Anaphase promoting complex subunit 4

Overview
NameAnaphase promoting complex subunit 4
Smed IDSMED30003506
Length (bp)2257
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Anaphase promoting complex subunit 4 (SMED30003506) t-SNE clustered cells

Violin plots show distribution of expression levels for Anaphase promoting complex subunit 4 (SMED30003506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Anaphase promoting complex subunit 4 (SMED30003506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Anaphase promoting complex subunit 4 (SMED30003506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003506h1SMcG0016930 dd_Smed_v4_4177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003506h1SMcG0016930 dd_Smed_v4_4177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003506h1SMcG0016930 dd_Smed_v4_4177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003506h1SMcG0016930 dd_Smed_v4_4177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Human
Match: ANAPC4 (anaphase promoting complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:19990])

HSP 1 Score: 95.1301 bits (235), Expect = 1.826e-19
Identity = 100/483 (20.70%), Postives = 212/483 (43.89%), Query Frame = 3
Query:   72 WSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQI----YKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFI 1469
            WSPK DLIAL +T G++ ++RL     +W         +++  + W PDG ++A    ++  I    +  P+SL+    + P++ + W++++ +  +  +     D  ++   K       Y N+      +  +E+++L     + + V G S  F+    Y + KI    R T          +S +  S+S V ++ + NG      F +  +L+   L +++ ++  F  +  L   +   +  + E+WE+ L   +  + ++ ++K      S++ + M ++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  EL  +  ++  YE   L    I E +    S + K  E   ++  ++ +   FF+W+   +    E+H L E N     T   ++ + +F+T          +    Y  +E + +Y+   ++DL+   N + N + +F+
Sbjct:   28 WSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIA---RVTGIAGTCLALCLSSDLKSLSVVTEV-STNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELN---KMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFL 501          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Human
Match: ANAPC4 (anaphase promoting complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:19990])

HSP 1 Score: 94.7449 bits (234), Expect = 2.539e-19
Identity = 100/483 (20.70%), Postives = 212/483 (43.89%), Query Frame = 3
Query:   72 WSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQI----YKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFI 1469
            WSPK DLIAL +T G++ ++RL     +W         +++  + W PDG ++A    ++  I    +  P+SL+    + P++ + W++++ +  +  +     D  ++   K       Y N+      +  +E+++L     + + V G S  F+    Y + KI    R T          +S +  S+S V ++ + NG      F +  +L+   L +++ ++  F  +  L   +   +  + E+WE+ L   +  + ++ ++K      S++ + M ++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  EL  +  ++  YE   L    I E +    S + K  E   ++  ++ +   FF+W+   +    E+H L E N     T   ++ + +F+T          +    Y  +E + +Y+   ++DL+   N + N + +F+
Sbjct:   28 WSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIA---RVTGIAGTCLALCLSSDLKSLSVVTEV-STNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELN--KVMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFL 502          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Human
Match: ANAPC4 (anaphase promoting complex subunit 4 [Source:HGNC Symbol;Acc:HGNC:19990])

HSP 1 Score: 55.0694 bits (131), Expect = 3.146e-8
Identity = 25/92 (27.17%), Postives = 50/92 (54.35%), Query Frame = 3
Query:   72 WSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLS 332
            WSPK DLIAL +T G++ ++RL     +W         +++  + W PDG ++A    ++  I    +  P+SL+    + P++ + W++++
Sbjct:   28 WSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVT 119          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Zebrafish
Match: anapc4 (anaphase promoting complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-041212-10])

HSP 1 Score: 90.5077 bits (223), Expect = 3.420e-18
Identity = 106/535 (19.81%), Postives = 231/535 (43.18%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIA--VGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYR-LQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIF--FLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKD---FFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVI 1616
            AW PK DLIAL +T G+L ++RL     +W +       ++I S+ W PDG ++A  VG ++  +        + L+    + P + + W+++ +D   L        +     P    + K+     +  +    L  +++ +IL+ V G S F      G+Y +  +      +          +S +  S+S + ++ + + +   R   ++  L+   L +++ ++  F  +  L   ++  +  + E+WE+ L   +  + ++ ++K       ++ + +E++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  E+  +  ++  ++   L  ++I + +    S   K  E   ++  ++ +   FF+W+   +    E+H+      +  T   L+ + DF++      +   D    Y  +E + +Y+   + DL+   N D N ++ F+         S  +KD    FP   +KSL   ++ L+  +ID +C      VI
Sbjct:   20 AWCPKRDLIALANTTGELLLHRLANFHRVWSLPPNENTGKEITSLAWRPDGKVLAFSVG-DTKQVVLCDAEKAEILHLFPVEYPASCMHWMEVQDDSSTLTSFSESEDESSRFLPKLPTLPKSE----EKSEEVTNLLGEVRLNILV-VGGPSGFVELYAYGLYKIATL------SGILGTCRSLGLSSDLKSLSVITEIRSTDDNPEIRYIQLDTGLLSSCLPELTKMARKFTHISTLLQYLRVSLTCMCEAWEEILMQMDLRLTKFVQEKN--TSTQVQDEFLELLLWGHASPELQALLMNQLTVKGLKMLGQSIDSSYSSIQKLVISHLQSGSEALLYHLSEVKGMALWKQKFQPLGLDPSDIEDAIVAVGSFTLKASELLQVIDKSMKNFKAFFRWLYVAMLRMSEDHVPPE--LNKMTQKDLAFVADFLSEHFSANEELFDRKGKYFNVERVGQYLKDEDEDLVSPPNMDGNQWVTFVKQ-------STHLKDSPLLFPTYPQKSL-HFVKRLMEASID-LCLQKPAAVI 529          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Zebrafish
Match: anapc4 (anaphase promoting complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-041212-10])

HSP 1 Score: 49.2914 bits (116), Expect = 6.478e-6
Identity = 28/96 (29.17%), Postives = 51/96 (53.12%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIA--VGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSND 338
            AW PK DLIAL +T G+L ++RL     +W +       ++I S+ W PDG ++A  VG ++  +        + L+    + P + + W+++ +D
Sbjct:   20 AWCPKRDLIALANTTGELLLHRLANFHRVWSLPPNENTGKEITSLAWRPDGKVLAFSVG-DTKQVVLCDAEKAEILHLFPVEYPASCMHWMEVQDD 114          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Xenopus
Match: carm1p1 (coactivator associated arginine methyltransferase 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-6072891])

HSP 1 Score: 102.449 bits (254), Expect = 7.060e-22
Identity = 112/516 (21.71%), Postives = 225/516 (43.60%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKD----IFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYISEND--LIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRML 1565
            AWSPK DLIAL +  G++ ++RL  I  +W +       +++  + W PDG I+A G  ++  +    +  P+SL+    + PI+ ++W+++  +      L   Y+ +D    + P    + KN    E   +I +LL      ++++G     I     G+Y +  I      +  Y       +S +  S+S V ++              N  L+   L +++ ++  F  +  L   +Q  +  + E+WE+ L   +  + ++ ++K      S++ + M+++L+G  + E    L   L++ G+K +  +V    S I      H+      LL+H  EL  +  ++  YE   L    I + +    S + K  E   ++   + +   FF+W+   +    E+H L E N     T   ++ + DF+T          ++   Y  +E + +Y+ + D  L+   N + N + +F+   +T    S  +  ++P   EKSL  + R +
Sbjct:   20 AWSPKRDLIALVNKAGEVLLHRLANIQRVWSLPPSENTGKEVTCLAWRPDGKILAFGLADTKKVVLCDVEKPESLHSFSLETPISCMQWMEVKVE---NSVLTSFYNAEDESNVLLPKLPALPKNE---EKSDEILKLLGDVRLNALVLGGDSGQIEIYAYGMYKIATI------SEVYGSCLGLCLSNDLKSLSVVTEL------------TTNSILLSDCLPEVTRMARKFTHISTLLQYLQLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMQLLLWGKASPELQALLMNQLTVKGLKKLGQSVESSYSTIQKLVISHLQSGAEALLYHLSELKGMALWKQKYEPLGLDAKAIEDAITAVGSFILKAHELLQVIDSGMKNFKAFFRWLYVAMLRMSEDHVLPELN---KMTQKDITFVADFLTEHFNEAPDLYNQKGKYFNVERVGQYLKDEDDILMSPPNTEGNQWFSFL-QSSTHLKESPLLFPYYP---EKSLHYVKRQM 502          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Xenopus
Match: carm1p1 (coactivator associated arginine methyltransferase 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-6072891])

HSP 1 Score: 102.449 bits (254), Expect = 8.760e-22
Identity = 112/516 (21.71%), Postives = 225/516 (43.60%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKD----IFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYISEND--LIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRML 1565
            AWSPK DLIAL +  G++ ++RL  I  +W +       +++  + W PDG I+A G  ++  +    +  P+SL+    + PI+ ++W+++  +      L   Y+ +D    + P    + KN    E   +I +LL      ++++G     I     G+Y +  I      +  Y       +S +  S+S V ++              N  L+   L +++ ++  F  +  L   +Q  +  + E+WE+ L   +  + ++ ++K      S++ + M+++L+G  + E    L   L++ G+K +  +V    S I      H+      LL+H  EL  +  ++  YE   L    I + +    S + K  E   ++   + +   FF+W+   +    E+H L E N     T   ++ + DF+T          ++   Y  +E + +Y+ + D  L+   N + N + +F+   +T    S  +  ++P   EKSL  + R +
Sbjct:   20 AWSPKRDLIALVNKAGEVLLHRLANIQRVWSLPPSENTGKEVTCLAWRPDGKILAFGLADTKKVVLCDVEKPESLHSFSLETPISCMQWMEVKVE---NSVLTSFYNAEDESNVLLPKLPALPKNE---EKSDEILKLLGDVRLNALVLGGDSGQIEIYAYGMYKIATI------SEVYGSCLGLCLSNDLKSLSVVTEL------------TTNSILLSDCLPEVTRMARKFTHISTLLQYLQLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMQLLLWGKASPELQALLMNQLTVKGLKKLGQSVESSYSTIQKLVISHLQSGAEALLYHLSELKGMALWKQKYEPLGLDAKAIEDAITAVGSFILKAHELLQVIDSGMKNFKAFFRWLYVAMLRMSEDHVLPELN---KMTQKDITFVADFLTEHFNEAPDLYNQKGKYFNVERVGQYLKDEDDILMSPPNTEGNQWFSFL-QSSTHLKESPLLFPYYP---EKSLHYVKRQM 502          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Xenopus
Match: carm1p1 (coactivator associated arginine methyltransferase 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-6072891])

HSP 1 Score: 98.2117 bits (243), Expect = 6.631e-21
Identity = 101/480 (21.04%), Postives = 209/480 (43.54%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKD----IFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI-ENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYISEND--LIISQNCDKNMFMNFI 1469
            AWSPK DLIAL +  G++ ++RL  I  +W +       +++  + W PDG I+A G  ++  +    +  P+SL+    + PI+ ++W+++  +      L   Y+ +D    + P    + KN    E   +I +LL      ++++G     I     G+Y +  I      +  Y       +S +  S+S V ++              N  L+   L +++ ++  F  +  L   +Q  +  + E+WE+ L   +  + ++ ++K      S++ + M+++L+G  + E    L   L++ G+K +  +V    S I      H+      LL+H  EL  +  ++  YE   L    I + +    S + K  E   ++   + +   FF+W+   +  + L +  L    T   ++ + DF+T          ++   Y  +E + +Y+ + D  L+   N + N + +F+
Sbjct:   20 AWSPKRDLIALVNKAGEVLLHRLANIQRVWSLPPSENTGKEVTCLAWRPDGKILAFGLADTKKVVLCDVEKPESLHSFSLETPISCMQWMEVKVE---NSVLTSFYNAEDESNVLLPKLPALPKNE---EKSDEILKLLGDVRLNALVLGGDSGQIEIYAYGMYKIATI------SEVYGSCLGLCLSNDLKSLSVVTEL------------TTNSILLSDCLPEVTRMARKFTHISTLLQYLQLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMQLLLWGKASPELQALLMNQLTVKGLKKLGQSVESSYSTIQKLVISHLQSGAEALLYHLSELKGMALWKQKYEPLGLDAKAIEDAITAVGSFILKAHELLQVIDSGMKNFKAFFRWLYVELWGDALIDILLLFQMTQKDITFVADFLTEHFNEAPDLYNQKGKYFNVERVGQYLKDEDDILMSPPNTEGNQWFSFL 473          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Xenopus
Match: carm1p1 (coactivator associated arginine methyltransferase 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-6072891])

HSP 1 Score: 97.0561 bits (240), Expect = 4.537e-20
Identity = 110/520 (21.15%), Postives = 225/520 (43.27%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKD----IFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFV----INCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYISEND--LIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRML 1565
            AWSPK DLIAL +  G++ ++RL  I  +W +       +++  + W PDG I+A G  ++  +    +  P+SL+    + PI+ ++W+++  +      L   Y+ +D    + P    + KN    E   +I +LL      ++++G     I     G+Y +  I+               +  Y+ D +            +  R F+    ++  L+   L +++ ++  F  +  L   +Q  +  + E+WE+ L   +  + ++ ++K      S++ + M+++L+G  + E    L   L++ G+K +  +V    S I      H+      LL+H  EL  +  ++  YE   L    I + +    S + K  E   ++   + +   FF+W+   +    E+H L E N     T   ++ + DF+T          ++   Y  +E + +Y+ + D  L+   N + N + +F+   +T    S  +  ++P   EKSL  + R +
Sbjct:   20 AWSPKRDLIALVNKAGEVLLHRLANIQRVWSLPPSENTGKEVTCLAWRPDGKILAFGLADTKKVVLCDVEKPESLHSFSLETPISCMQWMEVKVE---NSVLTSFYNAEDESNVLLPKLPALPKNE---EKSDEILKLLGDVRLNALVLGGDSGQIEIYAYGMYKIATIS------------EFVACCYSRDLL---------RATKPLRGFLPQILLDTSLLSDCLPEVTRMARKFTHISTLLQYLQLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMQLLLWGKASPELQALLMNQLTVKGLKKLGQSVESSYSTIQKLVISHLQSGAEALLYHLSELKGMALWKQKYEPLGLDAKAIEDAITAVGSFILKAHELLQVIDSGMKNFKAFFRWLYVAMLRMSEDHVLPELN---KMTQKDITFVADFLTEHFNEAPDLYNQKGKYFNVERVGQYLKDEDDILMSPPNTEGNQWFSFL-QSSTHLKESPLLFPYYP---EKSLHYVKRQM 503          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Xenopus
Match: carm1p1 (coactivator associated arginine methyltransferase 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-6072891])

HSP 1 Score: 66.2402 bits (160), Expect = 1.274e-10
Identity = 88/441 (19.95%), Postives = 178/441 (40.36%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKD----IFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHC 1364
            AWSPK DLIAL +  G++ ++RL  I  +W +       +++  + W PDG I+A G  ++  +    +  P+SL+    + PI+ ++W+++  +      L   Y+ +D    + P    + KN +                  ++++G     I     G+Y +  I      +  Y       +S +  S+S V ++              N  L+   L +++ ++  F  +  L   +Q  +  + E+WE+ L   +  + ++ +     R   ++   ++ +     + E    L   L++ G+K +  +V    S I      H+      LL+H  EL  +  ++  YE   L    + +             E  IL+S      N +F ++ +    HL E+ L   + Y + S  + +V  ++  V  HC
Sbjct:   20 AWSPKRDLIALVNKAGEVLLHRLANIQRVWSLPPSENTGKEVTCLAWRPDGKILAFGLADTKKVVLCDVEKPESLHSFSLETPISCMQWMEVKVE---NSVLTSFYNAEDESNVLLPKLPALPKNHLLLLTFAHFCSFRLN----ALVLGGDSGQIEIYAYGMYKIATI------SEVYGSCLGLCLSNDLKSLSVVTEL------------TTNSILLSDCLPEVTRMARKFTHISTLLQYLQLSLTCMCEAWEEILMQMDSRLTKFVQVGIG-RFLEIKISNLKFVY----HPELQALLMNQLTVKGLKKLGQSVESSYSTIQKLVISHLQSGAEALLYHLSELKGMALWKQKYEPLGLDAKYLKD-------------EDDILMSPPNTEGNQWFSFLQSS--THLKESPLLFPY-YPEKS--LHYVKRQMEAVIDHC 412          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Mouse
Match: Anapc4 (anaphase promoting complex subunit 4 [Source:MGI Symbol;Acc:MGI:1098673])

HSP 1 Score: 93.9745 bits (232), Expect = 3.240e-19
Identity = 103/507 (20.32%), Postives = 213/507 (42.01%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMG-------VKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIK 1529
            AWSPK DLIAL +T G++ ++RL     +W         +++  + W PDG ++A    ++  I    +  P+SL+    + P++ + W +++ +      L   Y+ +D   L            +            +   L+G       V G S  F+    Y + KI    R T          +S +  S+S V ++ +  G+     F +  +L+   L +++ ++  F  +  L   +   +  + E+WE+ L   +  + ++ ++K      S++ + M ++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  EL  +  ++  YE   L    I + +    S + K  E   ++  ++ +   FF+W+   +    E+H L E N     T   ++ + +F+T          +    Y  +E + +Y+   ++DL+   N + N + +F+   +T    S  +  ++P K
Sbjct:   27 AWSPKRDLIALANTTGEVLLHRLASFHRVWSFPPNESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSFSVEAPVSCMHWTEVTVE---SSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIA---RVTGIAGTCIALCLSSDLKSLSVVTEV-SSGGESEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKPTTT--SVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELN---KMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFL-QNSTHLKESPLLFPYYPRK 520          
BLAST of Anaphase promoting complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q9UJX5|APC4_HUMAN (Anaphase-promoting complex subunit 4 OS=Homo sapiens OX=9606 GN=ANAPC4 PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 8.770e-19
Identity = 100/483 (20.70%), Postives = 212/483 (43.89%), Query Frame = 3
Query:   72 WSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQI----YKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFI 1469
            WSPK DLIAL +T G++ ++RL     +W         +++  + W PDG ++A    ++  I    +  P+SL+    + P++ + W++++ +  +  +     D  ++   K       Y N+      +  +E+++L     + + V G S  F+    Y + KI    R T          +S +  S+S V ++ + NG      F +  +L+   L +++ ++  F  +  L   +   +  + E+WE+ L   +  + ++ ++K      S++ + M ++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  EL  +  ++  YE   L    I E +    S + K  E   ++  ++ +   FF+W+   +    E+H L E N     T   ++ + +F+T          +    Y  +E + +Y+   ++DL+   N + N + +F+
Sbjct:   28 WSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIA---RVTGIAGTCLALCLSSDLKSLSVVTEV-STNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELN---KMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFL 501          
BLAST of Anaphase promoting complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q91W96|APC4_MOUSE (Anaphase-promoting complex subunit 4 OS=Mus musculus OX=10090 GN=Anapc4 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.266e-18
Identity = 103/507 (20.32%), Postives = 213/507 (42.01%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMG-------VKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIK 1529
            AWSPK DLIAL +T G++ ++RL     +W         +++  + W PDG ++A    ++  I    +  P+SL+    + P++ + W +++ +      L   Y+ +D   L            +            +   L+G       V G S  F+    Y + KI    R T          +S +  S+S V ++ +  G+     F +  +L+   L +++ ++  F  +  L   +   +  + E+WE+ L   +  + ++ ++K      S++ + M ++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  EL  +  ++  YE   L    I + +    S + K  E   ++  ++ +   FF+W+   +    E+H L E N     T   ++ + +F+T          +    Y  +E + +Y+   ++DL+   N + N + +F+   +T    S  +  ++P K
Sbjct:   27 AWSPKRDLIALANTTGEVLLHRLASFHRVWSFPPNESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSFSVEAPVSCMHWTEVTVE---SSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIA---RVTGIAGTCIALCLSSDLKSLSVVTEV-SSGGESEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKPTTT--SVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELN---KMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFL-QNSTHLKESPLLFPYYPRK 520          
BLAST of Anaphase promoting complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q5RAQ5|APC4_PONAB (Anaphase-promoting complex subunit 4 OS=Pongo abelii OX=9601 GN=ANAPC4 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.586e-18
Identity = 100/486 (20.58%), Postives = 203/486 (41.77%), Query Frame = 3
Query:   72 WSPKLDLIALGSTNGDLCIYRLQMI-LIWKITI---KNEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMG-------VKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENH-LNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFI 1469
            WSPK DLIAL +T G++ ++RL     +W         +++  + W PDG ++A    ++  I    +  P SL+    + P++ + W++++ +      L   Y+ +D   L                         +   L+G       V G S  F+    Y + KI    R T          +S +  S+S V ++ + NG      F +  +L+   L +++ ++  F  +  L   +   +  + E+WE+ L   +  + ++ ++K      S++ + M ++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  EL  +  ++  YE   L    I E +    S + K  E   ++  ++ +   FF+W+   +    E+H L E N     T   ++ + +F+T          +    Y  +E + +Y+   ++DL+   N + N + +F+
Sbjct:   28 WSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPGSLHSFSVEAPVSCMHWMEVTVE---SSVLTSFYNAEDESNLLLPKLPTLPKNYSSTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIA---RVTGIAGTCLALCLSSDLKSLSVVTEV-STNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTT--SVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGLASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELN---KMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFL 501          
BLAST of Anaphase promoting complex subunit 4 vs. UniProt/SwissProt
Match: sp|O65418|APC4_ARATH (Anaphase-promoting complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=APC4 PE=2 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 5.506e-6
Identity = 27/94 (28.72%), Postives = 49/94 (52.13%), Query Frame = 3
Query:    3 MNEFIFDNYED---FRINYK-----NMNISAWSPKLDLIALGSTNGDLCIYRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSI 260
            M+E   D  E+   F++ +       + I+ W+P+ DL+A+ + +  + ++R     +W I+   + + S+CW PDG  IAVG E G I    +
Sbjct:    1 MSEMASDEEENIIPFQLQFDKPIPFQIKIAEWNPEKDLLAMVTEDSKILLHRFNWQRLWTIS-PGKPVTSLCWRPDGKAIAVGLEDGTISLHDV 93          
BLAST of Anaphase promoting complex subunit 4 vs. TrEMBL
Match: A0A0V0J6M7 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR160901 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.835e-35
Identity = 114/482 (23.65%), Postives = 240/482 (49.79%), Query Frame = 3
Query:    3 MNEFIFDNYEDFRINYKNMNISAWSPKLDLIALGSTNGDLCIYRLQMILIWKI-TIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKE--QIYKNSV--YXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHAS-ISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIR-DWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWI------SNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYI 1409
            M EF    +E+  ++   + +++WSPK+D+IALGS NG L ++R +M L W++ + +   +  + W P+G +IA  +E+  IQ F+++    ++ + FD+PI+ L+W++   D     T N P+   D FP  +   I+ + V  +++  +  +  L    K S+L+      I     G+Y + +++     T+S+++ +  S ++ +  S+ ++    ++N     +   ++   +      +  +S     L++ + ++   +K+++ +WE+ L   +  +  Y+R++ H    WSLR +L+E+ILFG  +  F   L    +   ++    T+ K    +       + + L++L+F   E     + +  Y  FN+S+  I  L++   + L K  E  +++     +L  FF+W+      S  I++  N   +    T  +  +I++FVT KLR +     E+ +Y+IE++ +YI
Sbjct:   11 MVEFCVTLFEEKALSKTKVRVASWSPKIDIIALGSPNGTLSLHRYKMSLTWEVHSPELGAVTQLAWQPNGKVIAAAYETQKIQMFNLSDGSLIHHLTFDKPISDLRWIEC--DPPSGRTTNLPHS-SDYFPPFDALAIFADEVSNHQKVFQLSKTFLDPDSKLSVLLVYLDGCIRLFGCGVYEIARVD-----TNSFNRTFLQSFLAADLSSLYHLTTTTDKNSCLELQLHKLDTRPLSTLRRPLKHLSFHISALLHCKQILLWSLKQLKNAWENTLLELDTKLTAYARERLHASASWSLRNELLEIILFGHISSAFQKFLATEWTSNSIRRAGVTMLKAYESMKAITFQQLQFGLMRLIFEASEFLGFARNRYHYHLFNISETTILHLIRDAGATLQKAQELHLVVEHCSQYLRPFFKWLYGVAVTSTKIDSDKNAQKI----TSQERDLIINFVTEKLRPLIVD-GELKSYQIELVEQYI 479          
BLAST of Anaphase promoting complex subunit 4 vs. TrEMBL
Match: A0A0X3Q182 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR160901 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.665e-34
Identity = 112/480 (23.33%), Postives = 238/480 (49.58%), Query Frame = 3
Query:    3 MNEFIFDNYEDFRINYKNMNISAWSPKLDLIALGSTNGDLCIYRLQMILIWKI-TIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKE--QIYKNSV--YXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHAS-ISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHI-RDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWI------SNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHE 1403
            M EF    +E+  ++   + +++WSPK+D+IALGS NG L ++R +M L W++ + +   +  + W P+G +IA  +E+  IQ F+++    ++ + FD+PI+ L+W++   D     T N P+   D FP  +   I+ + V  +++  +  +  L    K S+L+      I     G+Y + +++     T+S+++ +  S ++ +  S+ ++    ++N     +   ++   +      +  +S     L++ + ++   +K+++ +WE+ L   +  +  Y+R++ H    WSLR +L+E+ILFG  +  F   L    +   ++    T+ K    +       + + L++L+F   E     + +  Y  FN+S+  I  L++   + L K  E  +++     +L  FF+W+      S  I++  N   +    T  +  +I++FVT KLR +     E+ +Y+IE++ +
Sbjct:   11 MVEFCVTLFEEKALSKTKVRVASWSPKIDIIALGSPNGTLSLHRYKMSLTWEVHSPELGAVTQLAWQPNGKVIAAAYETQKIQMFNLSDGSLIHHLTFDKPISDLRWIEC--DPPSGRTTNLPHS-SDYFPPFDALAIFADEVSNHQKVFQLSKTFLDPDSKLSVLLVYLDGCIRLFGCGVYEIARVD-----TNSFNRTFLQSFLAADLSSLYHLTTTTDKNSCLELQLHKLDTRPLSTLRRPLKHLSFHISALLHCKQILLWSLKQLKNAWENTLLELDTKLTAYARERLHASASWSLRNELLEIILFGHISSAFQKFLATEWTSNSIRRAGVTMLKAYESMKAITFQQLQFGLMRLIFEASEFLGFARNRYHYHLFNISETTILHLIRDAGATLQKAQELHLVVEHCSQYLRPFFKWLYGVAVTSTKIDSDKNAQKI----TSQERDLIINFVTEKLRPLIVD-GELKSYQIELVEQ 477          
BLAST of Anaphase promoting complex subunit 4 vs. TrEMBL
Match: A0A158QVJ7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8043 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.578e-32
Identity = 128/575 (22.26%), Postives = 261/575 (45.39%), Query Frame = 3
Query:    9 EFIFDNYEDFRINYKNMNISAWSPKLDLIALGSTNGDLCIYRLQMILIWKITIKNEQ-ILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKF-DEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAF-----RTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIR-DWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWI------SNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLII-----------SQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTI 1658
            EFI   YE+  I    ++++ WSPK+D+IA+GS NG + ++R ++ L W++   +   +  + W PDG +IA  +E G + + ++     L  ++F D  I  L WV   N   L+++   P++   +F   + ++ N    E  +  +  L      S+L+      +     G+     + L    TS   K+  + ++ +     Y     +++G   F     R  V +C  +R   L +++       L++ + L+   +K+++ +WED L   +  +  YSR++     +WSLR +L+E+ILFG  + +  I L+   +   ++     + K    + +     + Y L++L+    EL    + +  Y  F ++++ + EL++   S L K +E  +++     +L  FF+W+      S+G +    ++N     T ++  +I+ FV+ +LR +     E+ +Y+IE++ +YI    +             S++ ++    + I +P      S     F P     SL+ +I ++L   IDK+  +     +      A   PV +
Sbjct:    4 EFITTLYEERPIAKSKVSVAVWSPKMDIIAIGSPNGMVSLHRYKLGLTWEVRSPHPGGVTHLAWRPDGKVIAAAYEFGRLHFLNLLDGSLLRVLEFNDATIQDLVWVSCGNAAPLKQSFFPPFESLSVF--SDDLFSNR--HEVTQLSKPWLDPDSSPSVLVVYFDDIVRLFGCGVCEFASLKLPHETTSRQTKVCDSFVTKDMSYHCYF--ALSKDGLLNFNKISSRRLVEHCLPLRNLSLHVAS-------LLHSKQLLLWSVKQLKNAWEDTLLELDAKLTAYSRERLRTSPNWSLRNELLEVILFGHVSPQLQIFLKAEWTPAAIRRAGIAMFKAYDTMKSITFQQLQYGLMQLICEASELLGCARDKQAYGCFGITEDAVVELIRDAGSTLQKTLELHMIVDHCSHYLRPFFKWLYGVAVSSDGTKPTSEKSN--RKVTPTERDLIITFVSEQLRPIFIQ-GELKSYQIELVEQYIRTGGVTRPLEEVFGITAESEHFNRAKLRDIIPLPGGALAESVPEGVFTPTN--ASLADLIEVVLIGHIDKMAASGREQSLPGDFFDAAETPVPL 560          
BLAST of Anaphase promoting complex subunit 4 vs. TrEMBL
Match: A0A068Y6B2 (Anaphase promoting complex subunit 4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000759300 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.136e-32
Identity = 122/567 (21.52%), Postives = 266/567 (46.91%), Query Frame = 3
Query:    9 EFIFDNYEDFRINYKNMNISAWSPKLDLIALGSTNGDLCIYRLQMILIWKI-TIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEP-INYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLE-DRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKK-QHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYS--QLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDL-----------IISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVC--WNHENTVIKYHTDPAGSYPV 1652
            E+    YE+  I    ++I++WSPK+D+IA+GS +G + ++R +M + W++ +  +  +  + W PDG +++V +E G +++ ++    +L+ ++F    I +L WV   ++   ++T+  P++   IF   + ++ N      + K       K    +++  +  ++ F   G Y L  + L  D R+      Y   ++ +F S +Y    ++           I    + +  L +  IS     L++ + L++  +K++  +WE+ L   +  +  YSR++ +    WSLR +L+E+ILFG  + +     +   +   ++     + K    +       + Y L++L+    EL   ++ +   E F L++  + +L++T  S L K ++  ++++    +L  FFQW      +   ET+       S  + ++I+ FV+ +LR       ++ +Y+IE++ +YI                  S+N  +    + I +P TDF+  +F +  F +    SL+ +I + L + IDK+      +++  +  ++P    P+
Sbjct:    4 EYTTTVYEEKPIAKGKVSIASWSPKMDIIAIGSPSGIVSLHRYKMGINWEVHSSDSGGVTYLAWRPDGKVLSVAYECGRLKFLNLLDGSALHSMEFGTAVIRHLTWVSCEHNVTTKQTIFPPFESLSIF--TDDLFSNRQEVSQLSKPWLDPDSKPSV-LIVHFEDNTVRFYGCGFYELASLKLPVDCRS------YECIMAQDFTSFAY----FSLTPQGLLTLNKIPSRALGERCLPMRNISFHIAALLHCKQLLEWSLKQLRNAWENTLLELDTKLTSYSRERLRSSSTWSLRNELLEIILFGYVSPQLREFFQRDWTPVAIRRAGIAMFKAYGSMKAITFQQLQYGLMRLICEASELLGCVRDRQICECFGLTEKVVIDLIRTAGSTLQKTLDLHLIVNHCSQYLRPFFQWFYGVALSGTKETSEKADIKVSPTERNLIITFVSERLRPFFVD-GQLKSYQIELVEQYIRTGGTTKPVDELLGIQTTSENYKRAKLKDIIPLP-TDFETKYFPEGIF-VTTNASLADLIEVQLAERIDKLAAFGGEQSSPSELFSEPERPVPL 554          
BLAST of Anaphase promoting complex subunit 4 vs. TrEMBL
Match: A0A5K3F2D2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 9.180e-32
Identity = 128/571 (22.42%), Postives = 257/571 (45.01%), Query Frame = 3
Query:    9 EFIFDNYEDFRINYKNMNISAWSPKLDLIALGSTNGDLCIYRLQMILIWKITIKNEQ-ILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKF-DEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTF-VINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIR-DWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWI------SNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLII-----------SQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTI 1658
            EFI   YE+  I    ++++ WSPK+D+IA+GS NG + ++R ++ L W++   +   +  + W PDG +IA  +E G + + ++     L  ++F D  I  L WV   N   L+++   P++   +F   + ++ N    E  +  +  L      S+L+      +     G+     + L    TS   K +    S+    +SY    Y          F  I+   + ++ L +  +S     L++ + L+   +K+++ +WED L   +  +  YSR++     +WSLR +L+E+ILFG  + +  I L+   +   ++     + K    + +     + Y L++L+    EL    + +  Y  F ++++ + EL++   S L K +E  +++     +L  FF+W+      S+G +    ++N     T ++  +I+ FV+ +LR +     E+ +Y+IE++ +YI    +             S++ ++    + I +P      S     F P     SL+ +I ++L   IDK+  +     +      A   PV +
Sbjct:    4 EFITTLYEERPIAKSKVSVAVWSPKMDIIAIGSPNGMVSLHRYKLGLTWEVRSPHPGGVTHLAWRPDGKVIAAAYEFGRLHFLNLLDGSLLRVLEFNDATIQDLVWVSCGNAAPLKQSFFPPFESLSVF--SDDLFSNR--HEVTQLSKPWLDPDSSPSVLVVYFDDIVRLFGCGVCEFASLKLPHETTSRQTK-FQVCDSFVTKDMSY--HCYFALSKDGLLNFNKISSRRLVEHCLPLRNLSLHVASLLHSKQLLLWSVKQLKNAWEDTLLELDAKLTAYSRERLRTSPNWSLRNELLEVILFGHVSPQLQIFLKAEWTPAAIRRAGIAMFKAYDTMKSITFQQLQYGLMQLICEASELLGCARDKQAYGCFGITEDAVVELIRDAGSTLQKTLELHMIVDHCSHYLRPFFKWLYGVAVSSDGTKPTSEKSN--RKVTPTERDLIITFVSEQLRPIFIQ-GELKSYQIELVEQYIRTGGVTRPLEEVFGITAESEHFNRAKLRDIIPLPGGALAESVPEGVFTPTN--ASLADLIEVVLIGHIDKMAASGREQSLPGDFFDAAETPVPL 562          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Cavefish
Match: anapc4 (anaphase promoting complex subunit 4 [Source:NCBI gene;Acc:103036806])

HSP 1 Score: 92.0485 bits (227), Expect = 9.375e-19
Identity = 111/548 (20.26%), Postives = 238/548 (43.43%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQ-MILIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIF----PLKEQIYKNS--VYXXXXXXXXXXXXXXXXFSILMGVKGMSIF--FLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPV 1652
            AWSPK DLIAL +T G+L ++RL     +W +       ++I S+ W PDG I+A    ++  +        + L+    D P++ + W+++ +D  +  +     D  + F    P+  + Y ++  ++ E+       L   ++ +IL+ V G S F      G+Y +  +N       S        +S +  S+S + ++ +   +       ++  L+   L +++ ++  F  +  L   ++  +  + E+WED L   +  + ++ ++K    +  ++ + +E++L+G  + E    L   L++ G+K +  ++    S I      H+      LL++  E+  +  ++  ++   L    I + +    S   K  E   ++  ++ +   FF+W+   +    E+H+      +  T   L+ + DF++      +   D    Y  +E + +Y+   + DL+   N D N ++ F+   +T    S  +   FP   +KSL   ++ ++  TID +C      VI      A   P+
Sbjct:   20 AWSPKRDLIALVNTAGELLLHRLANFQRVWNLPPSENTGKEITSLAWRPDGKILAFSLGDTKQVVLCDAEKAEILHLFTVDYPVSCMHWMEVQSDSSVSSSFTDSEDESNRFLPKLPILPKSYSSTSKIFSEEKSDEVTNLLGDVRLNILV-VGGQSGFVELYAYGLYKIATLNTITGVCRSL------CLSGDLKSLSIITEVRSPEDNAEIHYVQLDTGLLSSCLPELTRMARKFTHISTLIQYLRLSLTCMCEAWEDILMQMDLRLTKFVQEKN--TNTQVQDEFLELLLWGHASPELQALLMNQLTVKGLKMLGQSIESSYSSIQKLVISHLQSGSEALLYYLSEVKGMALWKQKFQPLGLDPTAIEDAITAVGSFTLKASELLQVIDKSMKNFKAFFRWLYVAMLRMSEDHVPPE--LNKMTQRDLAFVADFLSEHFSANEELFDRKGKYFNVERVGQYLKDEDEDLVSPPNMDGNHWVTFVQQ-STHLKESPLL---FPTYPQKSL-HFVKRMMESTID-ICLQKPAGVIGGSVKQAVRLPL 550          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Cavefish
Match: anapc4 (anaphase promoting complex subunit 4 [Source:NCBI gene;Acc:103036806])

HSP 1 Score: 82.8037 bits (203), Expect = 7.093e-16
Identity = 107/544 (19.67%), Postives = 237/544 (43.57%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQ-MILIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIF----PLKEQIYKNS--VYXXXXXXXXXXXXXXXXFSILMGVKGMSIF--FLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCC-----NKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGI----ENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYIS--ENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHT 1628
            AWSPK DLIAL +T G+L ++RL     +W +       ++I S+ W PDG I+A    ++  +        + L+    D P++ + W+++ +D  +  +     D  + F    P+  + Y ++  ++ E+       L   ++ +IL+ V G S F      G+Y +  +N       S        +S +  S+S + ++ +   +       ++  L+   L +++ ++  F  +  L   ++  +  + E+WED L   +  + ++ ++K    +  ++ + +E++L+G        K+ +IT        G+K +  ++    S I      H+      LL++  E+  +  ++  ++   L    I + +    S   K  E   ++  ++ +   FF+W+   +    E+H+      +  T   L+ + DF++      +    +   + +E + +Y+   + DL+   N D N ++ F+   +T    S  +   FP   +KSL   ++ ++  TID +C       ++Y+T
Sbjct:   20 AWSPKRDLIALVNTAGELLLHRLANFQRVWNLPPSENTGKEITSLAWRPDGKILAFSLGDTKQVVLCDAEKAEILHLFTVDYPVSCMHWMEVQSDSSVSSSFTDSEDESNRFLPKLPILPKSYSSTSKIFSEEKSDEVTNLLGDVRLNILV-VGGQSGFVELYAYGLYKIATLNTITGVCRSL------CLSGDLKSLSIITEVRSPEDNAEIHYVQLDTGLLSSCLPELTRMARKFTHISTLIQYLRLSLTCMCEAWEDILMQMDLRLTKFVQEKN--TNTQVQDEFLELLLWGHARYVLFTKQIYIT-------SGLKMLGQSIESSYSSIQKLVISHLQSGSEALLYYLSEVKGMALWKQKFQPLGLDPTAIEDAITAVGSFTLKASELLQVIDKSMKNFKAFFRWLYVAMLRMSEDHVPPE--LNKMTQRDLAFVADFLSEHFSNEELFDRKGKYFNVERVGQYLKDEDEDLVSPPNMDGNHWVTFVQQ-STHLKESPLL---FPTYPQKSL-HFVKRMMESTID-ICLQKPAVSLEYNT 539          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Sea Lamprey
Match: anapc4 (anaphase promoting complex subunit 4 [Source:ZFIN;Acc:ZDB-GENE-041212-10])

HSP 1 Score: 77.7962 bits (190), Expect = 3.650e-15
Identity = 99/491 (20.16%), Postives = 215/491 (43.79%), Query Frame = 3
Query:   72 WSPKLDLIALGSTNGDLCIYRLQMIL-IWKITIKNE---QILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIF----PLKEQIYK--NSVYXXXXXXXXXXXXXXXXFSIL-MGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVI---NCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIA---------YKIEMLHEYISENDLIISQNCDKNMFMNFID 1472
            WSPK DLI L S +G++ ++RL     +W +   +    ++ ++ W PDG ++AV + ++  +    +   + L+  +    I  + WV++  D   +  LN   D   ++    P   + Y   N V   +     + L    + +IL +G     + F   GI+ +  + ++     S  +  H  +S +  ++S  ++      D++    +    +  L+  NL +++ ++  F  +  L       ++ +  +WED L   + G+  + +  Q   D S+  + ME++L+G  + E  + L   L+L G+K +   V      I+     H+      LL+H +EL  +  ++  Y    L ++ + E +Q   S + K  E   ++ +++ +   FF+ +   + +  +ET        SQ  ++  FV N L   K H ++            + ++ + +Y+ +  L+  Q+   N ++NF++
Sbjct:   22 WSPKRDLIGLASRSGEVLLHRLSNCQKVWGLPPNDSTGSEVTALAWRPDGKVLAVSYGDTERLVLCDVEKAEILHTCRALHRITCMHWVEVKQDSSPE--LNSFEDDHTVYLSKLPALPKRYLSFNRVQLIEENSDIQRLLGDSRLNILVLGSCHGVVAFYAFGIFKIASLLIK-----SEGQCLHLCLSSDLKALSVAVK-KTSTLDESHCNIIYSQWDTSLLAANLPEVTKMARKFTHISALLHYQYLTVQSMSGAWEDVLIEMDMGLTNFVKASQENPDTSVSNEFMELLLWGTASPELQMLLLNKLTLKGLKKLGHEVESSYYSILKLLTSHLQSGADALLYHLVELKGMAMWRQKYGCLGLREDSVEEAIQIVGSYMLKADELLHVIENSLKNFKSFFRCLYVAMLHMSDETIPPELSKVSQKELM--FVANFL---KDHFEKKEPTLFEKKGKFFNVDRVGQYLKDELLLTPQDMKHNSWVNFVE 499          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Nematostella
Match: EDO32809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU03])

HSP 1 Score: 100.523 bits (249), Expect = 3.478e-22
Identity = 101/483 (20.91%), Postives = 216/483 (44.72%), Query Frame = 3
Query:   72 WSPKLDLIALGSTNGDLCIYRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSND--------YRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSIL-MGVKGMSIFFLPRGIYNLGKINLEDRRTSSYD-KIYHASISYNFDSISYVIQMYNENGDQ----AFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIM--DFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFID 1472
            WSPK+DL+A+ +  GD+ + RL    +W ++  NE+ + + W PDGN++ VG+ESG I+ F I   + ++          ++W +            Y  Q  L  P  +  +      ++    + E  K  ++L  L  K SIL +G     +  +  G++  G + +E+   S++  +I +A+ S + + ++ +++     G      A+ T +++    R  L  I+  S I   L+       + ++ + E+WED L   E  +  Y   +Q +  +S+  + + ++  G  + E    L   L+  G+K +   +    + I +    H+      LL+H  ++  + ++ + +    LS+      +++  + + K  E   ++  ++     FFQW+ + I    +E    +   +SQ  I++  +F+  +L     + DE   ++IE + +Y  +  L +  +   N F  F++
Sbjct:   25 WSPKMDLLAVITAEGDVWLNRLSWQQVWAVSAGNEKAVCLAWRPDGNLLCVGYESGEIKSFDIENAECVHKCSIGNTPTCMEWTEEVKSSAPRKPSFYIEQSQLYLP-SLPFLPKSGGAVFSKESHDEGNKDRKKLSSLPDKLSILTVGDVSGHVHIMLYGMFLAGVLPIENDIESTHGVEIVNAAFSADLELLNVIVKAKQITGATYSLLAYTTTLLSSH--RHELSLIAKKSGIVTSLLE---YFNETIRSMSEAWEDILLEMETKLTAY-MNEQKMPKFSITNEFLTLLTKGILSPELQNFLLHDLTEKGLKKLGVNIDNSYTSIQSLALKHLQCVTEALLYHMTDIRGMARWYNLFGVLGLSEKSTDVAIKSLGAVMLKNTELVEVIETSLKSFKAFFQWLYSIILRLSDEPVPSYVKKFSQQDILLLANFLKTQL-----NTDEHGKFRIERVGQYFEDKPLTVLSSFGDNAFAKFVE 495          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Medaka
Match: anapc4 (anaphase promoting complex subunit 4 [Source:NCBI gene;Acc:101154933])

HSP 1 Score: 79.337 bits (194), Expect = 8.462e-15
Identity = 104/547 (19.01%), Postives = 226/547 (41.32%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIF----PLKEQIYKNS--VYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNE--TNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAY-KIEMLHEYIS--ENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKD---FFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPV 1652
            AWSPK DLIAL +T G+L ++RL     +W +       ++I ++ W PDG  +A    ++  I    +   + L+       +  + W+++ ++     +     D   +F    P   + Y  +  ++ E+       L    + ++L  V G    F+    Y + KI   D  T +   +    +S +  S+S + ++ + + +       ++  L+   L +++ ++  F  +  L   +   +  + E+WED L   +  + ++ ++K       ++ + +E++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  E+  +  ++  +E   L    I   +    S   K  E   ++  ++ +   FF+W+   +    +E      +  T   ++ + DF++      +   D    Y  +E + +Y+   + DL+   N   N ++ F++        S  +K+    FP   +KSL  + RM+  + + + C      VI      A   P+
Sbjct:   20 AWSPKRDLIALANTAGELLLHRLASFQRVWSLPPTERTGKEITALAWRPDGKTLAFSLGDTKQIVLCGVEKAEILHVFPVQSAVTCMHWMEVVDESSSLSSFYSSEDESKLFLPKIPTLPKSYSTTSKIFSEEKSDEILNLLGDARLNVL--VLGGDSGFVELYAYGMYKIAAVDGVTGTCRNL---CLSSDLRSLSVIAEVRSADNNPEICYIQLDTGLLSDCLPEVTRMALKFTFISTLLQYLHLSLTCMCEAWEDILMQMDLRLTKFVQEKN--TSTQVQDEFLELLLWGQSSPELQALLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSEALLYHLSEVRGMSLWRQKFEPLGLDSAAIEGAITAVGSFSLKANELLQVIDKSMKNFKAFFRWLYVAMLRMCDEHVPPELNKMTQKDIAFVADFLSEHFSENEELFDRKGKYFNVERVGQYLKDEDEDLMSPPNTKGNQWLKFLEE-------SSHLKESPLLFPSYPQKSLHFVKRMM--EGVIQHCLQKPAEVIGKSVKQAAFVPL 550          
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Medaka
Match: anapc4 (anaphase promoting complex subunit 4 [Source:NCBI gene;Acc:101154933])

HSP 1 Score: 77.411 bits (189), Expect = 2.878e-14
Identity = 104/545 (19.08%), Postives = 219/545 (40.18%), Query Frame = 3
Query:   69 AWSPKLDLIALGSTNGDLCIYRLQMI-LIWKITIK---NEQILSICWHPDGNIIAVGF-ESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNE--TNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYK-----IEMLHEYIS--ENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKD---FFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPV 1652
            AWSPK DLIAL +T G+L ++RL     +W +       ++I ++ W PDG  +A    ++  I    +   + L+       +  + W+++ ++     +     D   +F  K      S  K D               +L G  G    +     Y + KI   D  T +   +    +S +  S+S + ++ + + +       ++  L+   L +++ ++  F  +  L   +   +  + E+WED L   +  + ++ ++K       ++ + +E++L+G  + E    L   L++ G+K +  ++    S I      H+      LL+H  E+  +  ++  +E   L    I   +    S   K  E   ++  ++ +   FF+W+   +    +E      +  T   ++ + DF++        H  E+   K     +E + +Y+   + DL+   N   N ++ F++        S  +K+    FP   +KSL  + RM+  + + + C      VI      A   P+
Sbjct:   20 AWSPKRDLIALANTAGELLLHRLASFQRVWSLPPTERTGKEITALAWRPDGKTLAFSLGDTKQIVLCGVEKAEILHVFPVQSAVTCMHWMEVVDESSSLSSFYSSEDESKLFLPKIPTLPKSEEKSDEILNLLGDARLNVL-VLGGDSGFVELY----AYGMYKIAAVDGVTGTCRNL---CLSSDLRSLSVIAEVRSADNNPEICYIQLDTGLLSDCLPEVTRMALKFTFISTLLQYLHLSLTCMCEAWEDILMQMDLRLTKFVQEKN--TSTQVQDEFLELLLWGQSSPELQALLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSEALLYHLSEVRGMSLWRQKFEPLGLDSAAIEGAITAVGSFSLKANELLQVIDKSMKNFKAFFRWLYVAMLRMCDEHVPPELNKMTQKDIAFVADFLSE-------HFSELFDRKGKYFNVERVGQYLKDEDEDLMSPPNTKGNQWLKFLEE-------SSHLKESPLLFPSYPQKSLHFVKRMM--EGVIQHCLQKPAEVIGKSVKQAAFVPL 538          
BLAST of Anaphase promoting complex subunit 4 vs. Planmine SMEST
Match: SMESG000062466.1 (SMESG000062466.1)

HSP 1 Score: 1387.86 bits (3591), Expect = 0.000e+0
Identity = 699/699 (100.00%), Postives = 699/699 (100.00%), Query Frame = 3
Query:  129 YRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTIATFNFDIDDDKILIASEYFDNDGENNSMDVCAFYYPNSPILIWTRNNFETVQSCTIYLDKLLFSEINQNIKILKLQFYNSNILFLLAAVEKDNIIENSYILVLSWSSIKASQLEKIRVHSFEELINENFTIWPTNIENWIYLSNLLTAKSQELLPIDAIDMNVSCKRRLALVFFGRSRERCRIFVLEDI 2225
            YRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYKEDIKKIEELLRLKIKFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTIATFNFDIDDDKILIASEYFDNDGENNSMDVCAFYYPNSPILIWTRNNFETVQSCTIYLDKLLFSEINQNIKILKLQFYNSNILFLLAAVEKDNIIENSYILVLSWSSIKASQLEKIRVHSFEELINENFTIWPTNIENWIYLSNLLTAKSQELLPIDAIDMNVSCKRRLALVFFGRSRERCRIFVLEDI
Sbjct:    5 YRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYKEDIKKIEELLRLKIKFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTIATFNFDIDDDKILIASEYFDNDGENNSMDVCAFYYPNSPILIWTRNNFETVQSCTIYLDKLLFSEINQNIKILKLQFYNSNILFLLAAVEKDNIIENSYILVLSWSSIKASQLEKIRVHSFEELINENFTIWPTNIENWIYLSNLLTAKSQELLPIDAIDMNVSCKRRLALVFFGRSRERCRIFVLEDI 703          
BLAST of Anaphase promoting complex subunit 4 vs. Planmine SMEST
Match: SMESG000062466.1 (SMESG000062466.1)

HSP 1 Score: 1383.62 bits (3580), Expect = 0.000e+0
Identity = 699/700 (99.86%), Postives = 699/700 (99.86%), Query Frame = 3
Query:  129 YRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYXXXXXXXXXXXXXXXXFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMK-DFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTIATFNFDIDDDKILIASEYFDNDGENNSMDVCAFYYPNSPILIWTRNNFETVQSCTIYLDKLLFSEINQNIKILKLQFYNSNILFLLAAVEKDNIIENSYILVLSWSSIKASQLEKIRVHSFEELINENFTIWPTNIENWIYLSNLLTAKSQELLPIDAIDMNVSCKRRLALVFFGRSRERCRIFVLEDI 2225
            YRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYKEDIKKIEELLRLKIKFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMK DFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTIATFNFDIDDDKILIASEYFDNDGENNSMDVCAFYYPNSPILIWTRNNFETVQSCTIYLDKLLFSEINQNIKILKLQFYNSNILFLLAAVEKDNIIENSYILVLSWSSIKASQLEKIRVHSFEELINENFTIWPTNIENWIYLSNLLTAKSQELLPIDAIDMNVSCKRRLALVFFGRSRERCRIFVLEDI
Sbjct:    5 YRLQMILIWKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEPINYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYKEDIKKIEELLRLKIKFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASISYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLVYLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEMILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLIKLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILLSDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVVKSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFIDMPNTDFDVSFFMKEDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPVTIATFNFDIDDDKILIASEYFDNDGENNSMDVCAFYYPNSPILIWTRNNFETVQSCTIYLDKLLFSEINQNIKILKLQFYNSNILFLLAAVEKDNIIENSYILVLSWSSIKASQLEKIRVHSFEELINENFTIWPTNIENWIYLSNLLTAKSQELLPIDAIDMNVSCKRRLALVFFGRSRERCRIFVLEDI 704          
The following BLAST results are available for this feature:
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ANAPC41.826e-1920.70anaphase promoting complex subunit 4 [Source:HGNC ... [more]
ANAPC42.539e-1920.70anaphase promoting complex subunit 4 [Source:HGNC ... [more]
ANAPC43.146e-827.17anaphase promoting complex subunit 4 [Source:HGNC ... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
anapc43.420e-1819.81anaphase promoting complex subunit 4 [Source:ZFIN;... [more]
anapc46.478e-629.17anaphase promoting complex subunit 4 [Source:ZFIN;... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
carm1p17.060e-2221.71coactivator associated arginine methyltransferase ... [more]
carm1p18.760e-2221.71coactivator associated arginine methyltransferase ... [more]
carm1p16.631e-2121.04coactivator associated arginine methyltransferase ... [more]
carm1p14.537e-2021.15coactivator associated arginine methyltransferase ... [more]
carm1p11.274e-1019.95coactivator associated arginine methyltransferase ... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Anapc43.240e-1920.32anaphase promoting complex subunit 4 [Source:MGI S... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9UJX5|APC4_HUMAN8.770e-1920.70Anaphase-promoting complex subunit 4 OS=Homo sapie... [more]
sp|Q91W96|APC4_MOUSE2.266e-1820.32Anaphase-promoting complex subunit 4 OS=Mus muscul... [more]
sp|Q5RAQ5|APC4_PONAB2.586e-1820.58Anaphase-promoting complex subunit 4 OS=Pongo abel... [more]
sp|O65418|APC4_ARATH5.506e-628.72Anaphase-promoting complex subunit 4 OS=Arabidopsi... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J6M71.835e-3523.65Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A0X3Q1821.665e-3423.33Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A158QVJ71.578e-3222.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068Y6B22.136e-3221.52Anaphase promoting complex subunit 4 OS=Echinococc... [more]
A0A5K3F2D29.180e-3222.42Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
anapc49.375e-1920.26anaphase promoting complex subunit 4 [Source:NCBI ... [more]
anapc47.093e-1619.67anaphase promoting complex subunit 4 [Source:NCBI ... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
anapc43.650e-1520.16anaphase promoting complex subunit 4 [Source:ZFIN;... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO328093.478e-2220.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
anapc48.462e-1519.01anaphase promoting complex subunit 4 [Source:NCBI ... [more]
anapc42.878e-1419.08anaphase promoting complex subunit 4 [Source:NCBI ... [more]
back to top
BLAST of Anaphase promoting complex subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000062466.10.000e+0100.00SMESG000062466.1[more]
SMESG000062466.10.000e+099.86SMESG000062466.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003506 ID=SMED30003506|Name=Anaphase promoting complex subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2257bp
CAATGAATGAGTTTATATTTGATAATTATGAAGATTTTAGGATTAATTAT
AAAAACATGAATATATCTGCATGGTCTCCAAAATTGGATCTCATAGCATT
AGGATCAACAAATGGTGATTTGTGCATCTATAGATTACAAATGATACTAA
TATGGAAAATTACTATTAAAAATGAACAAATTCTTTCTATTTGTTGGCAT
CCAGATGGAAATATTATAGCTGTCGGATTTGAAAGTGGTCTAATTCAATA
TTTTTCCATTAATTATCCGGATTCTTTGTATTGCATAAAATTTGACGAAC
CGATTAATTATTTAAAATGGGTAGATCTAAGTAACGATTATAGATTACAA
GAAACATTAAATTTTCCATATGACATTAAAGATATTTTTCCTTTAAAAGA
GCAAATCTATAAAAACTCAGTTTACAAAGAAGATATTAAAAAAATTGAAG
AATTGTTACGCTTGAAAATTAAATTTAGCATTTTAATGGGCGTTAAAGGA
ATGTCAATATTTTTTTTGCCACGAGGAATTTATAATTTAGGAAAAATAAA
TTTGGAAGATCGCCGCACAAGCTCATATGATAAAATATACCACGCAAGTA
TATCGTATAATTTTGATTCTATTTCCTATGTTATACAAATGTATAATGAA
AATGGAGACCAAGCTTTTAGAACTTTTGTGATTAATTGCGACTTGATTCG
AAAAAACCTTCTACAAATATCAACAATATCTTCCATTTTTGTTGACCTTG
TTTACTTAAGATTGCTTGTTCAAAAACATATGAAAGAGATTGAAGAGAGT
TGGGAAGACTGTCTTAGTTTATTTGAAAGAGGAATAATGGAATATTCTCG
AAAAAAACAACATATTCGGGATTGGTCTTTAAGAACAGATTTAATGGAAA
TGATTTTGTTTGGCTGTTGCAATAAAGAATTTTGGATTACTTTAGAAGGA
AGTCTTTCATTATGTGGTGTTAAAAGTATTTCATCTACAGTTACCAAAAT
GTCATCTCATATTATAAATCATTGTTGTCCTCATATGCACTATACCCTTA
TAAAATTACTTTTTCATGGCATTGAGTTATTTAATATAATTAAATTTCAA
TCGGACTATGAATTCTTTAATTTATCTAAAAATGAAATTTCTGAATTAGT
TCAGACGTGTGAATCTGCACTGTTTAAACTCGTAGAATTTCAGATATTAC
TTTCAGATAATATTGATCACCTTAATTTATTTTTTCAATGGATTAGTAAT
GGAATTGAAAATCATCTAAACGAAACGAACCTTTACCATTCATTTACGTA
TTCACAATTGTCAATTATTATGGATTTTGTTACTAATAAATTACGTGTTG
TCAAGTCTCATTGTGATGAAATTATAGCATATAAAATCGAAATGTTACAC
GAATATATCTCAGAAAATGATTTGATAATTTCACAGAATTGTGATAAAAA
TATGTTTATGAACTTTATCGACATGCCAAATACTGATTTCGACGTGTCAT
TTTTTATGAAAGATTTTTTTCCCATAAAGCATGAAAAGTCACTTTCCAAA
ATGATTCGTATGTTGCTTCCTGATACTATTGACAAAGTTTGTTGGAATCA
TGAAAATACAGTCATTAAATATCATACTGATCCTGCTGGAAGCTATCCTG
TAACAATAGCAACATTTAATTTTGATATTGATGATGATAAAATTCTTATT
GCATCAGAATATTTTGACAATGATGGGGAAAATAATTCAATGGATGTATG
CGCATTTTATTATCCAAATTCTCCTATTTTAATATGGACTCGGAATAATT
TTGAAACTGTTCAATCATGTACAATTTATTTGGACAAGCTTCTATTTTCT
GAAATAAACCAAAATATCAAGATATTAAAACTACAATTTTACAATTCAAA
TATTTTATTCCTGCTTGCTGCAGTGGAAAAAGATAATATTATAGAAAATT
CTTATATTTTAGTATTGTCGTGGAGTTCAATAAAAGCTTCGCAGCTGGAA
AAAATACGAGTGCATAGTTTTGAGGAACTCATTAATGAAAATTTTACTAT
ATGGCCGACTAATATTGAAAATTGGATATATTTATCTAATTTATTGACAG
CTAAATCGCAAGAACTATTGCCAATTGATGCTATTGATATGAATGTTAGT
TGTAAAAGAAGATTGGCCCTTGTCTTCTTTGGCCGTTCTAGAGAACGATG
TCGGATTTTCGTGTTGGAGGATATTTAATCGCGTTTCTATCACCGAATTA
ATTTAGC
back to top

protein sequence of SMED30003506-orf-1

>SMED30003506-orf-1 ID=SMED30003506-orf-1|Name=SMED30003506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=742bp
MNEFIFDNYEDFRINYKNMNISAWSPKLDLIALGSTNGDLCIYRLQMILI
WKITIKNEQILSICWHPDGNIIAVGFESGLIQYFSINYPDSLYCIKFDEP
INYLKWVDLSNDYRLQETLNFPYDIKDIFPLKEQIYKNSVYKEDIKKIEE
LLRLKIKFSILMGVKGMSIFFLPRGIYNLGKINLEDRRTSSYDKIYHASI
SYNFDSISYVIQMYNENGDQAFRTFVINCDLIRKNLLQISTISSIFVDLV
YLRLLVQKHMKEIEESWEDCLSLFERGIMEYSRKKQHIRDWSLRTDLMEM
ILFGCCNKEFWITLEGSLSLCGVKSISSTVTKMSSHIINHCCPHMHYTLI
KLLFHGIELFNIIKFQSDYEFFNLSKNEISELVQTCESALFKLVEFQILL
SDNIDHLNLFFQWISNGIENHLNETNLYHSFTYSQLSIIMDFVTNKLRVV
KSHCDEIIAYKIEMLHEYISENDLIISQNCDKNMFMNFIDMPNTDFDVSF
FMKDFFPIKHEKSLSKMIRMLLPDTIDKVCWNHENTVIKYHTDPAGSYPV
TIATFNFDIDDDKILIASEYFDNDGENNSMDVCAFYYPNSPILIWTRNNF
ETVQSCTIYLDKLLFSEINQNIKILKLQFYNSNILFLLAAVEKDNIIENS
YILVLSWSSIKASQLEKIRVHSFEELINENFTIWPTNIENWIYLSNLLTA
KSQELLPIDAIDMNVSCKRRLALVFFGRSRERCRIFVLEDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR024789APC4
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR024977Apc4_WD40_dom
IPR024790APC4_long_dom
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005680anaphase-promoting complex
Vocabulary: biological process
TermDefinition
GO:0030071regulation of mitotic metaphase/anaphase transition
GO:0031145anaphase-promoting complex-dependent catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024977Anaphase-promoting complex subunit 4, WD40 domainPFAMPF12894ANAPC4_WD40coord: 23..106
e-value: 2.2E-14
score: 53.5
IPR024790Anaphase-promoting complex subunit 4 long domainPFAMPF12896ANAPC4coord: 226..420
e-value: 1.7E-16
score: 60.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 5..114
e-value: 8.0E-9
score: 37.1
IPR024789Anaphase-promoting complex subunit 4PANTHERPTHR13260ANAPHASE PROMOTING COMPLEX SUBUNIT 4 APC4coord: 20..739
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 21..108