFDNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRLFKKLKKLLDRRESVFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENHPIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAANIYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGYYYKMKGEEELDIFYDNAEEILRTAFLPEHLPNKIDPNRIQDMFPMQLDLQGYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPSKFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPKYPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYLSDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWIN 1840          
BLAST of Adenylate kinase 9 vs. Planmine SMEST
Match: SMESG000027219.1 (SMESG000027219.1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.809e-13
Identity = 59/206 (28.64%), Postives = 107/206 (51.94%), Query Frame = 3
Query: 4251 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFEL-----VS----CPRELILRANKDRAGIELPFPMHDSS------------KIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKS 4805
            ++ +LG   SGK+T+A    K+Y ++++  G  +R  + +     LA  ++SY+ K L VP  ++I+ IE  L N  C+T G++L GYPL+++Q  +++  K+ P+RVF L     VS    C R L      D+  +    P++ S+            K+I  K+A Y++ + E++ +Y +       IDA +    ++E  +S
Sbjct:  270 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLA--MRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERLCERRLD-PVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDH----VVIDANQELHNIFELVES 468          

HSP 2 Score: 66.6254 bits (161), Expect = 1.213e-10
Identity = 39/146 (26.71%), Postives = 79/146 (54.11%), Query Frame = 3
Query:  357 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDP 794
             IL+G  G+G +T+A L   ++    +N  +LI + I  + + G  +++ +E    + + ++I LI +++ +   +  G+L+ G+P +        +Q  +L   K++P+ + +L++P      RL  +RLDP TGD Y   +Y+P
Sbjct:  271 IILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSV-------KQAELLDCTKLEPNRVFFLEVPSFVSLERLCERRLDPVTGDQY-HLSYNP 408          

HSP 3 Score: 51.9878 bits (123), Expect = 4.661e-6
Identity = 38/142 (26.76%), Postives = 66/142 (46.48%), Query Frame = 3
Query:  348 PSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVY 773
            P  FIL G P +G  T+AK+      C+ +N  ++     E  T++ +  +  ++    I   + I  ++ + +  +   +G+++ GFP          E    L+   I P  ++ L  PD  L  R   +R+DPETGDVY
Sbjct:   58 PRIFIL-GPPASGKHTIAKMLSGRLNCQLLNPVDVFS---ECDTDIKEIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPET-------REHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVY 188          
BLAST of Adenylate kinase 9 vs. Planmine SMEST
Match: SMESG000060686.1 (SMESG000060686.1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.656e-9
Identity = 31/93 (33.33%), Postives = 55/93 (59.14%), Query Frame = 3
Query:  336 LNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFP 614
            L S    F+L G PG+G  T  +  ++++   +++  +L+ + +E  +E G KL+ I+E G L+S ++V+DLIR  +        G+LIDG+P
Sbjct:   13 LKSAKVIFVL-GGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYP 104          

HSP 2 Score: 55.4546 bits (132), Expect = 6.941e-8
Identity = 49/199 (24.62%), Postives = 91/199 (45.73%), Query Frame = 3
Query: 4203 PLKYLKQPSPKDAVPIKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKT 4799
            P K + +   K      + +LG P SGK T  E+ V +YG   ++ G  LR  +     +E   ++K  + KG +V  ++V+  I   ++     + G+++DGYP  +EQ     + +IIP       S   E ++RA   + G E    + D+++ I  ++  ++     +   Y ++H     IDA      ++EK 
Sbjct:    2 PQKKIDEAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEV--ESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQ-GKRFENEIIPCECVIAFSVS-EDVMRARLLKRG-ETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQH-KAHQIDASGTIDEIFEKV 194          
BLAST of Adenylate kinase 9 vs. Planmine SMEST
Match: SMESG000037481.1 (SMESG000037481.1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.235e-9
Identity = 39/163 (23.93%), Postives = 84/163 (51.53%), Query Frame = 3
Query:  360 ILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFN-ILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPPQIVVKKE 845
            IL+G  G+G  T A    ++F+  +++  +++   +   + +G+++  I++ GGLIS+E+V  LI + +  P     G+++DGFP      V   E+ + +L+      D +I L   D  L+ R+  +     +G  Y ++ Y P  P   ++  + +++++
Sbjct:   16 ILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPN-CRNGFVLDGFPRT----VGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRK 173          

HSP 2 Score: 49.6766 bits (117), Expect = 7.317e-6
Identity = 27/95 (28.42%), Postives = 50/95 (52.63%), Query Frame = 3
Query: 4248 IKVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQ 4532
            +   +LG   SGK T A +  +++ +  ++ G  LR +++    + L ++I   + KG ++  E+V K I   L +  C   G+VLDG+P  + Q
Sbjct:   13 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSS--GSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRN-GFVLDGFPRTVGQ 104          
BLAST of Adenylate kinase 9 vs. Planmine SMEST
Match: SMESG000031478.1 (SMESG000031478.1)

HSP 1 Score: 55.0694 bits (131), Expect = 6.338e-8
Identity = 39/121 (32.23%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 4254 VCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTEL--AKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFELVSCPRELIL 4610
            + +LG P SGK T   +  KEY    I+ G  L+    E  N ++   + IKS+  KG +VPHE+  K I L  M S   +K +V+DG+P         N+   I  + F +  C  + +L
Sbjct:   10 IIVLGYPGSGKGTQCNKIEKEYNYHHISAGYLLQK---ETLNPQMKYGEIIKSHRSKGTIVPHEITCKLI-LQEMKSSQKSKKFVIDGFP--------RNEDNFIGWKSFLVKHCSLQCVL 118          
The following BLAST results are available for this feature:
BLAST of Adenylate kinase 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AK99.405e-16542.72adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33... [more]
AK91.649e-15542.94adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33... [more]
AK93.707e-7335.32adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33... [more]
AK91.597e-7236.76adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33... [more]
AK93.679e-7241.38adenylate kinase 9 [Source:HGNC Symbol;Acc:HGNC:33... [more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
let-7545.164e-1329.94Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
let-7545.164e-1329.94Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
F38B2.45.177e-824.62Adenylate kinase isoenzyme 1 [Source:UniProtKB/Sw... [more]
ZK673.22.312e-627.97Probable adenylate kinase isoenzyme ZK673.2 [Sour... [more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adk23.134e-1326.09gene:FBgn0283494 transcript:FBtr0072163[more]
Adk34.407e-1225.61gene:FBgn0042094 transcript:FBtr0082331[more]
Adk34.407e-1225.61gene:FBgn0042094 transcript:FBtr0339379[more]
Adk34.407e-1225.61gene:FBgn0042094 transcript:FBtr0082330[more]
Adk34.407e-1225.61gene:FBgn0042094 transcript:FBtr0339378[more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak91.019e-13940.03adenylate kinase 9 [Source:ZFIN;Acc:ZDB-GENE-04101... [more]
ak92.001e-6738.04adenylate kinase 9 [Source:ZFIN;Acc:ZDB-GENE-04101... [more]
ak5l4.618e-1026.00adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
ak85.003e-1026.85adenylate kinase 8 [Source:NCBI gene;Acc:553671][more]
ak86.501e-1026.17adenylate kinase 8 [Source:NCBI gene;Acc:553671][more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AK92.766e-14841.95adenylate kinase 9 [Source:NCBI gene;Acc:100144994... [more]
AK96.626e-14842.19adenylate kinase 9 [Source:NCBI gene;Acc:100144994... [more]
ak31.112e-1222.84adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
ak31.199e-1222.84adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
ak21.142e-1125.90adenylate kinase 2 [Source:NCBI gene;Acc:448011][more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ak93.144e-16243.57adenylate kinase 9 [Source:MGI Symbol;Acc:MGI:2685... [more]
Ak26.492e-1429.53adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak28.188e-1429.53adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak43.058e-1026.09adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak43.058e-1026.09adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
back to top
BLAST of Adenylate kinase 9 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5TCS8|KAD9_HUMAN7.918e-15542.94Adenylate kinase 9 OS=Homo sapiens OX=9606 GN=AK9 ... [more]
sp|Q0J6P7|KAD5_ORYSJ6.796e-2330.95Probable adenylate kinase 5, chloroplastic OS=Oryz... [more]
sp|Q31DX5|KAD_HYDCU2.252e-1931.14Adenylate kinase OS=Hydrogenovibrio crunogenus (st... [more]
sp|P43188|KADC_MAIZE2.681e-1929.86Adenylate kinase, chloroplastic OS=Zea mays OX=457... [more]
sp|Q6ZC69|KAD2_ORYSJ1.914e-1828.67Probable adenylate kinase 2, chloroplastic OS=Oryz... [more]
back to top
BLAST of Adenylate kinase 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182031679.012e-9345.87tr|A0A267FA46|A0A267FA46_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182584694.816e-5246.33tr|A0A267F4C5|A0A267F4C5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183258370.000e+045.87tr|A0A267GDB6|A0A267GDB6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157337650.000e+045.55tr|R7UGY3|R7UGY3_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|196991391.046e-4346.12tr|W4YXQ7|W4YXQ7_STRPU Uncharacterized protein OS=... [more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak95.764e-14039.53adenylate kinase 9 [Source:ZFIN;Acc:ZDB-GENE-04101... [more]
ak32.199e-1123.46adenylate kinase 3 [Source:NCBI gene;Acc:103033473... [more]
ak22.192e-1026.06adenylate kinase 2 [Source:NCBI gene;Acc:103022510... [more]
ak22.633e-1026.06adenylate kinase 2 [Source:NCBI gene;Acc:103022510... [more]
ak84.180e-1031.48adenylate kinase 8 [Source:NCBI gene;Acc:553671][more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004814.11.174e-9638.72pep scaffold:Pmarinus_7.0:GL476574:2348:7207:-1 ge... [more]
ENSPMAT00000004823.15.933e-7135.93pep scaffold:Pmarinus_7.0:GL476574:21704:35297:-1 ... [more]
ak5l8.082e-624.08adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ADK12.756e-1226.21Adenylate kinase, required for purine metabolism; ... [more]
URA63.166e-925.83Uridylate kinase; catalyzes the seventh enzymatic ... [more]
ADK21.187e-621.85Mitochondrial adenylate kinase; catalyzes the reve... [more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386912.652e-744.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361934.551e-2242.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425835.535e-1326.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432712.487e-1127.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305505.511e-926.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenylate kinase 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000030303.11.085e-6239.13pep primary_assembly:ASM223467v1:24:7958525:795989... [more]
ENSORLT00000017449.24.252e-5840.15pep primary_assembly:ASM223467v1:24:7956950:795845... [more]
ENSORLT00000017464.34.565e-2536.47pep primary_assembly:ASM223467v1:24:7963340:796992... [more]
ak41.093e-1227.74adenylate kinase 4 [Source:NCBI gene;Acc:101175146... [more]
ak38.951e-1225.31adenylate kinase 3 [Source:NCBI gene;Acc:101160331... [more]
back to top
BLAST of Adenylate kinase 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043841.10.000e+0100.00SMESG000043841.1[more]
SMESG000027219.12.809e-1328.64SMESG000027219.1[more]
SMESG000060686.12.656e-933.33SMESG000060686.1[more]
SMESG000037481.13.235e-923.93SMESG000037481.1[more]
SMESG000031478.16.338e-832.23SMESG000031478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003507 ID=SMED30003507|Name=Adenylate kinase 9|organism=Schmidtea mediterranea sexual|type=transcript|length=5794bp
AAGCCTTTTTACTGGTTTAGTCACCAAAAATTGTATCGATTCTTTTAAAA
ATCTTTCGTTTTTATATTTTTTAGTAAATTAGACATAAATTTTTGTTAAT
TGAATATTGCTAATTATAGTTTTCTATTTTATAGATTATTTATTAATTTT
AAATTAGCATAAGATTTGCAAATATTTATTAAAAAAATAAATTGATTAGA
AAAGTATTTATAAGGAATTAATTCATGTCGAGTGCAGATTTAGATATTGA
TAGCAAAAAAACACATTCTAGAAGCAGTCAAGATAAAGAATATAAGCTTG
ATCCTTACTCCGATAAAGAAATTGAATTACAATTTTTAAATTCTAAACCG
TCATGCTTTATATTAATGGGAAAACCAGGAGCTGGCTCCACGACTTTGGC
CAAATTATTTATCGATGAATTTCAATGTGAATACATCAATGGCAAAGAAC
TAATCGAACAACACATAGAAGGTCAAACAGAAGTAGGTAAAAAGTTACAA
ACAATTTTAGAGGACGGGGGGCTGATTAGTGAAGAAATGGTGATAGATTT
GATTAGGCAAAAAATCGAGAGTCCAGAAGTAGCTCACCGTGGCTATCTGA
TTGATGGATTTCCCAATGCGAATTCAACTGACGTAACTATACACGAGCAA
TTCAATATTCTCAAATCTTTCAAAATTCAGCCGGATATTTTGATTTACTT
GAAGATTCCTGATGGCGATTTGAAAAATCGTCTGTTGAGTCAAAGGTTGG
ATCCAGAAACAGGGGATGTATATTTCAAACAAAACTATGATCCCGATTTT
CCTCCTTCTATTGAAGTTCCTCCTCAAATAGTGGTAAAAAAAGAAAAAAC
CGGAGACGAAGAAGAAGAAGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAC
TTCTTGAAGAAGGAGAAAATGCCGCCAAAGGCAATCCAGATTTTCCTTTA
CTTGATCCGGAAACAATCAGAAAATTATTAAAAAGGCCAGAAGATTTTCT
AGATAAAATCGAAACAAAAATTGAAAATTACACAGAAAAGGCAGCATCAT
TAATAAATGATTACATTGAGAACTTTAACAGTTTGAATGTGATCAATCTG
AATGCAAATTTGCCCCCGAATAATCTATTTAAGCATCTAACGGAGAGGCT
TCGCTACTTATCTATTCGACCTGCTGCGGTCCCAGTGGAATTATTTCACG
TGGTTGGTGAAGATGAAGAGGAAGAATATCCAGATGGATCTGATTTAGAC
GAATTATTCAAAGAATTGGGAGGAAAAAGTCACCCTGCTCCTGGATTTAA
GTGGCTTAAAAGTGAATGGGCTAATTATTGCCCTGTCGCCCTTTTCGAAG
GTATTCTGCAACCTGGTCAACCGCAATTTGCTGTCGGATTTCTAAATAAA
GTCTACTTGATGTCAAGCAAAGACCGTATGAATCTATTTGTCAGAAATCC
CAGACCTTATTTGCTACCATCGCAACCTGAAATCCCTTGTAAAATCTCAG
TTGTTGGTCCAAATGGATCCGGCAAAACGATTCTGTCGCAATTACTTGCA
AACCGATACAAGGCTCAAGTCATCAATATGAAATGGTTAATGAAACCACA
CGAAGACGAAGCTAAAAGGGTTTATTTAGCAAATGTTCTGGAAAAATCAA
CAAAAGATGCAATAGAAACAGTCCATGCTAAAATTAAAAAACAAATGGAA
CTAGAAAAAACCGAAAGCCTTGCTAAAATAGCGGTTGATAACCTTGCACA
ATCAGCTATAGATGGAATTGAAGAAAATACTCGAGATCGAATAATCAACG
AAGAGTATGAGGAAGAGGAATCCGATAAGCGAGAATTACGAAGTGAAGAT
ACGATTCAAGGACAGAAAAGCTTCGAAGAGGAAATCGTAAGAGATTTGCC
AGAAAAATTACCAGAAATCTTTGTGGATGAATCCAATCCCGAAGTTCAGG
ATTTGGTTCGACAAGCAATGGAAGAAGCAGAAAAACAAGTTATTCCATTG
AAAGTAGAGTTATATATGGAGGAGTTAGAAAAAGCCGTGAAAAACATCGA
GACCCAAATGCAACAGAAAACACCCAACAGCAAAATGCACGGCGGTTGGG
TTTTGGATAATTTTCCCAATACCAGAGAACAATGGGCCGCACTTTTGGAA
ACTAATCCAGAAAAGTATTTGTTGCCTGACCAGGTCATTTTGATGAAAGA
TGGAAGTGAAAATTATCAGTTCTTGTTAAAACGATGGTATGCAAATAATA
AAGAATCCATAGACTCGGCCATAGCAGCCCGGGTTGGAGATAAAATTAAA
GACGCAGGAACTGCTAAACCGGATCAAGAGGTTGTATTGAGTGTTGATTC
AAATTTACCTCCTCCAGGCCCTGAACTTAATACCGCCCGCAAAGAAATTT
CTGATTGGTATCAAGACTGGAATGGAGTGTTAAGTATTATTTCAAATTCA
CCAACCCATATAGAAGTGATCGAATCAAATTTTGAAGACAGGACGATAGA
GGAATTGTATCAATTTACAGAAAAAGAAATCGAAAAAATATTCAAGCCAA
TAGCTGTTGAACTAGCTGATTTAGATGAAGATGAAGATGATGAAGCGGAG
GAAGCTGAAGAAAATGAAGAAGAACAACCAGAAGAGGAAGAACAAGAAAA
TGACGAAGAACCAAATCGCAGTAAAAAGCGGCCTCTTGGTGAAACAAATT
ATTGGTGTCCAGTTACTTTAAAAACTCACAAAGTTCTTTGTCCAGGAAAT
CCGGAAATTGCAGCAAAATATTTAGGTAAAATATACTATTTTTCCGATGA
AGAAAGTCGGGAAAAGTTCATTCAGGATCCTCTGCAATATTTACCAATTA
AGCATATACCAGAGTCGCCAGCTTTGCGATTAATTATACTTGGAGGAAAA
GGATCCGGCAAAACGACTCATGGACGAAAGATTGCTCAAAAACTTAGATT
GTTTCATATAAGTTTTCAGGAAATTCTACAAGAATTCATTCTACCAAAAA
ACCTTAAAAAGATTGGACCAGAATATGATGAGGGGCCGCCTGTACCAGAT
TTCATACTGCCAGATCCAGCAATTGAAGAACTAGAAGGATCTGCAGATGA
AAATGCCATGAAATCAGAAAGTCCGGGAGAAAATGCCACTGGTGACGAAA
CAGCGGTGGAAGGAGAAGATAATACTAAAAAACAAGAAATACAGATAAAA
GACGAAATAATAGAAGAATGGGATGAAAATGAAAATGCAATTAAGGAGAA
TTTGGAAAATCAGCAAGCTTTATCTACGGAATTGTTAGAAACTTTACTGA
AGGATTTCTGGAACAAACAGCCATTTGAAATGAAAGGTTTCGTTCTAGAA
GGATTTCCACGTAATGCAGAAGAGGCCCAATTTTTGGCTGAAAATAAACT
CTTTGTCGATGGAGTTATTTCTTTGGCAGCTACTGAAGACGATATAATTG
CTCGACTTCTGCCACCTCGATTGGAGAAATGGAAAAATCGAAAAGCTCTT
AAGGATTTATATAAAAGAAAGTTAACTGAGTACAAGGCAAAGAAAAGACA
ATTGAAGCTTGATAGACGGAGGAAAGAAATTCTGGCAAACTTAGAGGAGA
AAAGAAATAAAAAATATAATACTGAGAAGCCGGTTAAAAATGAATCTGAT
GAAGATAATGAAGAAGAAGAGGAAGAAGATGAGGATTTAGAAGAAGAAGT
AAACGTCGATGATATGTTAGCTGAAGAATTTGAGGAAGAAGAAGAAGAAG
CTGAAGACGATGAAGAAGAAGATTCCGAGGAGGACGCAAGAGAAAAAATT
GAGAATGAGATTAGAGAAGTGTTTGACAACGACACGAATGAAATATCGGC
GGTAATAGAAAGTTTCACAGAAATGCAAATTCCGAGATTTGAAGTTGAAG
CCGGCGATAAAATTCCAATTGTTCAATATCGATTATTCAAAAAACTGAAA
AAACTACTCGATAGAAGAGAATCAGTTTTTGAAAGATGTTACCCAGTGTC
ACCAAAAAATGCGGAAAAACTGATTAAATGTGGCCACAAATATCTGAGTA
GATTTGGAAGATGGTGTCCCGTGTCATTGCTGAATGAAATGGGAGCCTTT
TTACCTCTAGTCGATGAGAACCATCCGATTTTCCCAGTGATCTATCGCAA
CTATATATATTTCACGAAATCCAAACAAACTCGAGATCTCTTCATGACAA
ATCCTTTGAAATATCTGAAACAGCCATCACCCAAAGATGCAGTTCCGATT
AAAGTTTGCATTTTGGGTTTACCGAAATCCGGAAAGACAACTCTTGCAGA
GAGATTTGTGAAGGAATATGGTTTATTGCGTATAACTGGAGGCTCTGCAC
TGAGAACTGTATTAAATGAAAATTGGAACACGGAATTAGCTAAAGAAATC
AAGAGTTATCTCGTGAAAGGCCTTGTCGTGCCGCATGAACTAGTTATCAA
GGCCATCGAATTGTTATTAATGAATTCCCAGTGCGCAACAAAAGGCTATG
TCCTCGATGGATATCCGTTGGCAATCGAACAAATCGCCATGATGAATGAC
AAGAAAATTATTCCATCAAGAGTTTTCGAATTAGTTTCCTGTCCCCGGGA
GCTTATTTTACGGGCAAATAAGGATCGAGCCGGTATTGAGCTCCCGTTTC
CTATGCACGATTCTTCAAAGATTATTGCTATTAAAATGGCTAATTATTCA
AATAATATTAATGAAATTCGGCGTTGGTACGGTGAAGAGCATGACAACAT
ACGAAGCATTGATGCCGAAAAAGGAACTTGGTACTTATGGGAAAAGACAA
AAAGCGATGTAAAAGAACAGATATTTCACATTCAAAACTATTTGTTTGAT
CGAAGGGAAGGAAAAGCAGCGAATATCTATAACTTGTGTATCAGACCCTC
GGAATTTAAAGCAAGGTTGTCTGACCTTAAAGAATATTGTCCAGTTAGCC
TAAGCCAAACGAAAGAACTTGTTCATTTGAATCAAGATAGTGATTTACAT
TTCGCAGCAGAATACAGAGGATACTATTATAAAATGAAAGGAGAAGAAGA
ACTCGATATATTTTATGATAATGCCGAAGAAATTTTAAGGACAGCCTTTC
TTCCCGAACACTTACCAAACAAAATTGATCCAAATAGAATACAAGACATG
TTTCCAATGCAATTGGACTTGCAAGGCTATTGTCCAGTGTGTTTTCTCGA
CGGAAAGTGCCGATATGAAGGTTTAATTCTTGGAAACAAAGAAAAATATG
TTGTTGAATATCGAGGAAAACTCTACACGTTTTGTGGAGATGGATGCGTA
TCGAATTTCATGAAAATACCTTCAAAATTTTGGGGATTGGAACTTCCTAA
AAAACTTCCACCAGTGAAAAACAGTCTCAATATTAAAAGTTTACCTCTGC
CAGGTTATTTAGAACAGACAATGGCTGACGCTCTCAGGAATGCCTTGACA
GCTACAGGAACACTGAAACCGAAATATCCCTTCATTGATCCATCGAGATC
AGCGTTATTATATATAGCATTGCATCTTAAAGCATACAATCCAAAGAGTC
CGGAACATTTGCGTAGGAAATACAAACACAAATTAGAGGAGTTTGAGAAC
AGTTGTGAACTGATAAAATATCTCAGTGATCACATGACTCTCAAATATAA
AGAAGTCGAACATCGACCTATGGGATTCGATAAGAAAATGACGGAATTTC
TATATCTAAGGAAACTAGAGGACAATGAGGATCGCTGGATAAACTAGTAA
TAGCAATCTTCGGGAATGTTATAAATATTTTACTTTGAGAAAGG
back to top

protein sequence of SMED30003507-orf-1

>SMED30003507-orf-1 ID=SMED30003507-orf-1|Name=SMED30003507-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1841bp
MSSADLDIDSKKTHSRSSQDKEYKLDPYSDKEIELQFLNSKPSCFILMGK
PGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGL
ISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFK
IQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDPDFPPSIEVPP
QIVVKKEKTGDEEEEEEEEEEEEEELLEEGENAAKGNPDFPLLDPETIRK
LLKRPEDFLDKIETKIENYTEKAASLINDYIENFNSLNVINLNANLPPNN
LFKHLTERLRYLSIRPAAVPVELFHVVGEDEEEEYPDGSDLDELFKELGG
KSHPAPGFKWLKSEWANYCPVALFEGILQPGQPQFAVGFLNKVYLMSSKD
RMNLFVRNPRPYLLPSQPEIPCKISVVGPNGSGKTILSQLLANRYKAQVI
NMKWLMKPHEDEAKRVYLANVLEKSTKDAIETVHAKIKKQMELEKTESLA
KIAVDNLAQSAIDGIEENTRDRIINEEYEEEESDKRELRSEDTIQGQKSF
EEEIVRDLPEKLPEIFVDESNPEVQDLVRQAMEEAEKQVIPLKVELYMEE
LEKAVKNIETQMQQKTPNSKMHGGWVLDNFPNTREQWAALLETNPEKYLL
PDQVILMKDGSENYQFLLKRWYANNKESIDSAIAARVGDKIKDAGTAKPD
QEVVLSVDSNLPPPGPELNTARKEISDWYQDWNGVLSIISNSPTHIEVIE
SNFEDRTIEELYQFTEKEIEKIFKPIAVELADLDEDEDDEAEEAEENEEE
QPEEEEQENDEEPNRSKKRPLGETNYWCPVTLKTHKVLCPGNPEIAAKYL
GKIYYFSDEESREKFIQDPLQYLPIKHIPESPALRLIILGGKGSGKTTHG
RKIAQKLRLFHISFQEILQEFILPKNLKKIGPEYDEGPPVPDFILPDPAI
EELEGSADENAMKSESPGENATGDETAVEGEDNTKKQEIQIKDEIIEEWD
ENENAIKENLENQQALSTELLETLLKDFWNKQPFEMKGFVLEGFPRNAEE
AQFLAENKLFVDGVISLAATEDDIIARLLPPRLEKWKNRKALKDLYKRKL
TEYKAKKRQLKLDRRRKEILANLEEKRNKKYNTEKPVKNESDEDNEEEEE
EDEDLEEEVNVDDMLAEEFEEEEEEAEDDEEEDSEEDAREKIENEIREVF
DNDTNEISAVIESFTEMQIPRFEVEAGDKIPIVQYRLFKKLKKLLDRRES
VFERCYPVSPKNAEKLIKCGHKYLSRFGRWCPVSLLNEMGAFLPLVDENH
PIFPVIYRNYIYFTKSKQTRDLFMTNPLKYLKQPSPKDAVPIKVCILGLP
KSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGL
VVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRV
FELVSCPRELILRANKDRAGIELPFPMHDSSKIIAIKMANYSNNINEIRR
WYGEEHDNIRSIDAEKGTWYLWEKTKSDVKEQIFHIQNYLFDRREGKAAN
IYNLCIRPSEFKARLSDLKEYCPVSLSQTKELVHLNQDSDLHFAAEYRGY
YYKMKGEEELDIFYDNAEEILRTAFLPEHLPNKIDPNRIQDMFPMQLDLQ
GYCPVCFLDGKCRYEGLILGNKEKYVVEYRGKLYTFCGDGCVSNFMKIPS
KFWGLELPKKLPPVKNSLNIKSLPLPGYLEQTMADALRNALTATGTLKPK
YPFIDPSRSALLYIALHLKAYNPKSPEHLRRKYKHKLEEFENSCELIKYL
SDHMTLKYKEVEHRPMGFDKKMTEFLYLRKLEDNEDRWIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000850Adenylat/UMP-CMP_kin
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004550nucleoside diphosphate kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0019205nucleobase-containing compound kinase activity
GO:0019206nucleoside kinase activity
GO:0050145nucleoside phosphate kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0031965nuclear membrane
Vocabulary: biological process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0006174dADP phosphorylation
GO:0006186dGDP phosphorylation
GO:0006756AMP phosphorylation
GO:0006757ATP generation from ADP
GO:0009117nucleotide metabolic process
GO:0015949nucleobase-containing small molecule interconversion
GO:0016310phosphorylation
GO:0061508CDP phosphorylation
GO:0061565dAMP phosphorylation
GO:0061566CMP phosphorylation
GO:0061567dCMP phosphorylation
GO:0061568GDP phosphorylation
GO:0061569UDP phosphorylation
GO:0061570dCDP phosphorylation
GO:0061571TDP phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 996..1027
NoneNo IPR availableCOILSCoilCoilcoord: 1138..1158
NoneNo IPR availableCOILSCoilCoilcoord: 259..279
NoneNo IPR availableCOILSCoilCoilcoord: 1162..1202
NoneNo IPR availableCOILSCoilCoilcoord: 203..233
NoneNo IPR availableCOILSCoilCoilcoord: 777..811
NoneNo IPR availableCOILSCoilCoilcoord: 521..541
NoneNo IPR availableCOILSCoilCoilcoord: 1093..1113
NoneNo IPR availableCOILSCoilCoilcoord: 594..614
NoneNo IPR availablePFAMPF00406ADKcoord: 47..282
e-value: 4.3E-23
score: 82.1
NoneNo IPR availablePFAMPF00406ADKcoord: 1002..1091
e-value: 8.1E-7
score: 29.3
NoneNo IPR availablePFAMPF00406ADKcoord: 1346..1504
e-value: 1.5E-17
score: 64.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1330..1537
e-value: 1.4E-33
score: 118.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 958..986
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1141..1189
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..240
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1130..1189
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 785..810
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 785..820
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 7..25
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 211..229
NoneNo IPR availablePANTHERPTHR23359:SF148ADENYLATE KINASE 9coord: 821..947
coord: 32..501
NoneNo IPR availablePANTHERPTHR23359:SF148ADENYLATE KINASE 9coord: 1362..1763
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 41..181
e-value: 3.5
score: 8.1
coord: 882..1223
e-value: 9.5
score: 3.9
coord: 420..698
e-value: 1.8
score: 11.1
coord: 1340..1465
e-value: 12.0
score: 2.8
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 821..947
coord: 32..501
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 1362..1763
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 1343..1463
e-value: 2.7284E-20
score: 88.4478
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 45..290
e-value: 1.05775E-26
score: 106.937
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 883..1081
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 45..307
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 421..583
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1342..1525
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 421..676