Telomerase protein component 1

Overview
NameTelomerase protein component 1
Smed IDSMED30003493
Length (bp)6988
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Telomerase protein component 1 (SMED30003493) t-SNE clustered cells

Violin plots show distribution of expression levels for Telomerase protein component 1 (SMED30003493) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Telomerase protein component 1 (SMED30003493) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Telomerase protein component 1 (SMED30003493) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003493

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30003493SMESG000032835.1 SMESG000032829.1 Contig2869uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30003493SMESG000032835.1 SMESG000032829.1 Contig2869uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30003493SMESG000032835.1 SMESG000032829.1 Contig2869uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30003493SMESG000032835.1 SMESG000032829.1 Contig2869newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30003493SMESG000032835.1 SMESG000032829.1 Contig2869newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30003493SMESG000032835.1 SMESG000032829.1 Contig2869newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30003493SMESG000034231.1 Contig2869uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30003493SMESG000034231.1 Contig2869uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30003493SMESG000034231.1 Contig2869uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30003493SMESG000034231.1 Contig2869newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30003493SMESG000034231.1 Contig2869newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30003493SMESG000034231.1 Contig2869newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30003493SMESG000032835.1 SMESG000032829.1 SMESG000032828.1 dd_Smed_v4_4376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003493SMESG000032835.1 SMESG000032829.1 SMESG000032828.1 dd_Smed_v4_4376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Telomerase protein component 1 vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 408.297 bits (1048), Expect = 6.025e-114
Identity = 444/1970 (22.54%), Postives = 812/1970 (41.22%), Query Frame = 1
Query:  445 INNLSKMDLYV--DISKE----DPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKYRNKKMVA------------------------------------EINGKKI-------KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFN-----------------ETILKTNEK-------LIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIP--PIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDE---------------MVAGRVQFDMILSFDVSISEQCVS-----QYIKYNPSVL---IIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKY------GLKNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINN--SILSECHGEQTRYKSIMKETLTFLKSYTENIESFQK-------DEVNQLLL----IVEKKLSFEIDIDSPVNCQSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNL--PFPMKSYLKK---ELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE---DKKG-RIIIKNSFIGNLITKYSMSIDKT-----VVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEET-NSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYK-KDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHN-NKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDIT-----CVDANDQFIVCGTKFGEISILN-SNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLD--------SILTIDVCKELILVGCKDGSXX--XXXXXXXXXXNHEIKA-HNDWITTVRFNSFNYFLSGSND 5829
            +NN S   L    +I +E    +PEFILK SLY R++LN+R+++N ++A++ +    RP+L++Y  +I+ LP+DW++V   Y  ++         LP  L+ A+ +KF  F  YQL KY  +K  A                                    E  G  +       + +LK +V+ LHI +P ++V +LLG  YP     F  S+LPG WD S+AGKRMK+  PETWE ++S+ GNK  +W++LI+N  LP+MAM+RN+ NLL+  I   +H  + Q ++   +VIH +  PF++  A+  ++                      IL  NEK       L  +    +    +  +  +   R  +++ K  Q     E ++ RY +AL TA+ +S  +++P  P R  ++ L + N   +  P        +   + L+  M   A +   +    D+L           ++LK    IL    K +  V + FDE               +   RV  D ++    S+ +  ++      + + N   L   I+   +   +  +N    N V + G  +  +K I+E  +  +++ +  MD+ +      G   ++ L    PL +D+P+    +  +    I +FISSTF DM  ER ++   ++P+++        + I ++ IDLRWGV     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E           FL +N R +      L  FRD+             +V + +K      +  + E       I+   S LS   G   R        +   + Y   +E F +       + + +L L    ++E+ +S   D       Q    P S        D  +  +L  G + ++ G+ G GKT+ ++ L+S      + P+  K   +  V    +  +        LL  +  +L   L  P  + S  +    ELQ      S E   P   +                      + IDG D L D +      WIP  LP    ++++  S++ L  + +  + + +  + P+    + +++   L   GK L+ +PF+N M    +KR+S +P++L++  +H+ L T Y++V E +  LP+T+  L+ + L ++EKE   ++     + L  ++SG T+  L  ++S++                + +   A N    + M P   +      LL E   ++ G R+ + +   G L T       K        H +I+    +    D    FR        D+ Y+  +S         LTN+  +    +LG+   LL  +  +  +   E  KL            F+TF+ +  + L + P    QQA N+PL S +   C++  ++   + + +  +   NK  T K +  SSL   +S   + VAF +     ++   +G + L +L+ ++   ++      ++   F ++DT L   + DGL  +W    G  +   K H   +T C +S    L+ TV L     +W T +  L         +NC+  HP     +  G W G++  + ++  K    L     S +++ F+    +     ++  + +W+   G +L      +  + +   +   G Q+   G        + VWS +LG        L ++      +  +   +  G +   I I   S+ +   Q    DVA++++        LS    V+   + +     + E ++    + S   +PV+ +      + S S+D ++ L   +      K + F    +        S  +       +  G +D S+    ++  K  +L H   A H DW+T   +   N  +S S+D
Sbjct:  262 MNNTSDPTLAAIFEICRELALLEPEFILKASLYARQQLNVRNVANNILAIAAFLPACRPHLRRYFCAIVQLPSDWIQVAELYQSLAEGDKNKLVPLPACLRTAMTDKFAQFDEYQLAKYNPRKHRAKRHPRRPPRSPGMEPPFSHRCFPRYIGFLREEQRKFEKAGDTVSEKKNPPRFTLKKLVQRLHIHKPAQHVQALLGYRYPSNLQLFSRSRLPGPWDSSRAGKRMKLSRPETWERELSLRGNKASVWEELIENGKLPFMAMLRNLCNLLRVGISSRHHELILQRLQHAKSVIHSRQFPFRFLNAHDAIDALEAQLRNQALPFPSNITLMRRILTRNEKNRPRRRFLCHLSRQQLRMAMRIPVLYEQLKREKLRVHKARQWKYDGE-MLNRYRQALETAVNLSVKHSLPLLPGRTVLVYLTDANADRL-CPKSNPQGPPLNYALLLIGMMITRAEQVDVVLCGGDTLKT---------AVLKAEEGILKTAIKLQAQVQE-FDENDGWSLNTFGKYLLSLAGQRVPVDRVILLGQSMDDGMINVAKQLYWQRVNSKCLFVGILLRRVQYLSTDLN---PNDVTLSGCTDAILKFIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSL---RPLEEDTPSPLAPVSQQGWRSIRLFISSTFRDMHGERDLLLRSVLPALQARA---APHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVENAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVM--------QFLNRNQRLQP-SAQALIYFRDSSF---------LSSVPDAWK------SDFVSESEEAARRISELKSYLSRQKGITCRRYPCEWGGVAAGRPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARPRLLQDTVQRLMLPHGRLSLVTGQSGQGKTAFLASLVSAL----QAPDGAKVASL--VFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRLLPKSAESLHPGQTQ---------------------VLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQSQGAHVLALGPLEASARARLVREELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVW-------RTLPKGTKSWEEAVAAGNSGDPYPMGPFACLVQSLRSLLGEGPLERPGARLCLPD---GPLRTAAKRCYGKRPGLEDTAHILIAAQLWKTCDADASGTFRSCPPEALGDLPYHLLQSGNRGLLSKFLTNLHVVAAHLELGLVSRLLEAHALYASSVPKEEQKL-----PEADVAVFRTFLRQQASILSQYPRLLPQQAANQPLDSPL---CHQASLLSRRW-HLQHTLRWLNKPRTMKNQQSSSLSLAVSSSPTAVAFSTNGQRAAVGTANGTVYLLDLRTWQEEKSVVSGCDGISACLFLSDDT-LFLTAFDGLLELWDLQHGCRVLQTKAHQYQITGCCLSPDCRLLATVCLGGCLKLWDTVRGQLAFQHTYPKSLNCVAFHPEGQV-IATGSWAGSISFFQVDGLKVTKDLGAPGASIRTLAFNVPGGVVAVGRLDSMVELWAWREGARLAAFPAHH-GFVAAALFLHAGCQLLTAGEDGK----VQVWSGSLGRPRGHLGSLSLSPALSVALSPDGDRVAVGYRADGIRIYKISSGSQGAQGQALDVAVSALAW------LSPKVLVSGAEDGSLQGWALKECSLQSLWLLSRFQKPVLGLATSQELLASASEDFTVQLWPRQLLTRPHKAEDFPCGTELRGHEGPVSCCSFSTDGGSLATGGRDRSLLCWDVRTPKTPVLIHSFPACHRDWVTGCAWTKDNLLISCSSD 2127          
BLAST of Telomerase protein component 1 vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 343.199 bits (879), Expect = 6.220e-94
Identity = 396/1794 (22.07%), Postives = 734/1794 (40.91%), Query Frame = 1
Query:  811 KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFN-----------------ETILKTNEK-------LIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIP--PIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDE---------------MVAGRVQFDMILSFDVSISEQCVS-----QYIKYNPSVL---IIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKY------GLKNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINN--SILSECHGEQTRYKSIMKETLTFLKSYTENIESFQK-------DEVNQLLL----IVEKKLSFEIDIDSPVNCQSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNL--PFPMKSYLKK---ELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE---DKKG-RIIIKNSFIGNLITKYSMSIDKT-----VVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEET-NSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYK-KDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHN-NKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDIT-----CVDANDQFIVCGTKFGEISILN-SNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLD--------SILTIDVCKELILVGCKDGSXX--XXXXXXXXXXNHEIKA-HNDWITTVRFNSFNYFLSGSND 5829
            + +LK +V+ LHI +P ++V +LLG  YP     F  S+LPG WD S+AGKRMK+  PETWE ++S+ GNK  +W++LI+N  LP+MAM+RN+ NLL+  I   +H  + Q ++   +VIH +  PF++  A+  ++                      IL  NEK       L  +    +    +  +  +   R  +++ K  Q     E ++ RY +AL TA+ +S  +++P  P R  ++ L + N   +  P        +   + L+  M   A +   +    D+L           ++LK    IL    K +  V + FDE               +   RV  D ++    S+ +  ++      + + N   L   I+   +   +  +N    N V + G  +  +K I+E  +  +++ +  MD+ +      G   ++ L    PL +D+P+    +  +    I +FISSTF DM  ER ++   ++P+++        + I ++ IDLRWGV     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E           FL +N R +      L  FRD+             +V + +K      +  + E       I+   S LS   G   R        +   + Y   +E F +       + + +L L    ++E+ +S   D       Q    P S        D  +  +L  G + ++ G+ G GKT+ ++ L+S      + P+  K   +  V    +  +        LL  +  +L   L  P  + S  +    ELQ      S E   P   +                      + IDG D L D +      WIP  LP    ++++  S++ L  + +  + + +  + P+    + +++   L   GK L+ +PF+N M    +KR+S +P++L++  +H+ L T Y++V E +  LP+T+  L+ + L ++EKE   ++     + L  ++SG T+  L  ++S++                + +   A N    + M P   +      LL E   ++ G R+ + +   G L T       K        H +I+    +    D    FR        D+ Y+  +S         LTN+  +    +LG+   LL  +  +  +   E  KL            F+TF+ +  + L + P    QQA N+PL S +   C++  ++   + + +  +   NK  T K +  SSL   +S   + VAF +     ++   +G + L +L+ ++   ++      ++   F ++DT L   + DGL  +W    G  +   K H   +T C +S    L+ TV L     +W T +  L         +NC+  HP     +  G W G++  + ++  K    L     S +++ F+    +     ++  + +W+   G +L      +  + +   +   G Q+   G        + VWS +LG        L ++      +  +   +  G +   I I   S+ +   Q    DVA++++        LS    V+   + +     + E ++    + S   +PV+ +      + S S+D ++ L   +      K + F    +        S  +       +  G +D S+    ++  K  +L H   A H DW+T   +   N  +S S+D
Sbjct:  330 RFTLKKLVQRLHIHKPAQHVQALLGYRYPSNLQLFSRSRLPGPWDSSRAGKRMKLSRPETWERELSLRGNKASVWEELIENGKLPFMAMLRNLCNLLRVGISSRHHELILQRLQHAKSVIHSRQFPFRFLNAHDAIDALEAQLRNQALPFPSNITLMRRILTRNEKNRPRRRFLCHLSRQQLRMAMRIPVLYEQLKREKLRVHKARQWKYDGE-MLNRYRQALETAVNLSVKHSLPLLPGRTVLVYLTDANADRL-CPKSNPQGPPLNYALLLIGMMITRAEQVDVVLCGGDTLKT---------AVLKAEEGILKTAIKLQAQVQE-FDENDGWSLNTFGKYLLSLAGQRVPVDRVILLGQSMDDGMINVAKQLYWQRVNSKCLFVGILLRRVQYLSTDLN---PNDVTLSGCTDAILKFIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSL---RPLEEDTPSPLAPVSQQGWRSIRLFISSTFRDMHGERDLLLRSVLPALQARA---APHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVENAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVM--------QFLNRNQRLQP-SAQALIYFRDSSF---------LSSVPDAWK------SDFVSESEEAARRISELKSYLSRQKGITCRRYPCEWGGVAAGRPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARPRLLQDTVQRLMLPHGRLSLVTGQSGQGKTAFLASLVSAL----QAPDGAKVASL--VFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRLLPKSAESLHPGQTQ---------------------VLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQSQGAHVLALGPLEASARARLVREELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVW-------RTLPKGTKSWEEAVAAGNSGDPYPMGPFACLVQSLRSLLGEGPLERPGARLCLPD---GPLRTAAKRCYGKRPGLEDTAHILIAAQLWKTCDADASGTFRSCPPEALGDLPYHLLQSGNRGLLSKFLTNLHVVAAHLELGLVSRLLEAHALYASSVPKEEQKL-----PEADVAVFRTFLRQQASILSQYPRLLPQQAANQPLDSPL---CHQASLLSRRW-HLQHTLRWLNKPRTMKNQQSSSLSLAVSSSPTAVAFSTNGQRAAVGTANGTVYLLDLRTWQEEKSVVSGCDGISACLFLSDDT-LFLTAFDGLLELWDLQHGCRVLQTKAHQYQITGCCLSPDCRLLATVCLGGCLKLWDTVRGQLAFQHTYPKSLNCVAFHPEGQV-IATGSWAGSISFFQVDGLKVTKDLGAPGASIRTLAFNVPGGVVAVGRLDSMVELWAWREGARLAAFPAHH-GFVAAALFLHAGCQLLTAGEDGK----VQVWSGSLGRPRGHLGSLSLSPALSVALSPDGDRVAVGYRADGIRIYKISSGSQGAQGQALDVAVSALAW------LSPKVLVSGAEDGSLQGWALKECSLQSLWLLSRFQKPVLGLATSQELLASASEDFTVQLWPRQLLTRPHKAEDFPCGTELRGHEGPVSCCSFSTDGGSLATGGRDRSLLCWDVRTPKTPVLIHSFPACHRDWVTGCAWTKDNLLISCSSD 2019          
BLAST of Telomerase protein component 1 vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 337.421 bits (864), Expect = 2.483e-93
Identity = 299/1227 (24.37%), Postives = 535/1227 (43.60%), Query Frame = 1
Query:  493 DPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKYRNKKMVA------------------------------------EINGKKI-------KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFN-----------------ETILKTNEK-------LIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIP--PIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDE---------------MVAGRVQFDMILSFDVSISEQCVS-----QYIKYNPSVL---IIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKY------GLKNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINN--SILSECHGEQTRYKSIMKETLTFLKSYTENIESFQK-------DEVNQLLL----IVEKKLSFEIDIDSPVNCQSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNL--PFPMKSYLKK---ELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIY 3777
            +PEFILK SLY R++LN+R+++N ++A++ +    RP+L++Y  +I+ LP+DW++V   Y  ++         LP  L+ A+ +KF  F  YQL KY  +K  A                                    E  G  +       + +LK +V+ LHI +P ++V +LLG  YP     F  S+LPG WD S+AGKRMK+  PETWE ++S+ GNK  +W++LI+N  LP+MAM+RN+ NLL+  I   +H  + Q ++   +VIH +  PF++  A+  ++                      IL  NEK       L  +    +    +  +  +   R  +++ K  Q     E ++ RY +AL TA+ +S  +++P  P R  ++ L + N   +  P        +   + L+  M   A +   +    D+L           ++LK    IL    K +  V + FDE               +   RV  D ++    S+ +  ++      + + N   L   I+   +   +  +N    N V + G  +  +K I+E  +  +++ +  MD+ +      G   ++ L    PL +D+P+    +  +    I +FISSTF DM  ER ++   ++P+++        + I ++ IDLRWGV     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E           FL +N R +      L  FRD+             +V + +K      +  + E       I+   S LS   G   R        +   + Y   +E F +       + + +L L    ++E+ +S   D       Q    P S        D  +  +L  G + ++ G+ G GKT+ ++ L+S      + P+  K   +  V    +  +        LL  +  +L   L  P  + S  +    ELQ      S E   P   +                      + IDG D L D +      WIP  LP    ++++  S++ L  + +  + + +  + P+    + +++   L   GK L+ +PF+N M    +KR+S +P++L++  +H+ L T Y++V E +  LP+T+  L+ + L ++EKE   ++     + L  ++SG T+  L  ++S++
Sbjct:  284 EPEFILKASLYARQQLNVRNVANNILAIAAFLPACRPHLRRYFCAIVQLPSDWIQVAELYQSLAEGDKNKLVPLPACLRTAMTDKFAQFDEYQLAKYNPRKHRAKRHPRRPPRSPGMEPPFSHRCFPRYIGFLREEQRKFEKAGDTVSEKKNPPRFTLKKLVQRLHIHKPAQHVQALLGYRYPSNLQLFSRSRLPGPWDSSRAGKRMKLSRPETWERELSLRGNKASVWEELIENGKLPFMAMLRNLCNLLRVGISSRHHELILQRLQHAKSVIHSRQFPFRFLNAHDAIDALEAQLRNQALPFPSNITLMRRILTRNEKNRPRRRFLCHLSRQQLRMAMRIPVLYEQLKREKLRVHKARQWKYDGE-MLNRYRQALETAVNLSVKHSLPLLPGRTVLVYLTDANADRL-CPKSNPQGPPLNYALLLIGMMITRAEQVDVVLCGGDTLKT---------AVLKAEEGILKTAIKLQAQVQE-FDENDGWSLNTFGKYLLSLAGQRVPVDRVILLGQSMDDGMINVAKQLYWQRVNSKCLFVGILLRRVQYLSTDLN---PNDVTLSGCTDAILKFIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSL---RPLEEDTPSPLAPVSQQGWRSIRLFISSTFRDMHGERDLLLRSVLPALQARA---APHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVENAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVM--------QFLNRNQRLQP-SAQALIYFRDSSF---------LSSVPDAWK------SDFVSESEEAARRISELKSYLSRQKGITCRRYPCEWGGVAAGRPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARPRLLQDTVQRLMLPHGRLSLVTGQSGQGKTAFLASLVSAL----QAPDGAKVASL--VFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRLLPKSAESLHPGQTQ---------------------VLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQSQGAHVLALGPLEASARARLVREELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVW 1438          
BLAST of Telomerase protein component 1 vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 212.231 bits (539), Expect = 4.481e-54
Identity = 325/1580 (20.57%), Postives = 622/1580 (39.37%), Query Frame = 1
Query: 1381 IIKRYTEALNTAIEISTLYNIP--PIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDE---------------MVAGRVQFDMILSFDVSISEQCVS-----QYIKYNPSVL---IIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKY------GLKNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINN--SILSECHGEQTRYKSIMKETLTFLKSYTENIESFQK-------DEVNQLLL----IVEKKLSFEIDIDSPVNCQSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNL--PFPMKSYLKK---ELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE---DKKG-RIIIKNSFIGNLITKYSMSIDKT-----VVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEET-NSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYK-KDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHN-NKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDIT-----CVDANDQFIVCGTKFGEISILN-SNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLD--------SILTIDVCKELILVGCKDGSXX--XXXXXXXXXXNHEIKA-HNDWITTVRFNSFNYFLSGSND 5829
            ++ RY +AL TA+ +S  +++P  P R  ++ L + N   +  P        +   + L+  M   A +   +    D+L           ++LK    IL    K +  V + FDE               +   RV  D ++    S+ +  ++      + + N   L   I+   +   +  +N    N V + G  +  +K I+E  +  +++ +  MD+ +      G   ++ L    PL +D+P+    +  +    I +FISSTF DM  ER ++   ++P+++        + I ++ IDLRWGV     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E           FL +N R +      L  FRD+             +V + +K      +  + E       I+   S LS   G   R        +   + Y   +E F +       + + +L L    ++E+ +S   D       Q    P S        D  +  +L  G + ++ G+ G GKT+ ++ L+S      + P+  K   +  V    +  +        LL  +  +L   L  P  + S  +    ELQ      S E   P   +                      + IDG D L D +      WIP  LP    ++++  S++ L  + +  + + +  + P+    + +++   L   GK L+ +PF+N       +R+S +P++L++  +H+ L T Y++V E +  LP+T+  L+ + L ++EKE   ++     + L  ++SG T+  L  ++S++                + +   A N    + M P   +      LL E   ++ G R+ + +   G L T       K        H +I+    +    D    FR        D+ Y+  +S         LTN+  +    +LG+   LL  +  +  +   E  KL            F+TF+ +  + L + P    QQA N+PL S +   C++  ++   + + +  +   NK  T K +  SSL   +S   + VAF +     ++   +G + L +L+ ++   ++      ++   F ++DT L   + DGL  +W    G  +   K H   +T C +S    L+ TV L     +W T +  L         +NC+  HP     +  G W G++  + ++  K    L     S +++ F+    +     ++  + +W+   G +L      +  + +   +   G Q+   G        + VWS +LG        L ++      +  +   +  G +   I I   S+ +   Q    DVA++++        LS    V+   + +     + E ++    + S   +PV+ +      + S S+D ++ L   +      K + F    +        S  +       +  G +D S+    ++  K  +L H   A H DW+T   +   N  +S S+D
Sbjct:    1 MLNRYRQALETAVNLSVKHSLPLLPGRTVLVYLTDANADRL-CPKSNPQGPPLNYALLLIGMMITRAEQVDVVLCGGDTLKT---------AVLKAEEGILKTAIKLQAQVQE-FDENDGWSLNTFGKYLLSLAGQRVPVDRVILLGQSMDDGMINVAKQLYWQRVNSKCLFVGILLRRVQYLSTDLN---PNDVTLSGCTDAILKFIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSL---RPLEEDTPSPLAPVSQQGWRSIRLFISSTFRDMHGERDLLLRSVLPALQARA---APHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVENAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVM--------QFLNRNQRLQP-SAQALIYFRDSSF---------LSSVPDAWK------SDFVSESEEAARRISELKSYLSRQKGITCRRYPCEWGGVAAGRPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARPRLLQDTVQRLMLPHGRLSLVTGQSGQGKTAFLASLVSAL----QAPDGAKVASL--VFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRLLPKSAESLHPGQTQ---------------------VLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQSQGAHVLALGPLEASARARLVREELALYGKRLEESPFNN-------QRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVW-------RTLPKGTKSWEEAVAAGNSGDPYPMGPFACLVQSLRSLLGEGPLERPGARLCLPD---GPLRTAAKRCYGKRPGLEDTAHILIAAQLWKTCDADASGTFRSCPPEALGDLPYHLLQSGNRGLLSKFLTNLHVVAAHLELGLVSRLLEAHALYASSVPKEEQKL-----PEADVAVFRTFLRQQASILSQYPRLLPQQAANQPLDSPL---CHQASLLSRRW-HLQHTLRWLNKPRTMKNQQSSSLSLAVSSSPTAVAFSTNGQRAAVGTANGTVYLLDLRTWQEEKSVVSGCDGISACLFLSDDT-LFLTAFDGLLELWDLQHGCRVLQTKAHQYQITGCCLSPDCRLLATVCLGGCLKLWDTVRGQLAFQHTYPKSLNCVAFHPEGQV-IATGSWAGSISFFQVDGLKVTKDLGAPGASIRTLAFNVPGGVVAVGRLDSMVELWAWREGARLAAFPAHH-GFVAAALFLHAGCQLLTAGEDGK----VQVWSGSLGRPRGHLGSLSLSPALSVALSPDGDRVAVGYRADGIRIYKISSGSQGAQGQALDVAVSALAW------LSPKVLVSGAEDGSLQGWALKECSLQSLWLLSRFQKPVLGLATSQELLASASEDFTVQLWPRQLLTRPHKAEDFPCGTELRGHEGPVSCCSFSTDGGSLATGGRDRSLLCWDVRTPKTPVLIHSFPACHRDWVTGCAWTKDNLLISCSSD 1470          
BLAST of Telomerase protein component 1 vs. Ensembl Human
Match: WDR38 (WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:23745])

HSP 1 Score: 63.929 bits (154), Expect = 1.136e-9
Identity = 37/157 (23.57%), Postives = 75/157 (47.77%), Query Frame = 1
Query: 4609 HHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKT-KSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNK-STKSIVFHPYYDLFLTTTINGEINVW 5073
             H   VN + F  +   L++ SEDG    W +  G LL  L GH GPV  C  S   +L  + S D    +W   +    ++LK  +  +  ++  P++  ++  G W+  + ++++ + + + +L  ++ S +S  F P  +   T + +  +++W
Sbjct:   19 QHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSR-QLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIW 174          
BLAST of Telomerase protein component 1 vs. Ensembl Fly
Match: CG3071 (gene:FBgn0023527 transcript:FBtr0070398)

HSP 1 Score: 59.3066 bits (142), Expect = 3.801e-8
Identity = 62/288 (21.53%), Postives = 122/288 (42.36%), Query Frame = 1
Query: 4561 IQLFNLKQFEALLNLRHHFSRVNKTFF---YNNDTRLISVS-EDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSP-----INCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVA-VLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRS-PFFGINVWST--TLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNK---LQKTICDVA 5376
            +Q++NL     + NL    SR  KT +   +  D RL++   E+G   ++ +    +L++ KGH  PV     +     + +   D    +W       EK+++T        +     HP      + G ++G + +Y+      V   L +    +S++F P   +F++     ++ VW   +G +L  +  ++    + ++  SDG ++   G  R    + ++ + T  TL Y +    ++ +   D  DQ +V G   G +SI      +K   L+K   D A
Sbjct:   63 VQIYNLVTMLVVKNL----SRFQKTAYGATFRQDGRLLAAGDEEGHVKLFDTTSRNILRLFKGHTAPVHRTFFTADKLQLASFGDDKSVRLWDVAN---EKVVQTYEDTHTDYVRAGAMHPQAGHMFVSGGYDGKIKLYDTRAETAVQRTLDHGAPVESMLFLPNGSIFVSAG-GSQVRVWDLISGCRLLTMMSQHHKTVTCLRLGSDGRRLLSGGLDRHVKIYDVSTYKTVHTLTYPNA---VVSMAVADG-DQAVVAGMVDGLVSIRRMMVDSKPSHLKKIRADRA 338          
BLAST of Telomerase protein component 1 vs. Ensembl Fly
Match: CG7568 (gene:FBgn0039673 transcript:FBtr0330294)

HSP 1 Score: 55.8398 bits (133), Expect = 3.712e-7
Identity = 44/216 (20.37%), Postives = 96/216 (44.44%), Query Frame = 1
Query: 4534 ISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNG-NMFIYNLNNYKKVAVL-----HNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNV-QYSSDGL 5160
            I+ +   G  ++++++    L  L HH + V    F  +   L++ S D  A +W     +L   L+GH   +++C+ +   +LI T SLD+   +W T K   E  L  +     +    +   +++  C +     ++ L    ++ +L     H+++ +K + F P   + LT + +    +W + +G   +V++      +S    Y+ D +
Sbjct:  240 IATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSK-VCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAI 454          
BLAST of Telomerase protein component 1 vs. Ensembl Fly
Match: CG7568 (gene:FBgn0039673 transcript:FBtr0330295)

HSP 1 Score: 55.8398 bits (133), Expect = 3.819e-7
Identity = 44/216 (20.37%), Postives = 96/216 (44.44%), Query Frame = 1
Query: 4534 ISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNG-NMFIYNLNNYKKVAVL-----HNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYS-NVQYSSDGL 5160
            I+ +   G  ++++++    L  L HH + V    F  +   L++ S D  A +W     +L   L+GH   +++C+ +   +LI T SLD+   +W T K   E  L  +     +    +   +++  C +     ++ L    ++ +L     H+++ +K + F P   + LT + +    +W + +G   +V++      +S    Y+ D +
Sbjct:  240 IATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSK-VCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAI 454          
BLAST of Telomerase protein component 1 vs. Ensembl Fly
Match: U4-U6-60K (gene:FBgn0036733 transcript:FBtr0075209)

HSP 1 Score: 51.9878 bits (123), Expect = 7.059e-6
Identity = 48/223 (21.52%), Postives = 94/223 (42.15%), Query Frame = 1
Query: 4444 AFTYKKDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPN--NDFKVIVGC--------WNGNMFIYNLNNYKKVAVL--HNNKSTKSIVFHPYYDLFLTTTINGEINVWS 5076
             F  ++ I+ +  ++  ++S VAF      ++ +      +L++L+Q   +L+   H   V+   ++++ + L++   D    VW    G  +  L+GHLG V     S     I T S D+   +W          L+ + P+  I +H N  +D K    C        ++    I++   ++ +  L  H+NK   S+   P      TT+ +    +WS
Sbjct:  338 GFNNEESIADITGHMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWD---------LRRRQPVYTIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNKVI-SVDIAPNSQYIATTSFDRTFKLWS 550          
BLAST of Telomerase protein component 1 vs. Ensembl Fly
Match: Taf5 (gene:FBgn0010356 transcript:FBtr0088240)

HSP 1 Score: 51.9878 bits (123), Expect = 8.154e-6
Identity = 42/208 (20.19%), Postives = 92/208 (44.23%), Query Frame = 1
Query: 4561 IQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEK-FVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNK-STKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFG 5178
            +++ + +  E   +L  H   V +  F      L+S SED    +WS +  + +   +GH+ PV D   +       + S D    +W T+    L   +   S ++C+  HPN+++ V  G  +  + +++    + V ++  +K S  S+ F        + +++  I +W  +NG  +  + + + +  + + +S DG  +   G
Sbjct:  432 VRMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNY-VATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTL-LRHTSTVTTITFSRDGTVLAAAG 637          
BLAST of Telomerase protein component 1 vs. Ensembl Zebrafish
Match: tep1 (telomerase-associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6153])

HSP 1 Score: 220.705 bits (561), Expect = 1.310e-60
Identity = 119/289 (41.18%), Postives = 171/289 (59.17%), Query Frame = 1
Query:  469 LYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSSCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEIN-----GKKI--------------------------------KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEE 1224
            L  +I+ EDPEF+LKV++Y R+ELNIR  +NYL+A++ +   S+ +L++Y    + LP+DWLEV   Y +  + S LP+ LKKAL++KFK FS YQL KY  +K   + N     GK I                                + SLK MV  LHI E  E+VM++LGK YP    AF  S L G WD  +AGK+MK+  P+TWE ++S  GNK   W+KLID KSLP+MAM+RN+RN++   I + +H K+   +  ++ VI  +  PF++ +AYK++ E
Sbjct:  273 LATEITTEDPEFVLKVAVYTRQELNIRITANYLLALAAHLPASKQHLRRYFCPAVQLPSDWLEVARLYSMCFSKS-LPSCLKKALVDKFKQFSEYQLAKYNTRKHRCKHNKNQKKGKNISPEEWKKWGELLRVDEPILRKYKHTKKDKKESEFSLKKMVMRLHIKESAEHVMAILGKKYPSDLKAFSRSGLSGVWDRERAGKQMKLKQPDTWERKVSQEGNKAATWEKLIDGKSLPFMAMLRNLRNMITVGISEKHHSKILNRLSSKNAVIQSRQFPFRFLSAYKVILE 560          
BLAST of Telomerase protein component 1 vs. Ensembl Zebrafish
Match: taf5 (TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-051120-180])

HSP 1 Score: 57.3806 bits (137), Expect = 2.121e-7
Identity = 47/204 (23.04%), Postives = 91/204 (44.61%), Query Frame = 1
Query: 4468 SSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKT-KSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKST-KSIVFHPYYDLFLTTTINGEINVW 5073
            S +++  S  +  V+F    N +  S E G I+L++L+ F  L+  + H   V  T F       +S   D +A +W++     L++  GHL  VT       +N + T S D    +W        +I    K PI+ +   PN  F +  G  +G + ++++ +   +A L  +  T  ++ F    ++  + +I+  + +W
Sbjct:  492 SKILHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQFSPFGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSSDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGKF-LASGSTDGRVLLWDIGHGLMIAELKGHTGTIYALKFSRDGEIIASGSIDNTVRLW 694          
BLAST of Telomerase protein component 1 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 56.225 bits (134), Expect = 3.699e-7
Identity = 47/226 (20.80%), Postives = 93/226 (41.15%), Query Frame = 1
Query: 4495 QISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWN------------GNMFIYNLNNYKKVAVLHNNKSTKS-IVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYS 5133
            +I  +AF     L++        +L++++  E +  L  HF+ +    F     RL++ S D  A++W    G  + VL GH G ++    +   +LI T SLD    +W  E               C+ +   ++ +V+  C+N            G   +++ + ++ +  L  +K   S + F+      LT +++    VW    G  L+V+   +   +S
Sbjct:  179 EIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGG------------QCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGACLQVLEGHSDEIFS 392          

HSP 2 Score: 55.8398 bits (133), Expect = 4.400e-7
Identity = 31/111 (27.93%), Postives = 54/111 (48.65%), Query Frame = 1
Query: 4492 DQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMW 4824
            D++  V F     LI+ +   G  ++F+   F+ L  L  H   ++K  F    +R+++ S D  + VW    GA L+VL+GH   +  C  + + + I T S D+   +W
Sbjct:  304 DEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGACLQVLEGHSDEIFSCAFNYEGDTIITGSKDNTCRIW 414          
BLAST of Telomerase protein component 1 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 55.8398 bits (133), Expect = 4.881e-7
Identity = 47/226 (20.80%), Postives = 93/226 (41.15%), Query Frame = 1
Query: 4495 QISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWN------------GNMFIYNLNNYKKVAVLHNNKSTKS-IVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYS 5133
            +I  +AF     L++        +L++++  E +  L  HF+ +    F     RL++ S D  A++W    G  + VL GH G ++    +   +LI T SLD    +W  E               C+ +   ++ +V+  C+N            G   +++ + ++ +  L  +K   S + F+      LT +++    VW    G  L+V+   +   +S
Sbjct:  179 EIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGG------------QCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGACLQVLEGHSDEIFS 392          
BLAST of Telomerase protein component 1 vs. Ensembl Zebrafish
Match: wdr13 (WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-050522-274])

HSP 1 Score: 55.4546 bits (132), Expect = 6.396e-7
Identity = 52/196 (26.53%), Postives = 88/196 (44.90%), Query Frame = 1
Query: 4432 KKNKAFTYKKDISSLVYYLSDQISHVAF-----GSILNLISMSYESGLIQLFNLKQFEALLNLRHHF-----SRVNKTFFYNNDTRLISV-SEDG-LALVWSSIEGALLKV-LKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTE--KFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKV 4974
            +   A  +++ +S   Y L  Q++   +     GS++          +     L +  A   + H F     S V +  F N+D  L++  S DG L+++  S     +KV LKGH GPVTD   S   ++I + S D    +W TE  + + E +    S + C T  P N+   +VG    ++ + N++  KKV
Sbjct:   98 RAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDGTLSIMTLSPPPPTVKVTLKGHAGPVTDFAWSLSNDIIVSTSKDGTLRIWNTEDGRCIREVVDPEGSELLCCTFQPMNNNLTVVGNSKQHLQVVNISTGKKV 293          
BLAST of Telomerase protein component 1 vs. Ensembl Xenopus
Match: hs3st5 (heparan sulfate-glucosamine 3-sulfotransferase 5 [Source:Xenbase;Acc:XB-GENE-5795358])

HSP 1 Score: 283.878 bits (725), Expect = 6.917e-76
Identity = 215/818 (26.28%), Postives = 384/818 (46.94%), Query Frame = 1
Query:  463 MDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNS----SCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEINGKKIKL-----------------------------------------SLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETI------LKTNEKLIE----IELNSINKTKQKTLDRKN--------KVRNAIKLKKVSQRSV----VSENIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNET-----------------------------AIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDS--LVNRFQKNT---KCKSILKMSLDILSDNK---KGKITVTDLFDEMVAGRVQFDMILSFDVSIS----EQCVSQYIK-YNPSVLII------FNSINPPTETM---------------NCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFP-DAIPN-------EINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDY-EGLSVTNIE-YQFAS-------KNCQKIFLLKNSRDEDL 2475
            + L  ++S  DPEFILKV+LY R+ELNIRS +N+++AVS +    RP+L++Y  + + LP DW+E+   Y  ++      + LP+ L++ L  KF+ F+ YQL KY  ++   + + +K K+                                         S+K++++ LHI +P  +VM +LG  YP    +F  S L G W    +G++MK+  P+TW+ ++S+ GN   +W+KL+D+  +P+MA++RN+RN++++ I   +H +V   +  E  VI  ++ PF++ +AYK++++              N +LI+     E  SI + K+ T  R+          +R  +K KK + R +    + + I+++Y +AL +A++IS  YNI P+ G+ +IL  V+E+                                   +   S ++ EV  L++ M    SE+ ++ L  D   ++  F  ++       + K + D+ S  +   + K        E++A R + D +L F +S      +  + QY +  N   L +         +  P +                 +    N V + GF E  ++ +SE  +  ++  +  ++E++ +    +       VK S +F  + IP+        I IFISSTF DM  ER++I   +IP ++     +    + +  +DLRWG+     + ++ L  C+ ++ R  IF+GILG R G +P +  +  LSE Y  ++ Y  G S+T +E  QF          +C+  F L   RD DL
Sbjct:  339 LALCEELSNLDPEFILKVALYTRQELNIRSTANFMLAVSAFLPACRPHLRRYFCASVQLPADWMEIPRLYQSLAGQGEKLAPLPSCLRRVLTVKFQKFTEYQLAKYNTRRQRGKHSIRKPKVLNCQSTMKIGRNLRSVDKGLKLLQKKFSTPPTPKMKTKDRFSMKSLIQRLHISKPTHHVMGILGCKYPKDLYSFSKSGLEGPWQSDLSGQKMKLKQPQTWDRELSLKGNTGLVWEKLLDSDQVPFMALLRNLRNMIRAGISRQHHNQVTSRLSSERAVIKSRMFPFRFLSAYKVIQDLENQCHVSGKPFPVNVRLIKNIVTSEAASIPELKRYTWSRRQLRGCLAVPAIRQLLKRKKEALRKLRACKMDQAILQKYKKALESAVKISARYNITPLPGRTVILFYVSESMDKPCHGAKDLSVMLEDVSEDVSSDDSSQQSREEIRRHRSPTLLEVGLLLSGMVRDTSESAQVVLFNDQTYILAEFNSSSLLHNVSHLKKQAEDLKSQGRYSSRNKNVAKKYLMELLANRTKVDTLLLFRLSPPSAEFKSVLKQYRREVNTDCLCVTVVPENLQRVEEPDQRSEESHSESSAQEIGEESFDQCNDVVLHGFTEQVLRYVSERGTVRLLDHVAKVNERFQVPEDPD------SVKRSHDFGHEVIPSPITQRWRSIRIFISSTFRDMHSERNLIIGQVIPELRSRAACHY---LSVEEVDLRWGITEEETRKDRQLHLCLSEVCRSQIFIGILGERYGHVPKTYSLPLLSE-YEWIQRYPPGRSITELEAMQFLQNSDTENPGHCKAFFYL---RDADL 1143          

HSP 2 Score: 168.318 bits (425), Expect = 1.010e-40
Identity = 181/816 (22.18%), Postives = 344/816 (42.16%), Query Frame = 1
Query: 3244 VTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFR---VYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE-DKKGRIIIKNSFIGNLITK-YSMSIDKT-VVHCIISIYCDEMLKFDDKFA--------FRDIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKLWFDIC----NRQTYK----DFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSN-TKPVILKKNKAFTYKKDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGY----------NSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKL-QKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGL 5589
            +T+ IDG D L   +  +T  WIP  LP +  ++++    S+L  S   +K++V   +  +    + +++ + L   GK L+ + F+N M    +K+ +  P++L +A   +     ++++ ++I+ LP+TL  LI   L+S+E+E       +  + +  S+ G   +DL  ++S       V+  K N +L A     F  A NLP+      +  +++   + L       R+ + +  + + + K Y M  D T   H +++ +   +   +D  +          ++ ++   S        LLT++ +L+    LG+   L   Y+ +E    +      D      +RQ  K     F+ FI  +L  L +NPS   QQA+NEP   C  V C + ++I  N    T  + +  N    Y     S    +   +  V+      + ++   SG + L N    E +  L      V+   F ++D   +  S DG+  +W   +G  +   + H   +T C VS     + T SLD Q  +W+T +  L   +    P+ C T HP     V VG W+G + +  L N++K AVL  + S +++ F       ++ +++G +++W+    ++L      +   +S    +   LQ  ++         + VWS  LG           NS+   L     V  + Q +  G   G +S+ + +  + + Q +I DV +  +        LS    VT   +    + ++       + +   H R V  + +    + S S D S+ L
Sbjct: 1368 LTLLIDGADLLCGRAGETTSEWIPEHLPQRINLVLSVTEGSSLGYSLARQKDTVSISLTSLQPSDRAELVRHWLAVYGKKLEESAFNNQMRLLLIKKGTKHPLYLTMACEELRATAVFERLSDDIEKLPATLPALIQRRLESLEQEHGVTTVSIALAVICLSRKGLPERDLLRILSSLQALNCVFTAKWNAMLAA-----FAGAQNLPMATFALLLRGVRSVLGLWLPALTSDHRLHLPSCLLRDAVEKRYLMKRDVTKAAHLLMAAHFWTVCSPEDPDSVPVINAECLSELSHHLLCSEQLHTLGWLLTHLPFLRVHAALGLLPHLCQVYSMYEILEQKNGPTTKDCTIHELDRQVSKLPVDVFREFIHNSLPVLSKNPSLFYQQALNEP--DCSPV-CFQARVIIDNRKECTSHLTMLWNNKPAYMSICRSKSLEIPSLLGCVSLSPSGRMAAVGASSGALHLINTDSGEEVRILHSGCDGVSACNFISDDLLCVG-SYDGILEIWKISDGCRMHRAEAHRRQITGCCVSPDQRQLITCSLDYQLKLWETSRGSLLGSISFPYPLACTTFHPRGHV-VAVGSWDGKITVLRLENWEKTAVLCGSSSVRTVSFSQDGKWLISGSLDGWVSLWAWEAQVQLS-----HFKAHSGSTLTCSFLQQGKYLLTGGEDSKVQVWSGGLGRLLGRVDGEIKNSSAISL----AVSPSRQLLAVGYHTGTVSVYSVDLGDLVAQTSIEDVTILCVAW------LSEEVLVTGTSDSLVRVWKISSGQFTCQLMLKEHQRFVQALAVSSKLLASASGDVSVCL 2158          
BLAST of Telomerase protein component 1 vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 61.2326 bits (147), Expect = 1.221e-8
Identity = 51/217 (23.50%), Postives = 98/217 (45.16%), Query Frame = 1
Query: 4504 HVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKT--EKFVLEKILKTKSPINCITSHPN-NDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGE-INVWSSTNGMKLKVISMENKNYYSNVQ 5142
            +V F  +   ++ +     +++++++  + L + + H + VN   F+ +   L++ S DG   +   +EG L+  L GH GPV     S   +   + + D+Q ++WKT  +K+ +++I+K +    C  + P+ ND                   Y K   LH + S  SI  +P ++L  T T +   I+V     G         NK+Y  N++
Sbjct:  149 YVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKSGDQFASGATDAQVLVWKTNFDKYNIKEIVKLQQKRTCPEAPPHLNDI------------------YPKTPHLHTS-SGHSIEINPMFELADTQTFDPPIIDV-----GANFPYCRQVNKDYCGNLE 341          
BLAST of Telomerase protein component 1 vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 60.4622 bits (145), Expect = 2.140e-8
Identity = 45/190 (23.68%), Postives = 88/190 (46.32%), Query Frame = 1
Query: 4504 HVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKT--EKFVLEKILKTKSPINCITSHPN-NDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEI 5064
            +V F  +   ++ +     +++++++  + L + + H + VN   F+ +   L++ S DG   +   +EG L+  L GH GPV     S   +   + + D+Q ++WKT  +K+ +++I+K +    C  + P+ ND                   Y K   LH + S  SI  +P ++L  T T +  I
Sbjct:  191 YVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKSGDQFASGATDAQVLVWKTNFDKYNIKEIVKLQQKRTCPEAPPHLNDI------------------YPKTPHLHTS-SGHSIEINPMFELADTQTFDPPI 361          
BLAST of Telomerase protein component 1 vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 60.4622 bits (145), Expect = 2.934e-8
Identity = 45/190 (23.68%), Postives = 88/190 (46.32%), Query Frame = 1
Query: 4504 HVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKT--EKFVLEKILKTKSPINCITSHPN-NDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEI 5064
            +V F  +   ++ +     +++++++  + L + + H + VN   F+ +   L++ S DG   +   +EG L+  L GH GPV     S   +   + + D+Q ++WKT  +K+ +++I+K +    C  + P+ ND                   Y K   LH + S  SI  +P ++L  T T +  I
Sbjct:  191 YVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKSGDQFASGATDAQVLVWKTNFDKYNIKEIVKLQQKRTCPEAPPHLNDI------------------YPKTPHLHTS-SGHSIEINPMFELADTQTFDPPI 361          
BLAST of Telomerase protein component 1 vs. Ensembl Xenopus
Match: ENSXETT00000036352.1 (WD repeat domain 38 [Source:NCBI gene;Acc:100493075])

HSP 1 Score: 56.225 bits (134), Expect = 1.419e-7
Identity = 48/214 (22.43%), Postives = 89/214 (41.59%), Query Frame = 1
Query: 4612 HFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKS-PINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNK-STKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSP-----FFGINVWSTTLGY 5232
            H   VN      +   L++ S+D    +W +  G L + + GH GPV  C  S    L  + S D    +WK +      +L+  S  +  +   P++ + ++ G W+    ++ + N +K  V H ++ + +   F        T + +  + VW + N    K++     N  S V +S  G+ V E+     P      FG +V + +  Y
Sbjct:   20 HKGEVNSCALSPDCHLLLTCSDDSRIHLWEAKSGTLKQKVTGHTGPVKSCCFSPDGLLFASSSHDCTVRIWKVDTVECLHVLRDHSKSVETVCFSPDSRY-LLSGGWDCTAILWEVQNGQKRKVYHGHRDAIQCGAFSLNGSYIATGSWDYTVRVWIAQNKGTDKILEGHKSN-VSCVCFSISGMLVREYEGPLVPGTKQFVFGTHVMAPSSSY 231          
BLAST of Telomerase protein component 1 vs. Ensembl Mouse
Match: Tep1 (telomerase associated protein 1 [Source:MGI Symbol;Acc:MGI:109573])

HSP 1 Score: 399.053 bits (1024), Expect = 2.715e-111
Identity = 427/1908 (22.38%), Postives = 804/1908 (42.14%), Query Frame = 1
Query:  445 INNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKY--------------------------RNK---KMVAEINGKKI----------------KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETI------LKTNEKLIEIELNSINKTKQKTLDRKN-------KVRNA--------------IKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILI--LANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIY----LVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKI-TVTDLFDEMVAGRVQFDMILSFD-------VSISEQCVSQYIKYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGL---KNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEY-------QFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINNSILSECHGEQTRYKSIMKETLTFLKSYTENIESFQKDEVNQLLLIVEKK-LSFEIDIDSPVNC----------QSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMKSYLKKELQAHNEINSE------EFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNF---LLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE---DKKG-RIIIKNSFIGNLITKY---SMSIDKTVVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKLWFDICNRQTYKD---FKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKK-NKAFTYKKDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHN-NKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRP---------VIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLDSILTIDVCKELI 5685
            +   S +++   ++  +PEFILK SLY R++LN+R I+N ++AV+      RP++++Y  +I++LP+DW++V   Y  ++         LP  L+ A+ +KF +F  YQL KY                          R K   K +  +  ++I                + +LK +V  LHI +P ++V +LLG  YP T + F  S LPG W+ S+AG+RMK+  PETWE ++S+ GNK  +W++LIDN  LP+MAM+RN+ NLL++ I   +H  V Q ++ E +V+H +  PF++  A+  +++    +        +N  L++  +   +K  ++   RK+       ++R A              ++L K  Q +   E +++RY +AL TA+ +S  +N+ P+ G+ L+  L + N   +  P  +     +  V+ L+  M   A + T        VK  ++   +   K    L+  +  L  N +  + T       +   R   D ++ F        + +++Q + Q++  N   L +   +          + N V + G  +  +K I+E  +  +++ +  +D+ + +       +  +  PL ++ P     I       I +FISSTF DM  ER ++   ++P+++  +     + I ++ IDLRWG+     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E        Q +  + Q +      RD D     L S  D    +         + +++ K             ++ Q E+       C      +  +        + YT  +E F +  +  +  +++K+ L     ++ P +           Q   TP S        D  +  LL  G + ++ G+ G GKT+ ++ L+S   ++   PN   F++        +                 + L  NL   + ++L+++L   + + S       E  + + +K A  +               + + IDG D L D +      WIP  LP +  ++++  S+S L  + +  + + +  +  +    + +++   L   GK L+ +PF+N M     K+ S+ P++L +  +++ L T Y++V E +  LP+TL  L+ + L ++E+E   ++     + L  ++SG T+  L  ++S +  +  E  ++   L  ++  N F      PLC    P  Y+      LL E   ++ G R+ + +  +   I +     + ++KT  H +I+ +  +    D    FR        D+ Y+  +S  +      LTN+  +    ++G+   LL  +  +  +  E N+       +    D   F TF+ +  + L + P   +QQA ++P  S V   C +  ++   + +     LK  NK  T K    SL   +S   + VAF       ++   SG I L NLK ++    +      ++ +F + +DT L   + DG   +W    G  +   K H   +T C +S    L+ TV L     +W T +  L         +NC+  HP     V  G W G++  +  +  K    L     S  S+ F+    +     I+G + +W+   G +L                        + G   +  F                       + A D+F+  G   G+   L S F  + +           CL   + PLS    V ++ + +   +   ED I I K+ S    P           +++L P+ ++SG++D S+    FK  +    L L + +   +L +   +EL+
Sbjct:  272 LTRASILEVCSALASLEPEFILKASLYARQQLNLRDIANTVLAVAALLPACRPHVRRYYSAIVHLPSDWIQVAEFYQSLAEGDEKKLVSLPACLRAAMTDKFAEFDEYQLAKYNPRKHRSKRRSRQPPRPQKTERPFSERGKCFPKSLWPLKNEQITFEAAYNAMPEKNRLPRFTLKKLVEYLHIHKPAQHVQALLGYRYPATLELFSRSHLPGPWESSRAGQRMKLRRPETWERELSLRGNKASVWEELIDNGKLPFMAMLRNLCNLLRTGISARHHELVLQRLQHEKSVVHSRQFPFRFLNAHDSIDKLEAQLRSKASPFPSNTTLMKRIMIRNSKKNRRPASRKHLCTLTRRQLRAAMTIPVMYEQLKREKLRLHKARQWNCDVE-LLERYRQALETAVNLSVKHNLSPMPGRTLLVYLTDANADRL-CPKSHSQGPPLNYVLLLIGMMVARAEQVTVCLCGGGFVKTPVLTADEGILKTAIKLQAQVQELEGNDEWPLDTFGKYLLSLAVQRTPIDRVILFGQRMDTELLKVAKQIIWQHV--NSKCLFVGVLLQKTQYISPNLNPNDVTLSGCTDGILKFIAEHGASRLLEHVGQLDKLFKIPPPPGKTQAPSLRPLEENIPGPLGPISQHGWRNIRLFISSTFRDMHGERDLLMRSVLPALQARVF---PHRISLHAIDLRWGITEEETRRNRQLEVCLGEVENSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQFLNRGQRSQPSAQALIYF---RDPDF----LSSVPDAWKPDFISESEEAAHRVSELK-----------RYLHEQKEVT------CRSYSCEWGGVAAG-----RPYTGGLEEFGQLVLQDVWSMIQKQHLQPGAQLEQPTSISEDDLIQTSFQQLKTPTSPARPRLLQDTVQQLLLPHGRLSLVTGQAGQGKTAFLASLVSAL-KVPDQPNEPPFVFFHFAAARPD-----------------QCLALNLLRRLCTHLRQKLGELSALPSTYRGLVWELQQKLLLKFAQSLQPAQT----------LVLIIDGADKLVDRNGQLISDWIPKSLPRRVHLVLSVSSDSGLGETLQQSQGAYVVALGSLVPSSRAQLVREELALYGKRLEESPFNNQMRLLLAKQGSSLPLYLHLVTDYLRLFTLYEQVSERLRTLPATLPLLLQHILSTLEQEHGHDVLPQALTALEVTRSGLTVDQLHAILSTWLILPKETKSWEEVLAASHSGNPF------PLC----PFAYLVQSLRSLLGEGPVERPGARLCLSDGPLRTTIKRRYGKRLGLEKT-AHVLIAAHLWKTCDPDASGTFRSCPPEALKDLPYHLLQSGNHGLLAEFLTNLHVVAAYLEVGLVPDLLEAHVLYASSKPEANQ-------KLPAADVAVFHTFLRQQASLLTQYPLLLLQQAASQPEESPV---CCQAPLLTQRWHDQ--FTLKWINKPQTLKGQ-QSLSLTMSSSPTAVAFSPNGQRAAVGTASGTIYLLNLKTWQEEKAVVSGCDGIS-SFAFLSDTALFLTTFDGHLELWDLQHGCWVFQTKAHQYQITGCCLSPDRRLLATVCLGGYLKLWDTVRGQLAFQYTHPKSLNCVAFHPEGQV-VATGSWAGSITFFQADGLKVTKELGAPGPSVCSLAFNKPGKIVAVGRIDGTVELWAWQEGARLAAFPA-------------------QCGCVSAVLF-----------------------LHAGDRFLTAGED-GKAQ-LWSGFLGRPRG----------CL--GSLPLSPALSVALNPDGDQVAVGYREDGINIYKISSGSQGPQHQELNVAVSALVWLSPSVLVSGAEDGSLHGWMFKG-DSLHSLWLLSRYQKPVLGLAASRELM 2032          
BLAST of Telomerase protein component 1 vs. Ensembl Mouse
Match: Tep1 (telomerase associated protein 1 [Source:MGI Symbol;Acc:MGI:109573])

HSP 1 Score: 80.1073 bits (196), Expect = 1.696e-14
Identity = 51/191 (26.70%), Postives = 97/191 (50.79%), Query Frame = 1
Query: 1882 NIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLK---NIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIE-YQFASKN 2430
            N V + G  +  +K I+E  +  +++ +  +D+ + +       +  +  PL ++ P     I       I +FISSTF DM  ER ++   ++P+++  +     + I ++ IDLRWG+     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E  QF ++ 
Sbjct:  114 NDVTLSGCTDGILKFIAEHGASRLLEHVGQLDKLFKIPPPPGKTQAPSLRPLEENIPGPLGPISQHGWRNIRLFISSTFRDMHGERDLLMRSVLPALQARVF---PHRISLHAIDLRWGITEEETRRNRQLEVCLGEVENSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQFLNRG 301          
BLAST of Telomerase protein component 1 vs. Ensembl Mouse
Match: Wdr38 (WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:1923896])

HSP 1 Score: 70.0922 bits (170), Expect = 6.376e-12
Identity = 48/189 (25.40%), Postives = 86/189 (45.50%), Query Frame = 1
Query: 4612 HFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKT-KSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNN-KSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMEN-KNYYSNVQ---YSSDGL 5160
            H   VN + F  +   L++ S+DG   VW +  G LL  L GH GPV  C  S    LI + S D    +W   +     +LK  +  +  ++  P++  ++  G W+    ++ + + ++V +L  +  S +S  F P  D   T + +  +++W         V+S  N + +  N+    YS+ GL
Sbjct:   25 HHGEVNCSAFSPDGRTLLTASDDGCVYVWGTKSGRLLWRLAGHRGPVKSCCFSPDGRLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSK-QLASGGWDKRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLR--ASTPVVSYHNLEGHTGNISCLCYSASGL 210          
BLAST of Telomerase protein component 1 vs. Ensembl Mouse
Match: Wdr38 (WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:1923896])

HSP 1 Score: 70.0922 bits (170), Expect = 6.376e-12
Identity = 48/189 (25.40%), Postives = 86/189 (45.50%), Query Frame = 1
Query: 4612 HFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKT-KSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNN-KSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMEN-KNYYSNVQ---YSSDGL 5160
            H   VN + F  +   L++ S+DG   VW +  G LL  L GH GPV  C  S    LI + S D    +W   +     +LK  +  +  ++  P++  ++  G W+    ++ + + ++V +L  +  S +S  F P  D   T + +  +++W         V+S  N + +  N+    YS+ GL
Sbjct:   25 HHGEVNCSAFSPDGRTLLTASDDGCVYVWGTKSGRLLWRLAGHRGPVKSCCFSPDGRLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSK-QLASGGWDKRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLR--ASTPVVSYHNLEGHTGNISCLCYSASGL 210          
BLAST of Telomerase protein component 1 vs. Ensembl Mouse
Match: Wdr5b (WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:1916794])

HSP 1 Score: 60.4622 bits (145), Expect = 1.033e-8
Identity = 53/217 (24.42%), Postives = 90/217 (41.47%), Query Frame = 1
Query: 4489 SDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKS-PINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVL--HNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYY 5130
            S  IS V F      ++ S    LI ++          L  H   ++   + ++ +RL+S S+D    VW    G  LK LKGH   V  C  +  +NLI + S D    +W+ +     K L   S PI+ +  + N    ++ G ++G   I++  + + +  L    N     + F P     LT T++  + +W  + G  LK  +      Y
Sbjct:   39 SAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSL-IVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKY 254          

HSP 2 Score: 53.5286 bits (127), Expect = 2.050e-6
Identity = 43/189 (22.75%), Postives = 87/189 (46.03%), Query Frame = 1
Query: 4597 LNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSP-INCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIV-FHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDG 5157
            L L  H + ++   F  N   L S + D L ++W + +G   K L GH   ++D   S+ ++ + + S D    +W        K LK  S  + C   +P ++  ++ G ++ ++ I+ +   K +  L  +    S V F+    L ++ + +G   +W + +G  L+ ++ E     S V++S +G
Sbjct:   33 LTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNL-IVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNG 220          
BLAST of Telomerase protein component 1 vs. UniProt/SwissProt
Match: sp|Q99973|TEP1_HUMAN (Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2)

HSP 1 Score: 408.297 bits (1048), Expect = 2.893e-113
Identity = 444/1970 (22.54%), Postives = 812/1970 (41.22%), Query Frame = 1
Query:  445 INNLSKMDLYV--DISKE----DPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKYRNKKMVA------------------------------------EINGKKI-------KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFN-----------------ETILKTNEK-------LIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIP--PIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDE---------------MVAGRVQFDMILSFDVSISEQCVS-----QYIKYNPSVL---IIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKY------GLKNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINN--SILSECHGEQTRYKSIMKETLTFLKSYTENIESFQK-------DEVNQLLL----IVEKKLSFEIDIDSPVNCQSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNL--PFPMKSYLKK---ELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE---DKKG-RIIIKNSFIGNLITKYSMSIDKT-----VVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEET-NSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYK-KDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHN-NKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDIT-----CVDANDQFIVCGTKFGEISILN-SNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLD--------SILTIDVCKELILVGCKDGSXX--XXXXXXXXXXNHEIKA-HNDWITTVRFNSFNYFLSGSND 5829
            +NN S   L    +I +E    +PEFILK SLY R++LN+R+++N ++A++ +    RP+L++Y  +I+ LP+DW++V   Y  ++         LP  L+ A+ +KF  F  YQL KY  +K  A                                    E  G  +       + +LK +V+ LHI +P ++V +LLG  YP     F  S+LPG WD S+AGKRMK+  PETWE ++S+ GNK  +W++LI+N  LP+MAM+RN+ NLL+  I   +H  + Q ++   +VIH +  PF++  A+  ++                      IL  NEK       L  +    +    +  +  +   R  +++ K  Q     E ++ RY +AL TA+ +S  +++P  P R  ++ L + N   +  P        +   + L+  M   A +   +    D+L           ++LK    IL    K +  V + FDE               +   RV  D ++    S+ +  ++      + + N   L   I+   +   +  +N    N V + G  +  +K I+E  +  +++ +  MD+ +      G   ++ L    PL +D+P+    +  +    I +FISSTF DM  ER ++   ++P+++        + I ++ IDLRWGV     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E           FL +N R +      L  FRD+             +V + +K      +  + E       I+   S LS   G   R        +   + Y   +E F +       + + +L L    ++E+ +S   D       Q    P S        D  +  +L  G + ++ G+ G GKT+ ++ L+S      + P+  K   +  V    +  +        LL  +  +L   L  P  + S  +    ELQ      S E   P   +                      + IDG D L D +      WIP  LP    ++++  S++ L  + +  + + +  + P+    + +++   L   GK L+ +PF+N M    +KR+S +P++L++  +H+ L T Y++V E +  LP+T+  L+ + L ++EKE   ++     + L  ++SG T+  L  ++S++                + +   A N    + M P   +      LL E   ++ G R+ + +   G L T       K        H +I+    +    D    FR        D+ Y+  +S         LTN+  +    +LG+   LL  +  +  +   E  KL            F+TF+ +  + L + P    QQA N+PL S +   C++  ++   + + +  +   NK  T K +  SSL   +S   + VAF +     ++   +G + L +L+ ++   ++      ++   F ++DT L   + DGL  +W    G  +   K H   +T C +S    L+ TV L     +W T +  L         +NC+  HP     +  G W G++  + ++  K    L     S +++ F+    +     ++  + +W+   G +L      +  + +   +   G Q+   G        + VWS +LG        L ++      +  +   +  G +   I I   S+ +   Q    DVA++++        LS    V+   + +     + E ++    + S   +PV+ +      + S S+D ++ L   +      K + F    +        S  +       +  G +D S+    ++  K  +L H   A H DW+T   +   N  +S S+D
Sbjct:  262 MNNTSDPTLAAIFEICRELALLEPEFILKASLYARQQLNVRNVANNILAIAAFLPACRPHLRRYFCAIVQLPSDWIQVAELYQSLAEGDKNKLVPLPACLRTAMTDKFAQFDEYQLAKYNPRKHRAKRHPRRPPRSPGMEPPFSHRCFPRYIGFLREEQRKFEKAGDTVSEKKNPPRFTLKKLVQRLHIHKPAQHVQALLGYRYPSNLQLFSRSRLPGPWDSSRAGKRMKLSRPETWERELSLRGNKASVWEELIENGKLPFMAMLRNLCNLLRVGISSRHHELILQRLQHAKSVIHSRQFPFRFLNAHDAIDALEAQLRNQALPFPSNITLMRRILTRNEKNRPRRRFLCHLSRQQLRMAMRIPVLYEQLKREKLRVHKARQWKYDGE-MLNRYRQALETAVNLSVKHSLPLLPGRTVLVYLTDANADRL-CPKSNPQGPPLNYALLLIGMMITRAEQVDVVLCGGDTLKT---------AVLKAEEGILKTAIKLQAQVQE-FDENDGWSLNTFGKYLLSLAGQRVPVDRVILLGQSMDDGMINVAKQLYWQRVNSKCLFVGILLRRVQYLSTDLN---PNDVTLSGCTDAILKFIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSL---RPLEEDTPSPLAPVSQQGWRSIRLFISSTFRDMHGERDLLLRSVLPALQARA---APHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVENAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVM--------QFLNRNQRLQP-SAQALIYFRDSSF---------LSSVPDAWK------SDFVSESEEAARRISELKSYLSRQKGITCRRYPCEWGGVAAGRPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARPRLLQDTVQRLMLPHGRLSLVTGQSGQGKTAFLASLVSAL----QAPDGAKVASL--VFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRLLPKSAESLHPGQTQ---------------------VLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQSQGAHVLALGPLEASARARLVREELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVW-------RTLPKGTKSWEEAVAAGNSGDPYPMGPFACLVQSLRSLLGEGPLERPGARLCLPD---GPLRTAAKRCYGKRPGLEDTAHILIAAQLWKTCDADASGTFRSCPPEALGDLPYHLLQSGNRGLLSKFLTNLHVVAAHLELGLVSRLLEAHALYASSVPKEEQKL-----PEADVAVFRTFLRQQASILSQYPRLLPQQAANQPLDSPL---CHQASLLSRRW-HLQHTLRWLNKPRTMKNQQSSSLSLAVSSSPTAVAFSTNGQRAAVGTANGTVYLLDLRTWQEEKSVVSGCDGISACLFLSDDT-LFLTAFDGLLELWDLQHGCRVLQTKAHQYQITGCCLSPDCRLLATVCLGGCLKLWDTVRGQLAFQHTYPKSLNCVAFHPEGQV-IATGSWAGSISFFQVDGLKVTKDLGAPGASIRTLAFNVPGGVVAVGRLDSMVELWAWREGARLAAFPAHH-GFVAAALFLHAGCQLLTAGEDGK----VQVWSGSLGRPRGHLGSLSLSPALSVALSPDGDRVAVGYRADGIRIYKISSGSQGAQGQALDVAVSALAW------LSPKVLVSGAEDGSLQGWALKECSLQSLWLLSRFQKPVLGLATSQELLASASEDFTVQLWPRQLLTRPHKAEDFPCGTELRGHEGPVSCCSFSTDGGSLATGGRDRSLLCWDVRTPKTPVLIHSFPACHRDWVTGCAWTKDNLLISCSSD 2127          
BLAST of Telomerase protein component 1 vs. UniProt/SwissProt
Match: sp|O08653|TEP1_RAT (Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 7.589e-112
Identity = 404/1697 (23.81%), Postives = 727/1697 (42.84%), Query Frame = 1
Query:  493 DPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEINGKKI---------------------------------------------KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEF-------------NETILK----TNEKLIEIELNS--INKTKQKTLDRKNKV--------RNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILIL----ANVNETAIYS-----PFKYGSSKSVKEVIALVTSMCYVASEATEIYL-----VKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKI-TVTDLFDEMVAGRVQFDMILSFD-------VSISEQCVSQYIKYNPSVLIIFNSINPPTETMNCKSSNI----VRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFPDA-IP------NEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNK--IILEKINFQNEINN--SILSECHGEQTRYKSIMKETLTFLKSYTENIESFQKDEVNQLLLIVEKK-LSFEIDIDSP----------VNCQSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWI-FDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMKSYLKKELQAHNEINSE------EFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE---DKKG-RIIIKNSFIGNLITKY---SMSIDKTVVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKK-NKAFTYKKDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHN-NKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISME 5115
            +PEFILK SLY R++LN+R I+N ++AV+      RP++++Y  +I++LP+DW++V   Y  ++         LP  L+ A+ +KF  F  YQL KY  +K  ++   ++                                              + +LK +V  LHI EP ++V +LLG  YP T + F  S LPG WD S+AG+RMK+  PETWE ++S+ GN+  +W++LIDN  LP+MAM+RN+ NLL++ I  H+H  V Q ++ E +VIH +  PF++  A+  L+               N T++K     N K I+   N   +    Q+ L     +        R  ++L K  Q +   E +++RY +AL TA+ IS  +N+PP+ G+ L++    AN N     S     P  Y         + L+  M    +E T ++L     VK  ++   +   K    L+  +  L +N +  + T       +   R   D ++ F        +++++Q + Q++        +F S+      M   S N+    V + G  +  +K I+E  +  +++ +  +D+ + +          PL     N P   +P        I +FISSTF DM  ER ++   ++P+++        + I ++ IDLRWG+     +  + L+ C+ +++   +FVGILGSR G+ P S  + +    +   +   G SVT +E           FL +  R E  D   L  FRD                   F   +P + K   I E     + ++     L E      R  S     +   + YT  +E F +  +  +  +++K+ L     ++ P           + Q   +P S        D  +  +L  G + ++ G+ G GKT+ ++ L+S   ++   PN   F++  F   +                    + L +NL   + ++L ++L   + + S       E  + + +K A  +               + + IDG D L D +      WIP  LP +  ++++  S+S L  + +  +++ +  +  +    + +++   L   GK L+ +PF+N M     K+ S+ P++L +  +++ L T Y++V E +  LP+TL  L+ + L ++E+E    +     + L  + SG T+  L  ++S +  +  E  +       + +   AS+    + + P  Y+      LL E   ++ G R+ + +  +   + +     + ++KT  H +I+ +  +M   D    FR        D+ Y+  +S  +      LTN+  +    ++G+   LL  Y  +  +  E N+             F  F+ +  + L + P   +QQA ++P  S V   C +  ++   + N    ILK  NK  T K    SL   +S   + VAF       ++    G I L NL+ ++    L      ++ +F + +DT L   + DGL  +W    G  +   K H   +T C +S    L+ TV L     +W T +  L         +NCIT HP     V  G W+G +  +  +  K    L     S +++ F     +     I+G + +W+   G +L     +
Sbjct:  292 EPEFILKASLYARQQLNLRDIANIVLAVAALLPACRPHVRRYYSAIVHLPSDWIQVAEFYQSLAEGDEKKLVPLPACLRAAMTDKFAQFDEYQLAKYNPRKHRSKTRSRQPPRPQRTKPPFSESGKCFPKSVWPLKNEQISFEAAYNAVSEKKRLPRFTLKKLVEQLHIHEPAQHVQALLGYRYPSTLELFSRSHLPGPWDSSRAGQRMKLQRPETWERELSLRGNRASVWEELIDNGKLPFMAMLRNLCNLLRTGISAHHHELVLQRLQHEKSVIHSRQFPFRFLNAHDSLDRLEAQLRSKASPFPSNTTLMKRIMIRNSKKIKRPANPRYLCTLTQRQLRAAMAIPVMYEHLKREKLRLHKARQWTCDLE-LLERYRQALETAVNISVKHNLPPLPGRTLLVYLTDANANRLCPKSHLQGPPLNY---------VLLLIGMMMARAEQTTVWLCGTGTVKTPVLTADEGILKTAIKLQAQVQELEENDEWPLETFEKYLLSLAVRRTPIDRVILFGQRMDTELLNVAKQIIWQHVNSK----CLFVSVL--LRKMQYMSPNLNPNDVTLSGCTDGILKFIAEHGASRLLEHVGQLDKIFKIPPPPGKTKVSPLRPLEENNPGPFVPISQHGWRNIRLFISSTFRDMHGERDLLMRSVLPALQARAF---PHRISLHAIDLRWGITEEETRRNRQLEVCLGEVENSQLFVGILGSRYGYTPPSYDLPDHPHFHWTQRYPSGRSVTEMEVM--------QFLNRGQRSEPSDQ-ALIYFRD-----------------PGFLSSVPDVWKPDFISESEEAAHRVSELKRFLQEQKEVTCRRYSCEWGGVAAGRPYTGGLEEFGQLVLQDVWSVIQKRYLQPGAQLEQPGSISEEDLIQASFQQLKSPPSPARPRLLQDTVQQLMLPHGRLSLVIGQAGQGKTAFLASLVSAL-KVPDQPNVAPFVFFHFSAAR------------------PDQCLAFNLLRRLCTHLHQKLGEPSALPSTYRGLVWELQQKLLLKSAQWLQPGQT----------LVLIIDGADKLVDHNGQLISDWIPKSLPRRVHLVLSVSSDSGLGETLQQSQSAYVVALGSLVPSSRAQLVREELALYGKRLEESPFNNQMRLLLAKQGSSLPLYLHLVTDYLRLFTLYEQVSERLRTLPATLPLLLQHILSTLEQEHGHNVLPQALTALEVTHSGLTVDQLHAVLSTWLTLPKETKS-------WEEAVAASHSGNLYPLAPFAYLVQSLRSLLGEGPVERPGARLCLSDGPLRTAVKRRYGKRLGLEKT-AHVLIAAHLWKMCDPDASGTFRSCPPEALKDLPYHLLQSGNHGLLAKFLTNLHVVAAYLEVGLVPDLLEAYELYASSKPEVNQ----KLPEADVAVFHNFLKQQASLLTQYPLLLLQQAASQPEESPV---CCQAPLLTQRWHNQ--CILKWINKPQTLKGQ-QSLSLPISSSPTAVAFSPNGQRAAVGTAGGTIYLLNLRTWQEEKALVSGCDGIS-SFAFLSDTALFLTTFDGLLELWDLQHGCWVFQTKAHQYQITGCCLSPDRRLLATVCLGGYVKLWDTVQGQLAFQYTHPKSLNCITFHPEGQV-VATGNWSGIVTFFQADGLKVTKELGGPGPSVRTLAFSAPGKVVALGRIDGTVELWAWQEGTRLAAFPAQ 1894          
BLAST of Telomerase protein component 1 vs. UniProt/SwissProt
Match: sp|P97499|TEP1_MOUSE (Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 1.899e-110
Identity = 427/1908 (22.38%), Postives = 804/1908 (42.14%), Query Frame = 1
Query:  445 INNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKY--------------------------RNK---KMVAEINGKKI----------------KLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETI------LKTNEKLIEIELNSINKTKQKTLDRKN-------KVRNA--------------IKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILI--LANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIY----LVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKI-TVTDLFDEMVAGRVQFDMILSFD-------VSISEQCVSQYIKYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGL---KNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEY-------QFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINNSILSECHGEQTRYKSIMKETLTFLKSYTENIESFQKDEVNQLLLIVEKK-LSFEIDIDSPVNC----------QSFITPKST-------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMKSYLKKELQAHNEINSE------EFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNF---LLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDE---DKKG-RIIIKNSFIGNLITKY---SMSIDKTVVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKLWFDICNRQTYKD---FKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKK-NKAFTYKKDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHN-NKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRP---------VIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLDSILTIDVCKELI 5685
            +   S +++   ++  +PEFILK SLY R++LN+R I+N ++AV+      RP++++Y  +I++LP+DW++V   Y  ++         LP  L+ A+ +KF +F  YQL KY                          R K   K +  +  ++I                + +LK +V  LHI +P ++V +LLG  YP T + F  S LPG W+ S+AG+RMK+  PETWE ++S+ GNK  +W++LIDN  LP+MAM+RN+ NLL++ I   +H  V Q ++ E +V+H +  PF++  A+  +++    +        +N  L++  +   +K  ++   RK+       ++R A              ++L K  Q +   E +++RY +AL TA+ +S  +N+ P+ G+ L+  L + N   +  P  +     +  V+ L+  M   A + T        VK  ++   +   K    L+  +  L  N +  + T       +   R   D ++ F        + +++Q + Q++  N   L +   +          + N V + G  +  +K I+E  +  +++ +  +D+ + +       +  +  PL ++ P     I       I +FISSTF DM  ER ++   ++P+++  +     + I ++ IDLRWG+     +  + L+ C+ +++   +FVGILGSR G+IP S  + +    +   +   G SVT +E        Q +  + Q +      RD D     L S  D    +         + +++ K             ++ Q E+       C      +  +        + YT  +E F +  +  +  +++K+ L     ++ P +           Q   TP S        D  +  LL  G + ++ G+ G GKT+ ++ L+S   ++   PN   F++        +                 + L  NL   + ++L+++L   + + S       E  + + +K A  +               + + IDG D L D +      WIP  LP +  ++++  S+S L  + +  + + +  +  +    + +++   L   GK L+ +PF+N M     K+ S+ P++L +  +++ L T Y++V E +  LP+TL  L+ + L ++E+E   ++     + L  ++SG T+  L  ++S +  +  E  ++   L  ++  N F      PLC    P  Y+      LL E   ++ G R+ + +  +   I +     + ++KT  H +I+ +  +    D    FR        D+ Y+  +S  +      LTN+  +    ++G+   LL  +  +  +  E N+       +    D   F TF+ +  + L + P   +QQA ++P  S V   C +  ++   + +     LK  NK  T K    SL   +S   + VAF       ++   SG I L NLK ++    +      ++ +F + +DT L   + DG   +W    G  +   K H   +T C +S    L+ TV L     +W T +  L         +NC+  HP     V  G W G++  +  +  K    L     S  S+ F+    +     I+G + +W+   G +L                        + G   +  F                       + A D+F+  G   G+   L S F  + +           CL   + PLS    V ++ + +   +   ED I I K+ S    P           +++L P+ ++SG++D S+    FK  +    L L + +   +L +   +EL+
Sbjct:  272 LTRASILEVCSALASLEPEFILKASLYARQQLNLRDIANTVLAVAALLPACRPHVRRYYSAIVHLPSDWIQVAEFYQSLAEGDEKKLVSLPACLRAAMTDKFAEFDEYQLAKYNPRKHRSKRRSRQPPRPQKTERPFSERGKCFPKSLWPLKNEQITFEAAYNAMPEKNRLPRFTLKKLVEYLHIHKPAQHVQALLGYRYPATLELFSRSHLPGPWESSRAGQRMKLRRPETWERELSLRGNKASVWEELIDNGKLPFMAMLRNLCNLLRTGISARHHELVLQRLQHEKSVVHSRQFPFRFLNAHDSIDKLEAQLRSKASPFPSNTTLMKRIMIRNSKKNRRPASRKHLCTLTRRQLRAAMTIPVMYEQLKREKLRLHKARQWNCDVE-LLERYRQALETAVNLSVKHNLSPMPGRTLLVYLTDANADRL-CPKSHSQGPPLNYVLLLIGMMVARAEQVTVCLCGGGFVKTPVLTADEGILKTAIKLQAQVQELEGNDEWPLDTFGKYLLSLAVQRTPIDRVILFGQRMDTELLKVAKQIIWQHV--NSKCLFVGVLLQKTQYISPNLNPNDVTLSGCTDGILKFIAEHGASRLLEHVGQLDKLFKIPPPPGKTQAPSLRPLEENIPGPLGPISQHGWRNIRLFISSTFRDMHGERDLLMRSVLPALQARVF---PHRISLHAIDLRWGITEEETRRNRQLEVCLGEVENSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQFLNRGQRSQPSAQALIYF---RDPDF----LSSVPDAWKPDFISESEEAAHRVSELK-----------RYLHEQKEVT------CRSYSCEWGGVAAG-----RPYTGGLEEFGQLVLQDVWSMIQKQHLQPGAQLEQPTSISEDDLIQTSFQQLKTPTSPARPRLLQDTVQQLLLPHGRLSLVTGQAGQGKTAFLASLVSAL-KVPDQPNEPPFVFFHFAAARPD-----------------QCLALNLLRRLCTHLRQKLGELSALPSTYRGLVWELQQKLLLKFAQSLQPAQT----------LVLIIDGADKLVDRNGQLISDWIPKSLPRRVHLVLSVSSDSGLGETLQQSQGAYVVALGSLVPSSRAQLVREELALYGKRLEESPFNNQMRLLLAKQGSSLPLYLHLVTDYLRLFTLYEQVSERLRTLPATLPLLLQHILSTLEQEHGHDVLPQALTALEVTRSGLTVDQLHAILSTWLILPKETKSWEEVLAASHSGNPF------PLC----PFAYLVQSLRSLLGEGPVERPGARLCLSDGPLRTTIKRRYGKRLGLEKT-AHVLIAAHLWKTCDPDASGTFRSCPPEALKDLPYHLLQSGNHGLLAEFLTNLHVVAAYLEVGLVPDLLEAHVLYASSKPEANQ-------KLPAADVAVFHTFLRQQASLLTQYPLLLLQQAASQPEESPV---CCQAPLLTQRWHDQ--FTLKWINKPQTLKGQ-QSLSLTMSSSPTAVAFSPNGQRAAVGTASGTIYLLNLKTWQEEKAVVSGCDGIS-SFAFLSDTALFLTTFDGHLELWDLQHGCWVFQTKAHQYQITGCCLSPDRRLLATVCLGGYLKLWDTVRGQLAFQYTHPKSLNCVAFHPEGQV-VATGSWAGSITFFQADGLKVTKELGAPGPSVCSLAFNKPGKIVAVGRIDGTVELWAWQEGARLAAFPA-------------------QCGCVSAVLF-----------------------LHAGDRFLTAGED-GKAQ-LWSGFLGRPRG----------CL--GSLPLSPALSVALNPDGDQVAVGYREDGINIYKISSGSQGPQHQELNVAVSALVWLSPSVLVSGAEDGSLHGWMFKG-DSLHSLWLLSRYQKPVLGLAASRELM 2032          
BLAST of Telomerase protein component 1 vs. UniProt/SwissProt
Match: sp|Q94818|TE80_TETTH (Telomerase component p80 OS=Tetrahymena thermophila OX=5911 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 5.486e-28
Identity = 82/273 (30.04%), Postives = 144/273 (52.75%), Query Frame = 1
Query:  814 LSLKNMVRILHICEPVENVMSLLGKNYPLTQD---AFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKT--NEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSV--VSENIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNETAIYSPF----KYGSSKSVKEVIALVTSMCYVASEATEIYL 1599
            L+ K++++  HI EP E V  +LGK YP T++   A F       ++   AGKRMKI   +TWE ++S  GN  E+W  LI +  LPYMAM+RN+ N+L++ + D  H  V   I +   V + K+ P Q+F+A   +E  NE + K    +K   + L    +  ++ +++ ++ +  ++L++  +     V+E I K+Y  ++  AI+I+   N+  I+G   I ++V+ +   S      KYGS ++  E   ++  M     E +  Y+
Sbjct:  290 LTFKDLIKFCHISEPKERVYKILGKKYPKTEEEYKAAFGDSASAPFNPELAGKRMKIEISKTWENELSAKGNTAEVWDNLISSNQLPYMAMLRNLSNILKAGVSDTTHSIVINKICEPKAVENSKMFPLQFFSA---IEAVNEAVTKGFKAKKRENMNLKGQIEAVKEVVEKTDEEKKDMELEQTEEGEFVKVNEGIGKQYINSIELAIKIAVNKNLDEIKGHTAIFSDVSGSMSTSMSGGAKKYGSVRTCLECALVLGLMVKQRCEKSSFYI 559          

HSP 2 Score: 66.6254 bits (161), Expect = 2.668e-9
Identity = 37/119 (31.09%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  475 VDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVV--YHYMLISNSSCLPNQ-------------------LKKALINKFKDFSIYQLGKY 768
            +++++ DPEFI ++++Y R EL IR+ +NY+VA  V    ++P+++KY    + LP D LEV      + I +++   N                    L++ + +KF +F+ YQLGKY
Sbjct:   74 LEVAESDPEFICQLAVYIRNELYIRTTTNYIVAFCVVHKNTQPFIEKYFNKAVLLPNDLLEVCEFAQVLYIFDATEFKNLYLDRILSQDIRKELTFRKCLQRCVRSKFSEFNEYQLGKY 192          
BLAST of Telomerase protein component 1 vs. UniProt/SwissProt
Match: sp|Q54KD0|Y7407_DICDI (TPR repeat-containing protein DDB_G0287407 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287407 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.307e-11
Identity = 39/128 (30.47%), Postives = 69/128 (53.91%), Query Frame = 1
Query: 2068 EINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSK-----------VIRNLSEIYPELKDYEGLSVTNIEYQF 2418
            EI IFISS F DM+ +R  I  ++IP +++   L +   I ++ +DLRWGV  +  +    L  C++++++C+I +G+ G R GW    K            +    + +P +K+Y   S+T IE++ 
Sbjct:  368 EIKIFISSPFKDMQLDRDQIVKVVIPRIRK---LCIERDIVLSYVDLRWGVTSNQSEQSTGLSMCLKELEKCNILIGLFGERYGWSSQEKQDPKSQQLLQSTLDRAIQDFPWVKNYRDSSITEIEFRM 492          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: A0A369RW69 (Telomerase protein component 1 OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_008664 PE=4 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 2.690e-138
Identity = 534/2102 (25.40%), Postives = 929/2102 (44.20%), Query Frame = 1
Query:  283 DDFQSSDNL--------VISD-SNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS----CLPNQLKKALINKFKDFSIYQLGKY-RNKKMVAEINGKKIKLS-----------------------------------LKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTNEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNET---AIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDSL--VNRFQKNTKCKSILKMSLDILSDNKKGKITVT-DLFDEM-----VAGRVQFDMILSFDVSISE--------QCVSQYIK-YNPSVLIIFNSINPPTETMN----CKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPN-------FPDAIPN--EINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDY-EGLSVTNIEYQFA-----SKNCQKIF--LLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKI-NFQNEINNSILSECHGEQTRYKSIMKETLTFLKSYTENIESFQKDEVNQLLLIVEKKL-------SFEIDIDSPVNCQ---------SFITPKSTDKNENELLRSG--GILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMKSYLKKELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIH--EIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAI---LLDEDKKG-----RIIIKNSFIGNLI----TKYSMSIDKTVVHCIISIYCDEMLKFD----------DKFAFRDIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNG---FEETNSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHS-CVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYKKDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTE------KFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNN-KSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYN--SNEKDLLDITCV--DANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLL-KFKNYEVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSXXXXXXXXXXXXNHEIKAHNDWITTVRFNSF-NYFLSGSNDFTIKLWEIILMDTSNTNATFENSAKFNVLHVIGNHTGPITSISINSDDNFLSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKFLSTDYLLVVNA 6138
            DDF + D++          SD SNL +     C+I  A+  L  +  FK +  +     L +  N   K+ +Y      DPEFILKVSLY R+EL IR+ +N+L+A++      RPYLKKY  +II LP+DW+EV   Y  + + +     LP  L+K +++KF  F  YQL KY R K+  +  N K  K S                                   LK ++R LHI +P E+VM+L+GK YP+  ++F  S L G W+  +A KRMK+P PETWETQ+S++GNK   W+ LI+++ LP++A +RN+RNL+++ I D +H ++ + +E E++VI+ KL PF++FTA++ +  + +T              S         +RK K  N  K K+V  +  VSE ++KRY EAL+ A++++T +N+ PI G  LIL NV +       +    G  +++ EV  L+  M   + E +E  +  D+   ++ F  N    SIL+ +  I +  +K  IT + + F E      +  R+Q D ++      SE          +++Y +  NP++L +  +++      +        N V + GF++  +K +++      +  ++ +D  Y LK+I ++ N    V  S +       F   +P    + +FISSTF+DM  ER I+   + P ++     +  N  +   +DLRWG+     Q   +L+ C+ +++R   F+ ILG R GW P    +   SE +  +++Y    SVT +E Q A     S+  +K F  +  N+ + D+    L  F D+                          + I  EKI N +N +    +        ++  I+ +     K Y  N+E F    ++ L   +E+         +FE   D   N Q          FI  K   K  N+LL     GI++  GK G GKT++M+ L+      +         W   +I +     S                I NL       LK+      EI  + +   +   H  LI +             V IFIDG+D L  +  A  L W+P ++P     +++   N +   + + R + +IH  ++  I  + K   +  +L+K  K+L  + F+  M     KR+++ P+FL +A   + +   ++++ E I  +  T+  L+  +L+ IE +  +EI    F  +  SK G     L +L+ +     I+K+   ++    + +   S LP+C    P++Y +   A+   L    ++      ++ I++  I  ++    TK   S     +H  ++ +   ++K D          D +AF  + Y+  +   Y E   LL +++++  +  LG+   L+ DY+G   FE  + +  K +     +Q  +DF  F+S NL+ L  N   C QQA+NEPL++    +   +IK    + +N   +I++     TY       +      +  +A       ++   +   ++LF L   + L +   H   V    F  +   L S S DG   VW    G    +L  H   +  C V      I + SLD   I+WK        KF     +K+  P NC++ HP     ++ G W+ N++ +++N  ++  VL  +  S + + F    +  ++  I+G++ ++S  +G    V S+    +  N    S    V    A  S    + +W  TLG    S+  ++  +T V    + +FI  G+  G++SI++ N  N+    I  V     C+            +T   ++   +I +  ++  IK+  S HS  V  I      + +GS+DCSI L  K   Y +   L      + ++  I   ++ +L    D  I L  IK    +    ++H D ITT  F S  +  ++ SND T+K W     D S  +           +  + +H   + ++S+ + +   S+S DGT+ + N  G+ + +     D  +   ++      FL  DY L  + 
Sbjct:  229 DDFDAEDHMEKLYAPPKTSSDISNLKK-----CLINAASSSLIGSPDFK-SRKDFTRRQLKFLAN---KIQIY------DPEFILKVSLYTRQELGIRTAANFLLALAANIQACRPYLKKYFSTIIRLPSDWIEVAELYQSLHDKTIRIGSLPKALRKVMVDKFGGFDEYQLAKYNRQKRKKSSQNKKTDKTSQLDQAESNNYASEFNDIIFSDDSEDEEETVQMMFTLKQLIRKLHIIQPAEHVMALIGKKYPVDLESFHKSGLSGIWNSERANKRMKLPVPETWETQLSLHGNKASTWETLIEHQKLPFIATLRNLRNLIKAGISDKHHNRIIRRLENENSVINSKLFPFRFFTAFEAINGYEKT--------------SQAGESGNRFNRKFKKSNTKKKKQVEMQKTVSEALLKRYREALDNAVKVATNHNVAPICGSTLILCNVADVMKIPCTAARGLGKPRTLLEVGILLGLMFRYSCEQSEFIIYADNWKKIDVFNTN----SILENTESICTLVEKSMITTSPNGFPEQEMLKYLKDRIQLDNLILLSNGSSEVPNHSVMNSFLTKYRRVVNPNLLYVNVNLSGKVTGFDRNKKLSHENDVYVTGFSDQILKFVADRGGDGQLINVENIDNAYKLKSI-KIPNAISSVDKSEDKSYGIGTFDMFLPRWKTVRVFISSTFLDMHGERDILTRYVFPELRARCQRHFLNIFE---VDLRWGINEADIQHNSMLELCLTEVQRSDYFIAILGQRYGWCPQGYEVPPTSE-FDWVRNYPPNRSVTELEIQQAIFNNPSEAIRKCFCYIRDNTFESDIPKNWLLQFVDD--------------------------SDIAKEKIDNLKNRLRKCGVETYERYPCKWGGIVDK-----KPYLTNLEQFGLRVLHNLWNAIERDYIQNDNDNNFE---DEEYNTQISVVDLHSKDFIGRKRLCKESNDLLHESEQGIILYCGKKGCGKTALMARLVKDQMSTTN--------WCHRIIPYFIGSSSGSCK------------ITNLLHYFCRQLKRGADIVQEI-PDTYQELVTCFHEFLIQSASFHGSNP-----VIIFIDGLDQLNSYYNAKDLQWLPQLIPENVLFVVSVNENEDCFKNLEHRSD-IIHNFKLSGIDSWEKATFVRQILQKYRKSLDESNFNKQMNVLISKREASSPLFLTLACEELRMFGIFEQITERIKTISQTIHGLLEQTLERIEIDHGKEIVTALFQVVLSSKDGIDETYLPLLLGVLTLPEIKKDLMQISIKKLSQYT-TSALPIC----PLMYARLLRAVKEFLFPAQQQDLVSSCQLAIQHGKIKEVLESRYTKMERSNKLAFIHKTLAAF--YLVKADPTSNRSWEGFDPWAFIALPYHLIRGACYNELSELLCDLKFITAKCKLGLVNHLIDDYHGQVTFERVSED--KAYHKAMKQQKIQDFGNFVSRNLSILKTNAFLCQQQALNEPLNTYPAELAAAQIKTEARSSNN---LIMEWCNKPTYCNPCYMTLEGFQQPLLAIAISEDDQYVACGSKDCTVKLFELSTAKELKSFVGHARPVTDCCFIGSK-YLCSASLDGNISVWDLANGHRRHILSLHHRSICQCTVDRNEKFIASASLDGNVIIWKVNDGSSFGKFS----VKSNRPFNCVSFHPEAPL-IVAGNWDTNIYTWDVNTKEQKQVLRGHTASIRDVAFCNGGNFVISADISGQVMIFSLAHGT--NVGSLHGHFFPINKIAVSSNPHVL---ATASDDHKVKLWRNTLGRALFSSHFEMQRMTAVKISLSGKFIAVGSSNGDLSIIDRNVGNQ----ILSVQAHKQCIRSLTWSPCGLNIITASDDKTVKIINI--EHADIKETLSDHSAAVTCIASSKKYLATGSEDCSINLYHKHTVYRLDSNLSGHTACIAAV-DISSNEKYLLSSGHDKVIRLWNIKTKRCVIESHESHLDLITTCAFGSVHDTVVTASNDHTVKCW-----DASELSLVLHRKKVLIPVSEVHSHNSAVNTVSV-AKNLIASASSDGTVVISNRMGIEITSFKAHSDRINACHLV------FLDGDYYLTTSG 2189          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: G3WIK5 (Telomerase associated protein 1 OS=Sarcophilus harrisii OX=9305 GN=TEP1 PE=4 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 4.399e-132
Identity = 444/1946 (22.82%), Postives = 842/1946 (43.27%), Query Frame = 1
Query:  463 MDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNS-----SCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAE--------------------------------------------INGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTNEKLIEIEL-----------NSINKTKQKTLDRKNKV------------RNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEI-----YLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFD----EMVAGRVQFDMILSFDVSISE---QCVSQYI--KYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDE--KYGLKNIEELINCEPLVKDS-PNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPEL---KDY-EGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKIN-FQNEINNSILSECHGEQTRYKSIMKETLTFLKSYTENIESFQKDEVNQLLLIVEK-KLSFEIDIDSPVNCQSFITPKST-----------------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMK-SYLKKELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDEDKKGRIIIKNSFI----GNLITKYSMSID-----KTVVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYK-KDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTK-SIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDIT-----CVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDN----IIIKKVE-------SLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLDSILTIDVCKE--LILVGCKDGSXX---XXXXXXXXXXNHEIKAHNDWITTVRFNSFNYFLSGSND 5829
            + L  D++  +PEFILK SLY R++LNIR I+  ++A++ Y    RPY+++Y  +I+ LP+DW++V   +  ++       + LP  L+ A+ +KF  F  YQL KY  +K  A+                                            +  K    +LK +++ LHI +PV+NV +LLG  YP    +F  S+LPG WD S+AG RMK+P PETW+  +S  GNK  +W+ LID+  LPYMAM+RN+ +LL+  I   +H ++ Q +E++ +VI  + LPF++ +A+  + +    +LK+    + + L             I K +Q   +R  +             R   +L K++Q     E ++KRY +AL TA+ +S  +N+PP+ G+ LI+     +         + ++++  + L+ +M    +E  E+     Y++K +++N  +   K  + L+  ++ +++ K    +    F     +MVA RV  D ++    ++ +       Q+   + NP  L +   +         ++ N V + G  +  +K ISE     +++ +  MD+  K   +  E  I  + L+++  P     +P +    + +FISSTF DM  ER ++   ++P+++        + I++  IDLRWGV     Q ++ L+ C+ +++   +FVGILGSR G++P +  + +    +P     KDY  G SVT +E           FL + SR +   +  L   RD+             +V + +K+     ++   E+I+  ++ ++      CH    RY  +    +   + Y + +E F +  +  +  ++++  L  E  ++   + Q+  T +S                  D  +    RSG + ++ GKPG GKT+ +S L+S     S +    +    F  +    ++    + L  L T +   L  + PFP     L  ELQ     +++                             + + IDG D L D S      WIP +LP K  ++M+  + + L    + R+++ +  ++P+    + +++   L   GK L+  PF+N M    +KR +  P++L++A +H+ L T Y++V E++  LP+T+  L+ + L  +E+E   +I  +  + L+ ++SG T+  L  ++S +        +  L   D+ +   A N    + M P  Y+ +    LL     G + +  + +    G L +   +        KT  H +I++    M   D    F         D+ Y+  +S  +    SLLTN+  +    ++G+   L   +  +  +         D  +      F TF+ +    L + P+   QQA N+P +S +   C+++  +   +S ++P++   NK  T + +  SSL        + V          ++  SG++ L +   ++   ++      ++     +N T  ++ S DG   +W    G  +  +K H   +TDC ++    L+ TVSLD    +W T    L      + P+NC+  HP     +I G W G + +   ++ + +  L  + S+  S+ F P+  +   + ++G + +W+   G +L      ++ Y S+  +   G Q+   G        + VWS +LG          ++      +  +  ++  G     I I +                TS   E+S+ P+S      + +  +  L+   ED      ++  V          H + V+ +        S S+D ++ L         E ++  +     +       +  ++  G +D S+    +   +  +L+N     H DW+T   +      LS SND
Sbjct:  281 LQLCTDLALLEPEFILKASLYARQQLNIRDIAIMVLAIAAYLPACRPYVRRYFCAIVQLPSDWMQVARFFQSLAEEPNRKLAPLPACLRAAMTDKFAQFDEYQLAKYNLRKHRAKKSHQRPRRPKSEKVCQRKWYNSTIIYKTFYNHQKSFMRAYHAEPVKKKPSDFTLKKLIQRLHIRDPVQNVKALLGCRYPSDMQSFARSRLPGPWDFSRAGTRMKLPQPETWDRVLSQKGNKASVWEGLIDSGKLPYMAMLRNLCSLLRVGISSRHHERILQLLERKESVIRSRQLPFRFLSAHTSISDLERQLLKSGPIPLNVVLMRQLLERLEKKGQIPKPQQHLTNRDLRFAMLVPVLYEHFKREKQRLNKINQWKQDWE-MMKRYQQALETAMNLSVQHNLPPLPGRTLIVCCPGRS-------QENKRNLQNHVLLLVAMVMARAEQAELLLCKRYILKKAVINPEEGILKTATELQTQIEEMAEEKSESKSNHHPFALYILDMVARRVPTDTVIFVGNTMEDPEFMSAKQFFWQRVNPKCLFVGVDLTGMHSGSLSRNPNDVILTGCTDGILKFISERGMSRLLEHVGQMDKIFKIPPQRGEAQIFPDKLLEERVPGPLTPVPQQSWRSVRVFISSTFRDMHGERDLLLRSVLPALQARA---APHHINVRGIDLRWGVTEEETQKDRQLELCLGEVENSQLFVGILGSRYGYVPPNYSLPD----HPHFCWAKDYPSGRSVTEMEVM--------QFLSRGSRHQ--SSPALIYLRDSSF---------LSSVPDAWKMDFASESEEAAERISELKSYLDKQEGVTCH----RYSCVWG-GVAAGRPYVKGLEEFGQMVLQHVWELLQRLYLQPESGLEETTSIQNDDTIQSAFQQLQRPPCPARPSLLKDTIQQLQQRSGSLCLVIGKPGQGKTAFLSSLVSALQAPSGVTMSSQV--FFHFVGARPDQSYVLILLRRLCTYLHHQLQCSRPFPTTYRGLVWELQTLLPKSAQSL----------------------RSGQTLVLVIDGADQLGDQSGQLISDWIPKILPQKVHLVMSMSAKTGLGDILQSRRDAHVVALKPLEPTARAQLVRQELALYGKRLEETPFNNQMRLLLVKRGAALPLYLRLATDHLRLFTLYEQVSEQLRALPATVPLLLQHMLGVLEQEHGSDILPLALAALHVTRSGLTLDQLHGVISTW-------QSLPLETVDWAEAMAARNQGDPYPMGPFTYLVHSLRSLLG---AGSLELPGARLRLPPGPLCSAAELRYRKRPGLKTTAHVLIAVQLWRMCDLDALGTFHNCHPEALSDLPYHLAQSGNHSLLASLLTNLNVMTTYLEMGLLSQLGEAHALYASSVP------VDEPSEPNVTVFHTFLKQQSKLLTQYPALLAQQAANQPSNSPI---CHQVSKLSQRWS-SQPILHWLNKPQTMEAQQRSSLSLVPPSTPTAVNLSPNGQRAIVATASGIVHLLDTCTWQEEKSIVSGCDGISSCLCPSNTTLFLAAS-DGRLELWDLQGGWRIFQIKAHQLQITDCCLNPDHRLLATVSLDRYLKLWDTIHGKLAAQHLFQKPLNCVAFHPEGQV-IITGNWAGYLSVLQPDSLRVIMELGGSGSSVCSVTFAPHGSVLAASHLDGIVELWAWQKGARLAAFPA-HQGYVSSALFLQSGHQLLTSGEDGK----VQVWSGSLGRPKGVLGSFSLSPALSVAISPDQTYVAVGHHTDGIRIYS----------------TSSGTEESHCPMSAVAVSALAWLSDRVLVSGGEDGDLQCWVLGDVAPTCLWLLPAHQKAVLGLATSQTLFASASEDFTVRLWSLSFLTQPEMIEELHGHKGPVTCCSFSPDGSILATGSRDQSLQCWNVRTPEAPVLINFLPACHRDWVTGCSWTKDAMLLSSSND 2120          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: G3WIK6 (Telomerase associated protein 1 OS=Sarcophilus harrisii OX=9305 GN=TEP1 PE=4 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 8.061e-131
Identity = 444/1945 (22.83%), Postives = 842/1945 (43.29%), Query Frame = 1
Query:  463 MDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNS-----SCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAE------------------------------------------INGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTNEKLIEIEL-----------NSINKTKQKTLDRKNKV------------RNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEI-----YLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFD----EMVAGRVQFDMILSFDVSISE---QCVSQYI--KYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDE--KYGLKNIEELINCEPLVKDS-PNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSE-KLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPEL---KDY-EGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKIN-FQNEINNSILSECHGEQTRYKSIMKETLTFLKSYTENIESFQKDEVNQLLLIVEK-KLSFEIDIDSPVNCQSFITPKST-----------------DKNENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMK-SYLKKELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDEDKKGRIIIKNSFI----GNLITKYSMSID-----KTVVHCIISIYCDEMLKFDDKFAFR--------DIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYK-KDISSLVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTK-SIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDIT-----CVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDN----IIIKKVE-------SLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLDSILTIDVCKE--LILVGCKDGSXX---XXXXXXXXXXNHEIKAHNDWITTVRFNSFNYFLSGSND 5829
            + L  D++  +PEFILK SLY R++LNIR I+  ++A++ Y    RPY+++Y  +I+ LP+DW++V   +  ++       + LP  L+ A+ +KF  F  YQL KY  +K  A+                                          +  K    +LK +++ LHI +PV+NV +LLG  YP    +F  S+LPG WD S+AG RMK+P PETW+  +S  GNK  +W+ LID+  LPYMAM+RN+ +LL+  I   +H ++ Q +E++ +VI  + LPF++ +A+  + +    +LK+    + + L             I K +Q   +R  +             R   +L K++Q     E ++KRY +AL TA+ +S  +N+PP+ G+ LI+     +         + ++++  + L+ +M    +E  E+     Y++K +++N  +   K  + L+  ++ +++ K    +    F     +MVA RV  D ++    ++ +       Q+   + NP  L +   +         ++ N V + G  +  +K ISE     +++ +  MD+  K   +  E  I  + L+++  P     +P +    + +FISSTF DM  ER ++   ++P+++        + I++  IDLRWGV     Q + + L+ C+ +++   +FVGILGSR G++P +  + +    +P     KDY  G SVT +E           FL + SR +   +  L   RD+             +V + +K+     ++   E+I+  ++ ++      CH    RY  +    +   + Y + +E F +  +  +  ++++  L  E  ++   + Q+  T +S                  D  +    RSG + ++ GKPG GKT+ +S L+S     S +    +    F  +    ++    + L  L T +   L  + PFP     L  ELQ     +++                             + + IDG D L D S      WIP +LP K  ++M+  + + L    + R+++ +  ++P+    + +++   L   GK L+  PF+N M    +KR +  P++L++A +H+ L T Y++V E++  LP+T+  L+ + L  +E+E   +I  +  + L+ ++SG T+  L  ++S +        +  L   D+ +   A N    + M P  Y+ +    LL     G + +  + +    G L +   +        KT  H +I++    M   D    F         D+ Y+  +S  +    SLLTN+  +    ++G+   L   +  +  +         D  +      F TF+ +    L + P+   QQA N+P +S +   C+++  +   +S ++P++   NK  T + +  SSL        + V          ++  SG++ L +   ++   ++      ++     +N T  ++ S DG   +W    G  +  +K H   +TDC ++    L+ TVSLD    +W T    L      + P+NC+  HP     +I G W G + +   ++ + +  L  + S+  S+ F P+  +   + ++G + +W+   G +L      ++ Y S+  +   G Q+   G        + VWS +LG          ++      +  +  ++  G     I I +                TS   E+S+ P+S      + +  +  L+   ED      ++  V          H + V+ +        S S+D ++ L         E ++  +     +       +  ++  G +D S+    +   +  +L+N     H DW+T   +      LS SND
Sbjct:  163 LQLCTDLALLEPEFILKASLYARQQLNIRDIAIMVLAIAAYLPACRPYVRRYFCAIVQLPSDWMQVARFFQSLAEEPNRKLAPLPACLRAAMTDKFAQFDEYQLAKYNLRKHRAKKSHQRPRRPRNLESEWVERESTPRGHHREIQKSFMRAYHAEPVKKKPSDFTLKKLIQRLHIRDPVQNVKALLGCRYPSDMQSFARSRLPGPWDFSRAGTRMKLPQPETWDRVLSQKGNKASVWEGLIDSGKLPYMAMLRNLCSLLRVGISSRHHERILQLLERKESVIRSRQLPFRFLSAHTSISDLERQLLKSGPIPLNVVLMRQLLERLEKKGQIPKPQQHLTNRDLRFAMLVPVLYEHFKREKQRLNKINQWKQDWE-MMKRYQQALETAMNLSVQHNLPPLPGRTLIVCCPGRS-------QENKRNLQNHVLLLVAMVMARAEQAELLLCKRYILKKAVINPEEGILKTATELQTQIEEMAEEKSESKSNHHPFALYILDMVARRVPTDTVIFVGNTMEDPEFMSAKQFFWQRVNPKCLFVGVDLTGMHSGSLSRNPNDVILTGCTDGILKFISERGMSRLLEHVGQMDKIFKIPPQRGEAQIFPDKLLEERVPGPLTPVPQQSWRSVRVFISSTFRDMHGERDLLLRSVLPALQARA---APHHINVRGIDLRWGVTEEETQKDSRQLELCLGEVENSQLFVGILGSRYGYVPPNYSLPD----HPHFCWAKDYPSGRSVTEMEVM--------QFLSRGSRHQ--SSPALIYLRDSSF---------LSSVPDAWKMDFASESEEAAERISELKSYLDKQEGVTCH----RYSCVWG-GVAAGRPYVKGLEEFGQMVLQHVWELLQRLYLQPESGLEETTSIQNDDTIQSAFQQLQRPPCPARPSLLKDTIQQLQQRSGSLCLVIGKPGQGKTAFLSSLVSALQAPSGVTMSSQV--FFHFVGARPDQSYVLILLRRLCTYLHHQLQCSRPFPTTYRGLVWELQTLLPKSAQSL----------------------RSGQTLVLVIDGADQLGDQSGQLISDWIPKILPQKVHLVMSMSAKTGLGDILQSRRDAHVVALKPLEPTARAQLVRQELALYGKRLEETPFNNQMRLLLVKRGAALPLYLRLATDHLRLFTLYEQVSEQLRALPATVPLLLQHMLGVLEQEHGSDILPLALAALHVTRSGLTLDQLHGVISTW-------QSLPLETVDWAEAMAARNQGDPYPMGPFTYLVHSLRSLLG---AGSLELPGARLRLPPGPLCSAAELRYRKRPGLKTTAHVLIAVQLWRMCDLDALGTFHNCHPEALSDLPYHLAQSGNHSLLASLLTNLNVMTTYLEMGLLSQLGEAHALYASSVP------VDEPSEPNVTVFHTFLKQQSKLLTQYPALLAQQAANQPSNSPI---CHQVSKLSQRWS-SQPILHWLNKPQTMEAQQRSSLSLVPPSTPTAVNLSPNGQRAIVATASGIVHLLDTCTWQEEKSIVSGCDGISSCLCPSNTTLFLAAS-DGRLELWDLQGGWRIFQIKAHQLQITDCCLNPDHRLLATVSLDRYLKLWDTIHGKLAAQHLFQKPLNCVAFHPEGQV-IITGNWAGYLSVLQPDSLRVIMELGGSGSSVCSVTFAPHGSVLAASHLDGIVELWAWQKGARLAAFPA-HQGYVSSALFLQSGHQLLTSGEDGK----VQVWSGSLGRPKGVLGSFSLSPALSVAISPDQTYVAVGHHTDGIRIYS----------------TSSGTEESHCPMSAVAVSALAWLSDRVLVSGGEDGDLQCWVLGDVAPTCLWLLPAHQKAVLGLATSQTLFASASEDFTVRLWSLSFLTQPEMIEELHGHKGPVTCCSFSPDGSILATGSRDQSLQCWNVRTPEAPVLINFLPACHRDWVTGCSWTKDAMLLSSSND 2001          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: A0A5F8GAK5 (Telomerase associated protein 1 OS=Monodelphis domestica OX=13616 GN=TEP1 PE=4 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 2.226e-126
Identity = 447/1914 (23.35%), Postives = 844/1914 (44.10%), Query Frame = 1
Query:  463 MDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKYRNKKMVA------------------------EINGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTN---------EKLIEIELNSINKTKQKTLDRKNKVRNAI-------KLKKVSQRSV-VSE-----NIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNETAIYSPFKYGSSK--SVKEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDEMVAGRVQFDMILSFDVSISEQCVSQYIKYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGL---KNIEELINCEPLVKDSPNFPDAIPNE----INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDY-EGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKI-NFQNEINNSILSECHGEQTRYKSIMKETLTFLKSYTENIESFQK---DEVNQLL--LIVEKKLSFE----IDIDSPVNC--QSFITPKSTDKN-------ENELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMKSYLKKELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFI--DGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRVYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDED----KKGRIIIKNSFIGNLIT-KYSMSID-KTVVHCIISI----YCD--EMLKFDD--KFAFRDIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYKKDISSLVYYLSDQI-SHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDIT-----CVDANDQFIVCGTKFGEISIL-NSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNF--YLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFK---NYEVTEKLQLFNIFLDSILTIDVCK-----ELILVGCKDGSXX--XXXXXXXXXXNHEIKA-HNDWITTVRFNSFNYFLSGSNDFTIKLWEII 5856
            + L  D++  +PEFILK SLY R++LNIR ++  ++A++ Y    RPYL++Y  +I+ LP+DW++V  ++  ++ S       +P  L+ A+  KF  F  YQL KY  ++  A                         +  K    +LK +++ LHI +PV+NV +LLG  YP    +F  S+LPG WD S+AG RMK+P PETWE  +S  GN   +W+ LID+  LPYMAM+RN+ +LL+  I   +H ++ Q +E++S VI  + LPF++ +A+  + +    +  +           +L+E         K +       +R A+         K+  QR + +S       ++KRY +AL TA+ +S  +N+PP+ G+ LI        I SP++    K   +  V+ LV +M    +E  E+ L K   + +   N + + ILK + ++     + ++ +T L   M       + +  F+   ++Q   Q +  NP  L +   +       +C + N V + G  +  +K ISE     +++ +  MD+ + +   +   + +   PL +  P+     P      + IFISSTF DM  ER ++   ++P+++        + I +  IDLRWGV     Q ++ L+ C+ +++   +FVGILGSR G++P +  + +    +  +KDY  G SVT +E           FL + S  + +    L   RD+             +V + +KI     +    E+I + ++ ++      CH    RY S     +   + Y + +E F +     V +LL  L V+ + S E       D  V    Q    P S  +        +    RSG + ++ G+PG GKT+ +S L+S                           +S+ ++ +       +  I  L   + +YL+ +LQ     +S+ F  P   +  +   + +L K  Q      T+ +  DG D L D +      WIP  LP K  ++M+  +++ L+   + R+++ +  ++ +    + +++   L   GK L+  PF+N M    +KR +  P++L++A +H+ L T ++++ E++  LP+T+  L+ + L  +E+E   +I  +  + L  ++SG T+  L  ++S +  +  E         D+ +   A N    + M P  Y+      LL E        R+ +    + + +  +Y      KT  H +I++     CD   +  F +    A  D+ Y+  +S  +    SLLTN+       +LG+   L   +  +  +          + +      F TF+ +    L + P+   QQA N+P +S +  +  ++        +++P++   NK  T     SS +  +   + + V+         ++  SG++ L + + ++   ++      ++     +N T  ++ S DGL  +W    G  +   K H   +TDC +S    L+ TVSLD    +W T    L     ++ P+NC+  HP     +  G W G + +  L++           S +++ F P   +   + ++G + +W+   G +L      +  Y ++  +   G Q+   G        + +WS +LG      D L ++      +  +  F+  G     I I   S+ T + Q  + D A++++        L+    V+   + N   +++  +  + +   +   H + V+ +      + S S+D ++ L   +      + +KL            +  C       ++  G +D S+    +++ +  ++ H + A H DW+T   +      LS SND +++LW+ +
Sbjct:  222 LQLCTDLALLEPEFILKASLYARQQLNIRDMAIMVLAIAAYLPACRPYLRRYFCAIVQLPSDWMQVAQYFQNLAESPDKKLVPMPACLRAAMTEKFTQFDEYQLAKYNLREHRAKKRRRRYRRPVSDFFPFMRAYHEEPVKKKPSDFTLKKLIKRLHIRDPVQNVKALLGCRYPSDLQSFSRSRLPGPWDSSRAGTRMKLPQPETWERVLSQQGNTASVWEGLIDSGKLPYMAMLRNLCSLLRVGISAKHHERILQLLERKS-VIRSRQLPFRFLSAHTSISDLERQLKNSGPVPCNVVIMRQLLERLEKKKKLPKPERKLTNWDLRFAMMVPVLYEHFKREKQRLIQISHWKRDWEMMKRYQQALETAMNLSVQHNLPPLPGRTLI--------ICSPYESQDKKKNPLTHVLLLV-AMLMARAEQAELLLCKRGTLKKAVTNPE-EGILKTATEL---ETQIQVRLTGLLARMDTVIFVGNTMKDFEFMTAKQFFWQRV--NPKCLFVGVDL---MGMDSCTNPNDVILTGCTDGILKFISERGMSRLLEHVGQMDKIFKIPPPRGEAQTLPDRPLEEREPSPLTPAPQHSWRSVRIFISSTFRDMHGERDLLLRSVLPALQAQA---APHHISVRGIDLRWGVTEEEIQKDRQLELCLGEVENSQLFVGILGSRYGYVPPNSNLPDHPHFH-WVKDYPPGRSVTEMEVM--------QFLNRGSHQQGVSP-ALIYLRDSSF---------LSSVPDGWKIDFASESDEAAERISDLKSYLDKQEGVTCH----RY-SCAWGGVAAGRPYVKGLEEFGQMVLQHVWELLQRLYVQPESSLEKTESAQNDDTVQSAFQQLQHPPSPARPSLLKDIVQQLQQRSGSLCLVTGEPGQGKTAFLSSLVSALQAP------------------FGATRSSQVFFHFAGARPDQSYILTLLRRLCTYLRHQLQ-----HSKPF--PTTYRGLVWELHTLLPKSAQTLRSGQTLVLVIDGADQLGDQTGRLISDWIPKSLPQKVHLVMSMSTSTGLADILQCRRDAHVVALRSLEPTARAQLVRQELALYGKRLEETPFNNQMRLLLVKRGAALPLYLRLATDHLRLFTLFEQMSEQLRTLPATVPLLLQHVLGVLEQEHEPDILPLALAALQVTRSGLTVDRLHGVISTWRALSSE-------TVDWAEAMAARNKGDPYPMGPFTYLIQSLRRLLGEGSLELPGARLRLPPGPLSSAVELRYRKRPGLKTKAHVLIAVQLWKMCDPEALGTFHNCHPEALNDLPYHLVQSGNHSLLASLLTNLNVTATYLELGLLSQLGEAHALYASSVPMSEP----VSSETDVIAFHTFLKQQSRLLTQYPALLTQQATNQPSNSPIYQQVPKLA----QRWSSQPILRWLNKPQTMGSQQSSSLSLVPSSMPTAVSLSPNGQWAVVATASGIVHLLDTRTWQEEKSIVSGCDGISSCLCPSNSTVFLAAS-DGLLELWDLQGGWRVFQTKAHQLQITDCCLSPDHRLLATVSLDRHLKLWDTVHGKLASQHLSQKPLNCVAFHPEEQV-ITTGNWAGCLSVLRLDSLTVTM-----SSVRAVTFAPSGTVLAASHLDGTVELWAWQKGAQLASFPA-HLGYVASALFLQSGRQMLTAGEDGK----VQMWSGSLGRPKGTLDSLPLSPALSVAISPDRAFVAVGHHSDGIRIYRTSSGTEEGQCPVSDAAVSALAW------LNPKVLVSGGEDGNLQCWMLAYVTPHRLW--LLPAHQKAVLGLATSQELLASASEDFTVRLWSLQFLTQPNLAKKLHPGRELRGHTGPVTCCSFSPDGGILATGSRDQSLLCWDVRMPEAPVVMHSLPACHRDWVTGCSWTKDAMLLSCSNDGSVRLWDPV 2029          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: A0A1S3J9Z1 (telomerase protein component 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106171286 PE=4 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 3.056e-126
Identity = 433/1788 (24.22%), Postives = 807/1788 (45.13%), Query Frame = 1
Query:  814 LSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTNEKLIEIELNSINKTKQKTLDRK---------------NKVRNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNET---AIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDS--LVNRFQKNT---KCKSILKMSLDILSDNKKGKITVTDLFDEMVAGRVQFD--MILSFDVS---ISEQCVSQYIK-----YNPSVLIIFNSINPPTETMN----CKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEP-LVKDSPNFPDAIP------NEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDY-EGLSVTNIEYQFA------SKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINNSILSECHGEQTRYKSIMK--------ETLTF--LKSYTENIESFQKDEVNQLLLIVEKKLSFEIDIDSPVNCQSFITPKSTDKNENELLRS--GGILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKSXXXXXXXXXXXIIEFLIYNLPFPMKSYLKKELQAHNEINSEEFWRPINIKHAXXXXXXXXXXXXXXXXXYVTIFIDGIDNLRDFSEASTLSWIPLVLPPKFRIIMXXXXXXXXXXXXKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKTLQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPSTLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFRV----YIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDEDKKGRIIIKNSFIGNLITKYSMSIDKTVVHCIISIYC--------DEMLKFDDKFAFRDIIYYKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDY--NGFEETNSERNKLWFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNEIKIIPFNFSNTKPVILKKNKAFTYKKDISSLVYYLSD---QISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKST-KSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSN-----EKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIII-------KKVESL--HSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLDSILTIDVCK-----ELILVGCKDGSXXXXXXXXXXXXNHEI------KAHNDWITTVRF-NSFNYFLSGSNDFTIKLWEII 5856
             +LK ++R +HI EPVE+VM L+GK YP T + F+ S+LPG WDE +AGKRMK+PTPETWETQ+S+ GNK E+WQ L+++K LP+MAM+RN+RN++++ I + Y  KV + +    +V++ +  PF++F+AY++L    +   +  ++L+E  +   +   +     +               +K +NA K K+V         ++ RY +AL+TAI+I+T YN+ PI+G  +I  N+ +T      +    G  + V E+  L+  MC  + E +++ +  +S  L    +K T     +S+L  +  + +      +    +  +++  R Q D  +ILS  +S   +  Q VS ++K      NP++L +   +   +   N     +  N + I G+++  ++ I+E      +  ID +DEKY L      +  +P  VK +   P  I           +FISSTF DM  ER ++   + P ++     +  N  ++   DLRWGV     +S K L+ C+ +I +C  F+GILG R GW+PD  V+ +  E +  ++DY  G S+T +E   A       K  Q  F L++           KS++ ++           +  L DF    P  +   +E +  +  I +S L    G   ++  ++         E   F  L      ++ F  DE   L  I  +    E  +++ V+  SF   K+  K   E LR+   GIL++ GKPG GKTS+++ LISQY   + +  +  FI          N               I F +  L   +      E+             P + K+       IL +  Q     + +  DG++ L D+ +A +L+WIP  +P     +M+T+ NS    +   R++S + ++  + ++ K +V+ N L +  KTL    F+N M   + KR++N P+FL +A   + +   Y+K+ E++ +LP T+  L+   L  +E++  Q +     + L  ++ G   ++L ML+S + ++    Y  ++   +     +    A   PL  S+   +  +  S++L     +    I+  ++    T+  +     ++H +++ Y         +   +  ++ AF ++ Y+   +  + E   +L ++++L+ +  LG A  LL D+   G    + ER++  F   ++     +++F+S NL  L   P+   QQA+NEP  S       +I+ +  +      +I  KNK     +     +  LSD    ++ +A            +  +++L++L   +   +   H   ++   F   D ++ S S D    +W   +G  + V+KG+   V+ C    K ++I + + D    +W+ +  V         P+NC+  HP     ++ G W+ ++ I++  N  + A+L  + S+ +S+ + P      + +++GE+ +W++ NG ++  +S       + + +S  G ++       S    I VWS  LG   N     E        +  N Q++V G   G+                 D+    +  E  +   SV     VD+ R   +I    DN  +       K + SL  H+  V+ I    + + +GS+D      + + ++       + +    +  +  C       L++  C+   + +  I+ L   +  I        H DW+    + N+ ++ ++ SNDF +KLW+I+
Sbjct:  537 FTLKQLIRKIHITEPVEHVMCLIGKRYPETLEEFYKSRLPGTWDEERAGKRMKLPTPETWETQVSMKGNKAEVWQDLLEHKKLPFMAMLRNLRNMIKAGISEKYTTKVIKRLTDVRSVVNSRQFPFRFFSAYEVLNSLEKEYEQNQKQLVEEAVAGSSSWSRGRGRGRGCGRGGRGGGRGGRWDKKKNA-KTKEVP----FDPPLLNRYRKALDTAIKIATTYNVQPIKGTTVIFCNLGKTMNRPCTAAKGLGKPRQVSEIAVLLGLMCKYSCEESKMVVYGNSSYLEVDLEKGTILDNMQSVLGSAFMVNNQQDTDAVVPDGILRDLLRDRTQVDNLIILSDGMSLESVEGQNVSDFLKKYRRLVNPNMLFVNVDLGGKSSGFNKSVQPEHDNDIFIAGYSDQILRFIAERGESGQLTHIDKIDEKYNLTAKVPGLEKKPYAVKPAVEHPLPIAALKPRWRTARVFISSTFRDMHGERDLLTRFVFPELRARGKQHFLNVYEV---DLRWGVTEEDTRSNKTLELCLTEITKCQFFIGILGERYGWVPDKYVVPDSPE-FDWVRDYPPGCSITELEMHSACMSNPDEKKDQAFFFLRD-----------KSWQKDL----------PKKYLQDFAAESPS-SATKMEAL--KERIRSSGLEVFDGYPCKWGGVVDGQPMVSGLEDFGFRTLNCLWNAVKKFFPDEDAVLDEISHETSQHEAFLEARVS--SFTGRKAQMKMCLERLRTMKEGILMLSGKPGCGKTSLVANLISQYD--ADIGAKTHFIHFVGATPESTN---------------ITFALKRLCTELIRRFGLEMDV-----------PQDYKNLCGELKTILTEASQASGSPLLLVFDGLEMLEDYHQARSLTWIPEEIPENVIFLMSTVENSECHRALSRRQHSSV-QLSGLDLWDKPEVVRNQLARHKKTLVETGFNNQMKLLTSKREANNPLFLNLACEELRVFGVYEKITEKLKSLPHTVPLLLQEVLARLEQDHGQSLVSTALTLLVCARKGLFEEELHMLLSYHQKLQHVKYTVQDVLNVPLEPEHQIPQAVFAPLLRSLKTFLRPEATSSLLSLAHAEIERSIRQRYMRGSSTELEV-----MLHRLLAGYFWLNADPDKNGSWQGSNQRAFSELTYHLSCTGAFSELEDILCSLKFLRAKCMLGQASELLEDFLVKGASSKSQERSRQKF--LSQPRIVQYQSFVSRNLHVLSSVPALTWQQALNEPESS---APAQDIQSLLESVDMDLGLIKWKNKP----EWSDPCLLTLSDFTMPVTCLAISPDGQFFVCGSDDCVVRLYDLNTGKEQRSFTGHSHTISDVCFVGKD-KICSASLDQTLSLWDLNDGHRISVMKGNNRRVSSCSSDAKGSIIVSTAWDCYIKVWQGKDGVEVSKFTDVCPVNCVAFHPEGQL-IVTGSWDASLKIWDTLNKNRKAILRGHSSSVRSVAYSPSGRHIASASLDGEVRLWNAANGTQVGTLSGHTLP-VNKLVFSPAGQELITV----SDDHKIKVWSGHLGQPVNSIGQEEYGAATSVALSRNGQYVVVGYHEGQTRRF-------------DIRSGLLDFEVHHHQASVKCVHCVDH-RESVIITGSADNTALALDPLTGKALFSLTGHTNSVLCIDSRLDWLATGSED-----FQARMFDRKRGGPPYAVLSGHVAPVTGCSFNAEGSLLVTSCRGACLMVWNIQDLFPGDKNIPMNVISACHADWVNGCMWSNTGDFVVTASNDFNLKLWDIL 2220          
BLAST of Telomerase protein component 1 vs. Ensembl Cavefish
Match: tep1 (telomerase-associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6153])

HSP 1 Score: 214.927 bits (546), Expect = 7.921e-61
Identity = 104/253 (41.11%), Postives = 159/253 (62.85%), Query Frame = 1
Query:  466 DLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSSCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEINGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEE 1224
            DL  +I++ DPEFILKV++Y R+ELNIR  +N+L+A++ Y  ES+P+L++Y  + + LP+DWLEV   +    +SS LP  LKKAL++KFK FS YQL KY  +K+  + N KK                          + YP    AF  S L G W+  +AG+RMK+  P+TWET++S+ GN   +W+KLI+N SLP+MAM+RN+RN++   I D +H ++ + +  ++ VI  +  PF++ +AYK++ E
Sbjct:  141 DLGTEITRRDPEFILKVAVYTRQELNIRITTNFLLALAAYLPESKPHLRRYFCAAVQLPSDWLEVTRLFSTCFSSS-LPACLKKALVDKFKQFSEYQLAKYNTRKLRGKHNKKK--------------------------REYPSDLRAFVSSGLSGVWESERAGQRMKLKQPDTWETKLSLEGNNAAVWEKLINN-SLPFMAMLRNLRNMITQGISDQHHERILKRLTSKNAVIQSRQFPFRFLSAYKVIME 365          
BLAST of Telomerase protein component 1 vs. Ensembl Cavefish
Match: ENSAMXT00000041500.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000219.1:314674:321613:-1 gene:ENSAMXG00000037746.1 transcript:ENSAMXT00000041500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 4.694e-15
Identity = 37/95 (38.95%), Postives = 61/95 (64.21%), Query Frame = 1
Query:  511 KVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLIS-----NSSCLPNQLKKALINKFKDFSIYQLGKYRNKK 780
            +V++Y R+ELN   +++YL+A++ Y   S+P++++Y  + + LP+DWL+V   Y  +S       S LP  LKK L++KFK FS  QL KY  ++
Sbjct:   52 EVAVYSRQELNKHLMASYLIALAAYLPASKPHVRRYFCAAVRLPSDWLQVPRIYSTVSWRISHQLSSLPTCLKKGLVDKFKQFSESQLAKYCTRR 146          
BLAST of Telomerase protein component 1 vs. Ensembl Cavefish
Match: ENSAMXT00000044252.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:2462631:2463659:1 gene:ENSAMXG00000035043.1 transcript:ENSAMXT00000044252.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.014e-10
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 2071 INIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSV 2397
            + +FISSTF DM  ER ++   + P ++R       +C+ +  ++LRWGV     +S + +Q C+ ++ R  + + ILG R G +P    +       PEL  Y  + V
Sbjct:   43 VRVFISSTFRDMHAERDVLVRSVFPELRRRA---APHCLYLQEVELRWGVTEE--ESNQAIQLCLSEVCRSQLLLSILGERYGQVPPRPTL-------PELPQYTWVRV 139          
BLAST of Telomerase protein component 1 vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 56.225 bits (134), Expect = 4.272e-7
Identity = 43/204 (21.08%), Postives = 91/204 (44.61%), Query Frame = 1
Query: 4474 LVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKT-KSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKST-KSIVFHPYYDLFLTTTINGEINVWSS 5079
            ++Y  S  +  V+F    N +  S E G I+L++L+ F  L+  + H   V  T F       +S   D +A +W++     L++  GHL  +T       +N + T S D    +W        ++L   K PI+ +   PN  + +  G  +G + ++++ +   +  L  +  T  ++ F    ++  + +++  + +W +
Sbjct:  466 ILYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPNGKY-LASGSTDGRVLLWDIGHGLMIGELKGHTDTIYALRFSRDGEILASGSMDNTVRLWDA 668          

HSP 2 Score: 53.9138 bits (128), Expect = 2.496e-6
Identity = 62/294 (21.09%), Postives = 120/294 (40.82%), Query Frame = 1
Query: 4495 QISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTK-SPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKST-KSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDA------NDQFIVCGTKFGE-ISILNSNFTNK 5349
            ++  V   + L +I    +  L ++ + K       L  H   V    F  +   L+S SEDG   +WS      L   KGH  PV D   S       +   D    +W T+ +   ++     + I C   HPN+++ V  G  +  + ++++ N   V VL  +K    S+ F P      + + +G + +W   +G+ +  +       Y+ +++S DG ++   G+  +    + +W     ++  E D  D T          N Q ++ GT   +   +++ +FT +
Sbjct:  431 KLRKVKSAADLGMIDKESDDVLERIMDEKTASECKILYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADITCTRFHPNSNY-VATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPNGKYLASGSTDGRVLLWDIGHGLMIGELKGHTDTIYA-LRFSRDG-EILASGSMDNT---VRLWDAIRAFDDVETD--DFTAATGHVHLPDNSQELLLGTYLSKSTPVIHLHFTRR 716          
BLAST of Telomerase protein component 1 vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 56.225 bits (134), Expect = 4.272e-7
Identity = 43/204 (21.08%), Postives = 91/204 (44.61%), Query Frame = 1
Query: 4474 LVYYLSDQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKT-KSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKST-KSIVFHPYYDLFLTTTINGEINVWSS 5079
            ++Y  S  +  V+F    N +  S E G I+L++L+ F  L+  + H   V  T F       +S   D +A +W++     L++  GHL  +T       +N + T S D    +W        ++L   K PI+ +   PN  + +  G  +G + ++++ +   +  L  +  T  ++ F    ++  + +++  + +W +
Sbjct:  466 ILYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPNGKY-LASGSTDGRVLLWDIGHGLMIGELKGHTDTIYALRFSRDGEILASGSMDNTVRLWDA 668          

HSP 2 Score: 53.9138 bits (128), Expect = 2.496e-6
Identity = 62/294 (21.09%), Postives = 120/294 (40.82%), Query Frame = 1
Query: 4495 QISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTK-SPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKST-KSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDA------NDQFIVCGTKFGE-ISILNSNFTNK 5349
            ++  V   + L +I    +  L ++ + K       L  H   V    F  +   L+S SEDG   +WS      L   KGH  PV D   S       +   D    +W T+ +   ++     + I C   HPN+++ V  G  +  + ++++ N   V VL  +K    S+ F P      + + +G + +W   +G+ +  +       Y+ +++S DG ++   G+  +    + +W     ++  E D  D T          N Q ++ GT   +   +++ +FT +
Sbjct:  431 KLRKVKSAADLGMIDKESDDVLERIMDEKTASECKILYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADITCTRFHPNSNY-VATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPNGKYLASGSTDGRVLLWDIGHGLMIGELKGHTDTIYA-LRFSRDG-EILASGSMDNT---VRLWDAIRAFDDVETD--DFTAATGHVHLPDNSQELLLGTYLSKSTPVIHLHFTRR 716          
BLAST of Telomerase protein component 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010121.1 (pep scaffold:Pmarinus_7.0:GL485934:2276:4067:1 gene:ENSPMAG00000009162.1 transcript:ENSPMAT00000010121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 6.533e-20
Identity = 43/105 (40.95%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  478 DISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSS-----CLPNQLKKALINKFKDFSIYQLGKYRNK 777
            ++++ DPEF+LKV+LY R+EL IR  SN L+A++      RP+L +Y  + + LP+DWL+V   Y    NS       LP  L++AL+ KF  F+ +QL KY  +
Sbjct:   32 ELAQTDPEFVLKVALYSRRELGIRKTSNVLLALAAELPPCRPHLVRYFSAAVVLPSDWLDVATTYKSPPNSCTRERLSLPACLRRALVEKFPAFNEHQLAKYNKE 136          
BLAST of Telomerase protein component 1 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 59.3066 bits (142), Expect = 6.902e-9
Identity = 53/203 (26.11%), Postives = 85/203 (41.87%), Query Frame = 1
Query: 4612 HFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTK-SPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAV-LHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVW 5214
            H   V  T F  ++  L+S SED    +WS      L   KGH  PV D   S   +   T S D    +W  +     +I     + ++C++ HPN  + V  G  +    +++++    V + L +     SI   P      T + +G INVW    G +LK +    KN   ++ YS +G  +   GA  +    + VW
Sbjct:  524 HSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCY-VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHT----VRVW 721          
BLAST of Telomerase protein component 1 vs. Ensembl Nematostella
Match: EDO32895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STP2])

HSP 1 Score: 67.3958 bits (163), Expect = 5.385e-11
Identity = 46/144 (31.94%), Postives = 75/144 (52.08%), Query Frame = 1
Query: 2071 INIFISSTFMDMEKERSIINTIIIPSVK---RNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCH------IFVGILGSRSGWIPD-SKVIRNLSEIYPELKDYEGLSVTNIEY---QFASKNCQKIFLLKNSR 2463
            I +F+SSTF D  +ER ++   I P ++       L++  C      DLRWGVP     +E+ ++ C+E+I RC+       F+ +   RSGWIPD   +  NL+  Y  +    GLS+T +E     F   N   +F++++S+
Sbjct:   31 IRLFVSSTFRDFHEEREVLVKEIFPDLRLWCEERKLHLVEC------DLRWGVPKD-SSTEETVRICLEEIDRCYRDNVMPYFLNLTCGRSGWIPDFGDLTYNLAVQYGWVY---GLSITEMEIVHGAFRKCNPNALFMIRDSK 164          
BLAST of Telomerase protein component 1 vs. Ensembl Nematostella
Match: EDO39396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA50])

HSP 1 Score: 56.9954 bits (136), Expect = 6.861e-8
Identity = 86/380 (22.63%), Postives = 151/380 (39.74%), Query Frame = 1
Query: 2071 INIFISSTFMDMEKERSIINTIIIPSVK-----RNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCH-------IFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGL---SVTNIEYQFAS---KNCQKIFLLKNSRDEDLDNLQLKSFRDNIIAXXXXXXXXXXXVLNDFKILIPCLNKIILEKINFQNEINNSILSECHGEQTRYKSIMKET------LTFLKSYTENIESFQKDEVNQLLLIVEKKLSFEIDIDSPVNCQSFITPKS-----------------TDKNE---NELLRSGGILIIDGKPGSGKTSIMSELISQYSEISKL---------P---------NRLKFIWIFDVIKFINN 3024
            + +F+SSTF D   ER ++   + P ++     R + L       I C DLRWGVP  +  +E  ++ C+ +I +C         F+ +LG R GW+P    + N  EI    K Y+ +   S+T++E   A+   KN    F++++            +F D I           +    D  +L     +++ EK+  +         +       Y  I K T      L  L  +   +    K  +     +VEK+L+ E   ++  +  SF+  +                  T ++E   NE   S  I+++ G PGSGK+S+++    +  ++  L         P         NRL F W+ D+  +  N
Sbjct:   42 VRLFVSSTFTDYHAERELLVKKVFPELREWCEHRRVQL-------IEC-DLRWGVP-KYSSTEMTIKTCLGEIDKCKEETDGVPFFLNMLGERYGWMPGESDVPN--EIQ---KGYDWVFPASITHMEILHAAYRNKNPNAAFMIRDP-----------AFLDEI-------PTDMKGAFIDNSVLSKAQLQMLKEKLRLR------FPGQVFDYNCEYTGIDKSTGKPKVCLRALDDFGNRVLEVFKAAIEMTFPVVEKELTLE-QTEAAAH-DSFVRSRGALLLGRHNEVKQVMEYITREHEPLGNEESDSRPIMLVQGVPGSGKSSLVAYCTLEAKKLDSLLFYHFVGSGPGSTSPLRVVNRL-FAWLRDITHYTGN 380          
BLAST of Telomerase protein component 1 vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 56.6102 bits (135), Expect = 8.744e-8
Identity = 32/112 (28.57%), Postives = 53/112 (47.32%), Query Frame = 1
Query: 4492 DQISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWK 4827
            D++  VAF     LI+ +   G  +++N      L  L  H   ++K  F    TRL++ S D  A +W    G  L+VL+GH   +  C  +   ++I T S D+   +W+
Sbjct:  304 DEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTDEIFSCAFNYDGDIIITGSKDNTCRLWR 415          
BLAST of Telomerase protein component 1 vs. Ensembl Nematostella
Match: EDO31974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWE8])

HSP 1 Score: 56.6102 bits (135), Expect = 9.856e-8
Identity = 47/196 (23.98%), Postives = 77/196 (39.29%), Query Frame = 1
Query: 4513 FGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVS-TKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVG-----CWN---GNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVW 5073
            F S   L+    E GLIQLF+L     L   + H   V+ T F  ++  ++S S+D L   W           K H   V   + S   +++  T S D    MW          L   +P+ CI  +PN    +  G      W+   G   + + +N++        K+  S+ F   Y   L+ +I+  + V+
Sbjct:   89 FRSDGQLMIAGGEDGLIQLFDLNSRAVLRQFKGHSGPVHVTKFLQDNLHIVSASDDKLVNCWDIATEQTTATYKEHEDYVRTGVASQVTSDIFLTGSYDHTVRMWDRRCNASVNTLDHGAPVECIQVYPNGAMAITAGENVIKIWDILSGGRLVTSFSNHQ--------KTITSLCFDGAYKRLLSGSIDRNVKVY 276          
BLAST of Telomerase protein component 1 vs. Ensembl Nematostella
Match: EDO37328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG41])

HSP 1 Score: 54.6842 bits (130), Expect = 1.083e-7
Identity = 52/249 (20.88%), Postives = 102/249 (40.96%), Query Frame = 1
Query: 4495 QISHVAFGSILNLISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPI--NCITSHPNNDFKVIVGCWNGNMFIYNL-NNYKKVAVLHNNKS-TKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLG 5229
            Q++  AF      +    +  L+++++ K  + L  L HH   +    F ++     S + D L +VW +  G  +  L+GH   V  C  S     + + S D+  I+W  +  +   +L     +   C  SH +    V  G W+  + +++L      V  L  +KS   S+ F   + +  + + +  I +W S  G  + +++  +  +     +S  G    +  A  S    + VW T+ G
Sbjct:    1 QVNTCAFSPDWTRVVTGGDDDLVKIWDSKTGKVLFTLEHHDGAIKCVCFSSDGKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFSPNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAFSHDSK--TVATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAFAKNH-MLASGSWDMTIRLWDSKTGELIHLLT-GHSGWVQACSFSGSG----DLLASASDDQTVRVWDTSTG 241          
BLAST of Telomerase protein component 1 vs. Ensembl Medaka
Match: ENSORLT00000046678.1 (pep primary_assembly:ASM223467v1:17:3383455:3390573:1 gene:ENSORLG00000027023.1 transcript:ENSORLT00000046678.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 5.809e-16
Identity = 42/103 (40.78%), Postives = 66/103 (64.08%), Query Frame = 1
Query:  508 LKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLIS---NSSCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEINGKK 807
            ++V++Y R+ELNIR  +N+L+A++     ++ ++++Y  + + LP+DWLEVV  Y  +S       LP  LKKA+ +KFK FS YQL KY  +K   + N KK
Sbjct:  151 VQVAVYTRQELNIRITANFLLALAASLPSTKRHVRRYFCAAVQLPSDWLEVVRIYSAVSVRERLCSLPACLKKAMADKFKQFSEYQLAKYNTRKHRCKHNKKK 253          
BLAST of Telomerase protein component 1 vs. Ensembl Medaka
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:101170185])

HSP 1 Score: 55.4546 bits (132), Expect = 5.065e-7
Identity = 51/196 (26.02%), Postives = 87/196 (44.39%), Query Frame = 1
Query: 4432 KKNKAFTYKKDISSLVYYLSDQISHVAF-----GSILNLISMSYESGLIQLFNLKQFEALLNLRHHF-----SRVNKTFFYNNDTRLISVS--EDGLALVWSSIEGALLKV-LKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTE--KFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKV 4974
            +   A  +++ +S   Y L  Q++   +     GS++          +     L +  A   + H F     S V +  F N+D  L++    +  L+++  S   A +KV LKGH GPVTD   S   ++I + SLD    +W TE  + + E      S + C T  P N+   +VG    ++ + N++  KKV
Sbjct:   19 RAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDATLSIMMLSPPPASVKVILKGHGGPVTDFAWSLSNDIIVSTSLDGTLRIWNTEDGRCIREVRDPESSELLCCTFQPMNNNLTVVGNGKNHLQVVNISTGKKV 214          
BLAST of Telomerase protein component 1 vs. Ensembl Medaka
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:101170185])

HSP 1 Score: 55.4546 bits (132), Expect = 6.565e-7
Identity = 51/196 (26.02%), Postives = 87/196 (44.39%), Query Frame = 1
Query: 4432 KKNKAFTYKKDISSLVYYLSDQISHVAF-----GSILNLISMSYESGLIQLFNLKQFEALLNLRHHF-----SRVNKTFFYNNDTRLISVS--EDGLALVWSSIEGALLKV-LKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTE--KFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKV 4974
            +   A  +++ +S   Y L  Q++   +     GS++          +     L +  A   + H F     S V +  F N+D  L++    +  L+++  S   A +KV LKGH GPVTD   S   ++I + SLD    +W TE  + + E      S + C T  P N+   +VG    ++ + N++  KKV
Sbjct:   98 RAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDATLSIMMLSPPPASVKVILKGHGGPVTDFAWSLSNDIIVSTSLDGTLRIWNTEDGRCIREVRDPESSELLCCTFQPMNNNLTVVGNGKNHLQVVNISTGKKV 293          
BLAST of Telomerase protein component 1 vs. Ensembl Medaka
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:101170185])

HSP 1 Score: 55.4546 bits (132), Expect = 6.565e-7
Identity = 51/196 (26.02%), Postives = 87/196 (44.39%), Query Frame = 1
Query: 4432 KKNKAFTYKKDISSLVYYLSDQISHVAF-----GSILNLISMSYESGLIQLFNLKQFEALLNLRHHF-----SRVNKTFFYNNDTRLISVS--EDGLALVWSSIEGALLKV-LKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTE--KFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKV 4974
            +   A  +++ +S   Y L  Q++   +     GS++          +     L +  A   + H F     S V +  F N+D  L++    +  L+++  S   A +KV LKGH GPVTD   S   ++I + SLD    +W TE  + + E      S + C T  P N+   +VG    ++ + N++  KKV
Sbjct:   98 RAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDATLSIMMLSPPPASVKVILKGHGGPVTDFAWSLSNDIIVSTSLDGTLRIWNTEDGRCIREVRDPESSELLCCTFQPMNNNLTVVGNGKNHLQVVNISTGKKV 293          
BLAST of Telomerase protein component 1 vs. Ensembl Medaka
Match: phip (pleckstrin homology domain interacting protein [Source:NCBI gene;Acc:101175120])

HSP 1 Score: 55.4546 bits (132), Expect = 6.716e-7
Identity = 36/138 (26.09%), Postives = 59/138 (42.75%), Query Frame = 1
Query: 4507 VAFGSILNLISMSYESGLIQLFNLKQFEALLNLRH---------HFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSH 4893
            V +GS  N++  S+  GL   + L+Q       +H         H S V    F     R+ + S+D L  +W + +G LL  L+GH   ++D  VS +  +I   S D    +W          L+T +P+  +  H
Sbjct:  109 VIYGSPPNIVETSHSRGLNGAYRLRQLVPTAVYQHMKMHKRILGHLSSVYCVTFDRTGRRIFTGSDDCLVKIWGTDDGRLLATLRGHAAEISDMAVSYENTMIAAGSCDKTIRVW---------CLQTCAPLAVLEGH 237          
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Match: SMESG000032828.1 (SMESG000032828.1)

HSP 1 Score: 1450.65 bits (3754), Expect = 0.000e+0
Identity = 739/842 (87.77%), Postives = 746/842 (88.60%), Query Frame = 1
Query:   34 MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSSCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEINGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTNEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSENIIKRYTEALNTAIEISTLYNIPPIRGKILILANVNETAIYSPFKYGSSKSVKEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDEMVAGRVQFDMILSFDVSISEQCVSQYIKYNPSVLIIFNSI--------------NPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA 2517
            MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNS CLPNQLKKALINKFKDFSIYQLGKYR          KKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILK NEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVS+     + +I   T     A E + +Y                                                     LVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDEMVAGRVQFDMILSFDV+ISEQCVSQYIKYNPSVLIIFNSI              +PPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA
Sbjct:    1 MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSCCLPNQLKKALINKFKDFSIYQLGKYR----------KKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKANEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSE----VKEVIALVTSMCYVASEATEIY-----------------------------------------------------LVKDSLVNRFQKNTKCKSILKMSLDILSDNKKGKITVTDLFDEMVAGRVQFDMILSFDVNISEQCVSQYIKYNPSVLIIFNSIKFLFISYNFTIFSFSPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA 775          
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Match: SMESG000032835.1 (SMESG000032835.1)

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 495/511 (96.87%), Postives = 499/511 (97.65%), Query Frame = 1
Query: 4576 LKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSXXXXXXXXXXXXNHEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEIILMDTSNTNATFENSAKFNVLHVIGNHTGPITSISINSDDNFLSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKFL 6108
            LK F   +    ++  VNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKN EVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSIGLIKIKKLLLLNHEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEIILMDTSNTNATFENSAKFNVLHVIGNHTGPITSISINSDDNF+SSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTK L
Sbjct:  185 LKSFRDNIIANEYYYEVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNSEVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSIGLIKIKKLLLLNHEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEIILMDTSNTNATFENSAKFNVLHVIGNHTGPITSISINSDDNFVSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKNL 695          

HSP 2 Score: 342.813 bits (878), Expect = 2.150e-99
Identity = 162/167 (97.01%), Postives = 165/167 (98.80%), Query Frame = 1
Query: 2017 CEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA 2517
            C+ ++K SPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA
Sbjct:   28 CKSILKMSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA 194          

HSP 3 Score: 319.701 bits (818), Expect = 1.374e-91
Identity = 193/315 (61.27%), Postives = 212/315 (67.30%), Query Frame = 1
Query: 5917 HVIGNHTGPITSISINSDDNFLSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKFLSTDYLLVVNARSVLYGLDFKKSCLINKISEHHEPIISV-FDSQNELFTISVDGAVRKSSFHQIF---------------------QKNLKQHNNFKITHSIHFSSIMNFSDFIVALSDSGKLLLFYKNNPNDNWGLCKEFDVKAHYTKYNTQEFQTPFLQCSYFKKCGKHEVIMKICKSVFIFDLESLLFINFNGHVKDVVEDFDSLDFNIHXXXXXXXXXXXXQNSDQKYFIRFIEKGHILELLSMKNNE 6795
            H I  H   IT++  NS + FLS S D TIKLW +  + +D       F +                                 K  +++ I  H  PI S+  +S +   + S DG ++  +   +F                      KNLKQHNNFKITHSIHFSSIMNFSDFIVALSDSGKLLLFYKNNPNDNWGLCKEFDVKAHYTKYNTQEFQTPFLQCSYFKKCGKHEVIMKICKSVFIFDLESLLFINFNGHVKDVVEDFDSLDFNIHELIETESTLEILQN+DQKY IRFIEKGHILELLSMKNNE
Sbjct:  576 HEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEI--ILMDTSNTNATFENS-------------------------------AKFNVLHVIGNHTGPITSISINSDDNFVSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKNLKQHNNFKITHSIHFSSIMNFSDFIVALSDSGKLLLFYKNNPNDNWGLCKEFDVKAHYTKYNTQEFQTPFLQCSYFKKCGKHEVIMKICKSVFIFDLESLLFINFNGHVKDVVEDFDSLDFNIHELIETESTLEILQNNDQKYSIRFIEKGHILELLSMKNNE 857          

HSP 4 Score: 73.9442 bits (180), Expect = 1.363e-12
Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 1
Query: 1561 MCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMS 1665
            MCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMS
Sbjct:    1 MCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMS 35          
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Match: SMESG000032835.1 (SMESG000032835.1)

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 494/497 (99.40%), Postives = 495/497 (99.60%), Query Frame = 1
Query: 4618 SRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNYEVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSXXXXXXXXXXXXNHEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEIILMDTSNTNATFENSAKFNVLHVIGNHTGPITSISINSDDNFLSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKFL 6108
            SRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKN EVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSIGLIKIKKLLLLNHEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEIILMDTSNTNATFENSAKFNVLHVIGNHTGPITSISINSDDNF+SSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTK L
Sbjct:  119 SRVNKTFFYNNDTRLISVSEDGLALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTEKFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVLHNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYSNVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDANDQFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFVTVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSIGLLKFKNSEVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSIGLIKIKKLLLLNHEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEIILMDTSNTNATFENSAKFNVLHVIGNHTGPITSISINSDDNFVSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKNL 615          

HSP 2 Score: 319.701 bits (818), Expect = 2.870e-92
Identity = 193/315 (61.27%), Postives = 212/315 (67.30%), Query Frame = 1
Query: 5917 HVIGNHTGPITSISINSDDNFLSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKFLSTDYLLVVNARSVLYGLDFKKSCLINKISEHHEPIISV-FDSQNELFTISVDGAVRKSSFHQIF---------------------QKNLKQHNNFKITHSIHFSSIMNFSDFIVALSDSGKLLLFYKNNPNDNWGLCKEFDVKAHYTKYNTQEFQTPFLQCSYFKKCGKHEVIMKICKSVFIFDLESLLFINFNGHVKDVVEDFDSLDFNIHXXXXXXXXXXXXQNSDQKYFIRFIEKGHILELLSMKNNE 6795
            H I  H   IT++  NS + FLS S D TIKLW +  + +D       F +                                 K  +++ I  H  PI S+  +S +   + S DG ++  +   +F                      KNLKQHNNFKITHSIHFSSIMNFSDFIVALSDSGKLLLFYKNNPNDNWGLCKEFDVKAHYTKYNTQEFQTPFLQCSYFKKCGKHEVIMKICKSVFIFDLESLLFINFNGHVKDVVEDFDSLDFNIHELIETESTLEILQN+DQKY IRFIEKGHILELLSMKNNE
Sbjct:  496 HEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEI--ILMDTSNTNATFENS-------------------------------AKFNVLHVIGNHTGPITSISINSDDNFVSSSQDGTIKLWNMKGVFLDNLIVEKDFSSDEEIIPIKWTKNLKQHNNFKITHSIHFSSIMNFSDFIVALSDSGKLLLFYKNNPNDNWGLCKEFDVKAHYTKYNTQEFQTPFLQCSYFKKCGKHEVIMKICKSVFIFDLESLLFINFNGHVKDVVEDFDSLDFNIHELIETESTLEILQNNDQKYSIRFIEKGHILELLSMKNNE 777          

HSP 3 Score: 255.373 bits (651), Expect = 1.403e-70
Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 1
Query: 2104 MEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSR 2463
            MEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSR
Sbjct:    1 MEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSR 120          
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Match: SMESG000032828.1 (SMESG000032828.1)

HSP 1 Score: 867.455 bits (2240), Expect = 0.000e+0
Identity = 430/442 (97.29%), Postives = 431/442 (97.51%), Query Frame = 1
Query:   34 MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSSCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEINGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTNEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQ 1359
            MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNS CLPNQLKKALINKFKDFSIYQLGKY        I GKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILK NEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVS+
Sbjct:    1 MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSCCLPNQLKKALINKFKDFSIYQLGKYL-------ILGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKANEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSE 435          
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Match: SMESG000032828.1 (SMESG000032828.1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 431/448 (96.21%), Postives = 435/448 (97.10%), Query Frame = 1
Query:   34 MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSSCLPNQLKKALINKFKDFSIYQLGKYRNKKMVAEINGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKTNEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSE 1377
            MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNS CLPNQLKKALINKFKDFSIYQLGKY        I GKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILK NEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVS++  V++
Sbjct:    1 MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCVFHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLLRHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDISKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSIINLPTDWLEVVYHYMLISNSCCLPNQLKKALINKFKDFSIYQLGKYL-------ILGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLPGQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVRNIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNETILKANEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSEKITVTD 441          

HSP 2 Score: 563.533 bits (1451), Expect = 3.296e-178
Identity = 273/274 (99.64%), Postives = 274/274 (100.00%), Query Frame = 1
Query: 1696 KITVTDLFDEMVAGRVQFDMILSFDVSISEQCVSQYIKYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA 2517
            KITVTDLFDEMVAGRVQFDMILSFDV+ISEQCVSQYIKYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA
Sbjct:  436 KITVTDLFDEMVAGRVQFDMILSFDVNISEQCVSQYIKYNPSVLIIFNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEKYGLKNIEELINCEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINTIIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRCHIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNCQKIFLLKNSRDEDLDNLQLKSFRDNIIA 709          
The following BLAST results are available for this feature:
BLAST of Telomerase protein component 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEP16.025e-11422.54telomerase associated protein 1 [Source:HGNC Symbo... [more]
TEP16.220e-9422.07telomerase associated protein 1 [Source:HGNC Symbo... [more]
TEP12.483e-9324.37telomerase associated protein 1 [Source:HGNC Symbo... [more]
TEP14.481e-5420.57telomerase associated protein 1 [Source:HGNC Symbo... [more]
WDR381.136e-923.57WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG30713.801e-821.53gene:FBgn0023527 transcript:FBtr0070398[more]
CG75683.712e-720.37gene:FBgn0039673 transcript:FBtr0330294[more]
CG75683.819e-720.37gene:FBgn0039673 transcript:FBtr0330295[more]
U4-U6-60K7.059e-621.52gene:FBgn0036733 transcript:FBtr0075209[more]
Taf58.154e-620.19gene:FBgn0010356 transcript:FBtr0088240[more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tep11.310e-6041.18telomerase-associated protein 1 [Source:ZFIN;Acc:Z... [more]
taf52.121e-723.04TAF5 RNA polymerase II, TATA box binding protein (... [more]
daw13.699e-720.80dynein assembly factor with WDR repeat domains 1 [... [more]
daw14.881e-720.80dynein assembly factor with WDR repeat domains 1 [... [more]
wdr136.396e-726.53WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hs3st56.917e-7626.28heparan sulfate-glucosamine 3-sulfotransferase 5 [... [more]
ngfr1.221e-823.50nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr2.140e-823.68nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr2.934e-823.68nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ENSXETT00000036352.11.419e-722.43WD repeat domain 38 [Source:NCBI gene;Acc:10049307... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tep12.715e-11122.38telomerase associated protein 1 [Source:MGI Symbol... [more]
Tep11.696e-1426.70telomerase associated protein 1 [Source:MGI Symbol... [more]
Wdr386.376e-1225.40WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr386.376e-1225.40WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr5b1.033e-824.42WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of Telomerase protein component 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99973|TEP1_HUMAN2.893e-11322.54Telomerase protein component 1 OS=Homo sapiens OX=... [more]
sp|O08653|TEP1_RAT7.589e-11223.81Telomerase protein component 1 OS=Rattus norvegicu... [more]
sp|P97499|TEP1_MOUSE1.899e-11022.38Telomerase protein component 1 OS=Mus musculus OX=... [more]
sp|Q94818|TE80_TETTH5.486e-2830.04Telomerase component p80 OS=Tetrahymena thermophil... [more]
sp|Q54KD0|Y7407_DICDI1.307e-1130.47TPR repeat-containing protein DDB_G0287407 OS=Dict... [more]
back to top
BLAST of Telomerase protein component 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A369RW692.690e-13825.40Telomerase protein component 1 OS=Trichoplax sp. H... [more]
G3WIK54.399e-13222.82Telomerase associated protein 1 OS=Sarcophilus har... [more]
G3WIK68.061e-13122.83Telomerase associated protein 1 OS=Sarcophilus har... [more]
A0A5F8GAK52.226e-12623.35Telomerase associated protein 1 OS=Monodelphis dom... [more]
A0A1S3J9Z13.056e-12624.22telomerase protein component 1 isoform X1 OS=Lingu... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tep17.921e-6141.11telomerase-associated protein 1 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000041500.14.694e-1538.95pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000044252.11.014e-1030.28pep primary_assembly:Astyanax_mexicanus-2.0:1:2462... [more]
taf54.272e-721.08TATA-box binding protein associated factor 5 [Sour... [more]
taf54.272e-721.08TATA-box binding protein associated factor 5 [Sour... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010121.16.533e-2040.95pep scaffold:Pmarinus_7.0:GL485934:2276:4067:1 gen... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAF56.902e-926.11Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328955.385e-1131.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393966.861e-822.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348658.744e-828.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319749.856e-823.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373281.083e-720.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046678.15.809e-1640.78pep primary_assembly:ASM223467v1:17:3383455:339057... [more]
wdr135.065e-726.02WD repeat domain 13 [Source:NCBI gene;Acc:10117018... [more]
wdr136.565e-726.02WD repeat domain 13 [Source:NCBI gene;Acc:10117018... [more]
wdr136.565e-726.02WD repeat domain 13 [Source:NCBI gene;Acc:10117018... [more]
phip6.716e-726.09pleckstrin homology domain interacting protein [So... [more]
back to top
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032828.10.000e+087.77SMESG000032828.1[more]
SMESG000032835.12.150e-9996.87SMESG000032835.1[more]
SMESG000032835.12.870e-9299.40SMESG000032835.1[more]
SMESG000032828.10.000e+097.29SMESG000032828.1[more]
SMESG000032828.13.296e-17896.21SMESG000032828.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003493 ID=SMED30003493|Name=Telomerase protein component 1|organism=Schmidtea mediterranea sexual|type=transcript|length=6988bp
TCTTCCGATCTTGTAGTTTGCGGTATTTAAATTATGTCCACTACGTATAA
AGGAAAACTATATTTTACGGAACGCGATTTAACAACAAGATATGATAAAG
CTAAAATTAAAACTTATAGATATGAAATTGGTAAAAGCTCTCCTCTCTGG
CTATCAAATTTCAGCTTTAATAAAACATGTGTTTTTCACAATTTGATTAA
TAACAAATCTATATTAAATCCAAATGAAAATTTATCCAAGAATAATGTTT
CAGTAGATGAATGGATGAACTTAGATGTTGTTGATGATTTTCAATCTTCA
GATAATTTAGTCATAAGTGACTCAAATTTGTTAAGACACAAATCCCCTAA
TTGCGTAATAGGTAACGCAAACCGCTATTTAACTAATACAAATACTTTTA
AAGTAAATTTGACAAATTTAGTTATGAATTCTTTACCTTATGGTATTAAT
AATTTATCCAAAATGGATCTCTATGTCGATATTTCTAAAGAAGATCCGGA
ATTTATTTTAAAAGTTTCATTATACTGCCGTAAAGAACTTAACATACGTT
CAATATCAAACTATTTAGTAGCAGTTTCAGTATATTCGAATGAATCTAGA
CCTTACTTAAAAAAATATCTTCAATCAATCATAAATTTACCAACTGATTG
GCTAGAAGTTGTATATCATTATATGTTAATTTCTAATTCAAGTTGTCTTC
CAAATCAATTGAAAAAAGCATTAATTAACAAATTTAAGGATTTTTCTATT
TATCAATTGGGTAAGTATCGTAACAAAAAAATGGTAGCTGAAATTAATGG
GAAAAAAATCAAACTATCATTGAAAAATATGGTAAGAATACTTCATATTT
GCGAACCTGTCGAAAATGTTATGTCGCTATTGGGGAAAAACTATCCATTA
ACTCAAGACGCGTTCTTCATTTCTAAGTTACCTGGTCAGTGGGATGAATC
GAAAGCCGGGAAAAGAATGAAAATTCCTACGCCAGAAACCTGGGAGACTC
AAATTAGTATTTATGGAAATAAACCGGAAATATGGCAGAAGCTAATAGAT
AATAAGTCCTTACCATATATGGCCATGGTTCGAAATATACGAAATTTGTT
ACAATCGAATATTAAAGATCATTATCACTTAAAAGTTGCTCAAAATATTG
AAAAAGAATCAAATGTTATTCACGGAAAGTTATTACCATTCCAATATTTC
ACTGCTTATAAAATCCTCGAAGAATTTAATGAAACTATTTTAAAAACCAA
TGAAAAACTAATTGAAATTGAGCTTAATTCAATCAATAAAACTAAGCAAA
AAACTCTGGATCGCAAAAATAAAGTTCGAAATGCTATTAAACTGAAAAAA
GTTTCACAGAGGTCCGTAGTTTCAGAAAATATTATCAAAAGATATACTGA
GGCTTTAAATACTGCAATTGAAATATCTACTCTTTATAATATTCCTCCAA
TTCGAGGTAAAATTCTCATTTTAGCTAATGTAAATGAAACTGCAATATAC
TCTCCATTCAAATATGGATCATCTAAATCGGTTAAAGAAGTTATTGCACT
TGTAACATCAATGTGTTACGTTGCTAGTGAAGCTACTGAAATATACTTGG
TTAAAGATAGTTTAGTAAATAGATTTCAAAAGAATACAAAGTGTAAATCT
ATTTTGAAAATGTCGTTAGATATTTTGTCTGATAATAAAAAAGGAAAAAT
AACTGTGACGGATTTATTTGATGAAATGGTTGCAGGCCGAGTTCAATTTG
ATATGATATTGTCATTCGATGTGAGTATATCAGAACAATGTGTGTCGCAG
TATATCAAATATAATCCTTCAGTATTAATAATTTTTAATTCCATAAACCC
ACCAACTGAGACCATGAATTGTAAATCATCAAATATAGTTCGAATTGATG
GGTTTAATGAACACACAATTAAAATAATATCTGAATTTAATAGCGGTAGT
ATTATTAAGAAAATTGATTTTATGGATGAGAAATATGGTCTGAAAAACAT
TGAAGAATTGATAAACTGCGAACCTCTTGTAAAAGACAGTCCTAATTTTC
CTGATGCTATTCCAAATGAAATTAATATTTTCATTTCTTCAACTTTTATG
GATATGGAAAAGGAACGAAGTATAATTAATACCATAATAATTCCTTCTGT
TAAAAGAAATATTTTGCTTAATGTTACGAATTGCATTGATATTAATTGTA
TTGATTTGCGATGGGGTGTTCCTATTCATTGGGGTCAGAGTGAGAAATTA
TTACAATACTGCATAGAGCAGATTAAAAGATGTCATATTTTTGTCGGAAT
ACTAGGATCTCGATCTGGATGGATTCCAGATTCCAAAGTAATTCGAAATC
TGTCTGAGATCTATCCAGAATTAAAGGATTATGAAGGATTATCAGTTACT
AATATTGAATATCAGTTTGCTTCTAAAAATTGTCAGAAAATTTTTTTACT
AAAAAATTCAAGAGACGAAGATCTTGACAATTTGCAATTGAAATCATTTC
GAGACAATATTATTGCAAATGAATATTATTATGAATACTCAAATGAAAAT
GTCCTTAATGATTTCAAAATTTTAATTCCATGTTTAAATAAAATTATTCT
GGAAAAAATAAATTTCCAAAATGAAATTAATAATTCAATTCTTTCTGAAT
GTCACGGTGAACAAACTAGATATAAAAGCATTATGAAAGAAACTTTAACT
TTTCTTAAAAGTTATACGGAAAATATTGAATCTTTTCAAAAAGATGAAGT
TAATCAGTTGCTTTTAATTGTGGAAAAGAAATTGTCATTTGAAATTGATA
TCGATTCACCTGTTAATTGCCAATCCTTTATTACCCCTAAAAGCACTGAT
AAAAATGAAAATGAATTATTACGTTCTGGTGGAATATTAATTATTGATGG
CAAACCAGGATCGGGGAAAACTTCTATAATGTCAGAATTAATTAGTCAGT
ATAGTGAAATATCCAAATTACCTAACAGATTGAAATTTATTTGGATTTTT
GATGTTATTAAATTTATAAATAATGAAAAATCTACGGATCTTTATTTGTA
CGATTTACTCACTGATATAATCGAATTTCTTATTTATAATTTGCCATTTC
CCATGAAAAGTTACCTTAAAAAGGAATTACAGGCTCATAATGAAATAAAT
TCTGAAGAATTTTGGCGACCAATTAATATTAAACATGCACTTTTAATTTG
GAATTTAATATTGAAAAAACTGCTTCAATTAAAAAATTTATATGTTACAA
TTTTCATTGATGGAATCGATAATTTAAGAGATTTTTCAGAAGCTTCAACT
CTTTCTTGGATTCCATTAGTTTTACCTCCTAAATTTCGTATAATTATGAC
AACTTTATCCAATTCAAATTTATCAGCATCTAGTAAATTCAGAAAGAATT
CCGTTATCCATGAAATCCAGCCCATTTCAATTTTTCACAAAAGAAAAGTT
ATTGAGAATTTATTGAAAAAAATTGGAAAAACCTTACAATCAAATCCATT
TGATAATTATATGACCTATTTCTCGATGAAACGTGATTCAAATAAACCAA
TGTTTTTAAAAATCGCAATAAATCATATGACTTTAAACACCAAATATGAC
AAAGTAAAAGAAGAGATTGATAATCTTCCATCGACATTGGAAAATTTAAT
TTTGTACTCATTAAAAAGTATTGAAAAGGAAATTCCTCAAGAAATTTGTT
TAGTATTTTTCTCATTTTTAAATCACAGCAAATCAGGTTTTACAATGAAA
GATTTACAAATGCTGATGAGTATATATTTTAGAGTGTATATTGAGAAAAA
TAATTTTCTTTTAACTGCAAATGATTACAATGATTTCAAATTGGCCTCTA
ATTTGCCTTTATGTTTTTCCATGTATCCAATAATATACATTAAAAATCAC
AGTGCCATTCTTCTTGATGAAGACAAAAAAGGTAGAATCATAATTAAAAA
TTCTTTCATTGGAAACCTTATAACTAAGTATTCTATGTCAATTGATAAAA
CGGTAGTTCACTGCATCATATCAATTTATTGTGATGAAATGTTAAAATTC
GACGACAAATTTGCCTTTCGTGATATAATATATTATAAATTTAAATCACA
TTTATACGAAGAATGTTGTTCTCTTTTAACAAACATTGAGTATTTAAAAC
GAAGGTTTGATTTGGGCATTGCTGAGGGTCTTTTACTAGACTACAATGGA
TTCGAAGAAACAAATTCCGAAAGAAATAAATTGTGGTTTGATATTTGCAA
TAGACAAACATATAAAGACTTTAAAACATTCATATCAGAAAACTTGACTT
TTTTAATCGAGAATCCCAGTTTCTGTATTCAGCAAGCAATTAATGAGCCT
TTACATAGTTGTGTAAATGTGAAATGTAATGAAATAAAAATTATTCCTTT
TAATTTTTCAAATACCAAGCCTGTAATCCTAAAAAAGAATAAAGCTTTCA
CTTATAAAAAGGATATTAGTTCTTTAGTTTATTACTTATCTGATCAGATT
TCTCATGTTGCTTTTGGTTCAATATTAAATTTAATATCTATGAGCTATGA
AAGCGGATTAATTCAATTATTTAATTTAAAGCAATTTGAAGCATTATTAA
ATTTACGTCATCACTTTTCAAGAGTTAATAAAACATTTTTTTATAATAAT
GATACAAGACTTATCAGTGTTAGTGAAGATGGTTTGGCACTTGTTTGGAG
TTCTATTGAAGGAGCTTTACTTAAAGTGCTTAAAGGTCATTTGGGACCCG
TAACTGATTGTATTGTATCTACGAAGGCAAATTTAATTGGTACAGTTAGC
TTAGACTCTCAATTTATAATGTGGAAAACTGAAAAATTTGTGTTAGAAAA
AATTTTAAAAACGAAGTCTCCAATTAATTGCATAACTTCACATCCTAACA
ATGATTTTAAAGTGATTGTTGGTTGTTGGAATGGAAATATGTTTATTTAT
AATTTAAATAATTATAAAAAAGTTGCGGTCCTTCATAATAATAAATCTAC
AAAGTCTATTGTCTTTCATCCTTATTATGATTTATTTTTAACGACTACAA
TTAATGGTGAAATAAATGTTTGGAGTTCAACTAACGGAATGAAACTGAAA
GTTATTTCCATGGAAAATAAAAATTATTATAGTAATGTTCAATATTCTTC
TGATGGACTACAGGTTTTTGAATTTGGCGCGTTTCGCAGTCCCTTTTTTG
GTATTAATGTTTGGAGTACTACTTTGGGATATAATTCAAACGAAAAAGAT
TTATTGGATATTACATGTGTCGATGCTAATGATCAGTTTATTGTATGTGG
AACCAAATTCGGTGAAATTTCAATTTTAAATAGCAACTTTACCAATAAAT
TACAAAAAACCATATGCGATGTCGCATTAACTTCTATATGCCTAGAAAAG
AGCAATAAACCTCTTTCAGTCACGTTTTTTGTTACAGTTGATTATGAAAG
GAACTTCTATCTCATTCAAATGATTGAAGATAATATAATAATAAAAAAAG
TTGAAAGTTTACATTCTAGACCTGTTATTGTAATTTATTTATTACCGAAT
TGTATTATATCAGGAAGTGATGATTGCTCAATTGGCCTTTTGAAATTTAA
GAACTATGAAGTCACGGAAAAACTACAGTTATTTAATATTTTCCTAGATT
CAATATTAACGATTGATGTTTGTAAAGAATTAATTCTTGTTGGTTGCAAA
GATGGAAGTATCGGTCTTATTAAAATTAAAAAATTACTTTTATTGAATCA
CGAGATTAAAGCTCATAATGATTGGATTACTACTGTTCGTTTCAATAGTT
TCAATTACTTTTTATCTGGTTCCAATGACTTTACTATAAAACTTTGGGAG
ATAATTTTGATGGATACATCCAACACGAATGCAACTTTTGAAAACTCAGC
AAAATTCAACGTACTTCATGTAATTGGAAATCACACTGGTCCGATAACAT
CTATTTCTATTAATAGTGACGATAATTTTCTTTCTTCTTCACAAGATGGA
ACAATTAAATTGTGGAATATGAAAGGTGTATTTTTAGATAATTTAATTGT
AGAAAAAGACTTTTCATCTGATGAAGAAATTATTCCTATTAAATGGACAA
AATTTCTATCAACAGATTATTTACTAGTTGTAAATGCAAGATCTGTATTA
TACGGTCTAGATTTTAAAAAGTCTTGCTTGATAAATAAAATTAGCGAGCA
TCATGAACCGATTATATCAGTCTTTGATTCTCAAAATGAACTTTTTACAA
TTTCAGTTGATGGTGCGGTAAGAAAATCAAGTTTCCATCAAATATTTCAA
AAGAACTTGAAACAACATAATAATTTTAAAATTACTCATTCTATTCATTT
TTCCTCTATAATGAACTTTAGTGATTTCATAGTTGCTTTATCTGATTCTG
GAAAATTGTTACTCTTTTATAAAAATAATCCAAATGACAACTGGGGATTA
TGTAAAGAGTTTGATGTCAAAGCGCACTATACTAAATATAATACACAAGA
ATTCCAAACTCCATTTTTACAATGTAGTTATTTCAAAAAATGTGGCAAGC
ATGAGGTTATTATGAAAATATGTAAATCTGTATTTATATTTGACCTGGAA
TCTCTATTATTCATCAATTTCAATGGCCATGTCAAAGATGTAGTTGAAGA
TTTTGATTCATTAGATTTCAATATCCATGAATTGATTGAAACCGAAAGTA
CCTTAGAAATTCTGCAAAATAGTGATCAAAAATATTTCATACGATTTATA
GAGAAAGGTCACATTTTGGAATTATTGTCAATGAAAAATAATGAGCAAAA
CTTGCACAGTTTGGGCAAACTTCCTATGAGCGGAATTCCGTGTCATATAA
TGATGTTTGAGAATAGTTATCAGGAGCAAGAAATTTTAATTGGCTACTTA
GATGGAAATTCTGATATTATTGGATTTAAACAATTGTTATAAATTAGTAG
AAGTTTTTACTTAATTTATTATTTTCTTTGAAAAAAAA
back to top

protein sequence of SMED30003493-orf-1

>SMED30003493-orf-1 ID=SMED30003493-orf-1|Name=SMED30003493-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2303bp
MSTTYKGKLYFTERDLTTRYDKAKIKTYRYEIGKSSPLWLSNFSFNKTCV
FHNLINNKSILNPNENLSKNNVSVDEWMNLDVVDDFQSSDNLVISDSNLL
RHKSPNCVIGNANRYLTNTNTFKVNLTNLVMNSLPYGINNLSKMDLYVDI
SKEDPEFILKVSLYCRKELNIRSISNYLVAVSVYSNESRPYLKKYLQSII
NLPTDWLEVVYHYMLISNSSCLPNQLKKALINKFKDFSIYQLGKYRNKKM
VAEINGKKIKLSLKNMVRILHICEPVENVMSLLGKNYPLTQDAFFISKLP
GQWDESKAGKRMKIPTPETWETQISIYGNKPEIWQKLIDNKSLPYMAMVR
NIRNLLQSNIKDHYHLKVAQNIEKESNVIHGKLLPFQYFTAYKILEEFNE
TILKTNEKLIEIELNSINKTKQKTLDRKNKVRNAIKLKKVSQRSVVSENI
IKRYTEALNTAIEISTLYNIPPIRGKILILANVNETAIYSPFKYGSSKSV
KEVIALVTSMCYVASEATEIYLVKDSLVNRFQKNTKCKSILKMSLDILSD
NKKGKITVTDLFDEMVAGRVQFDMILSFDVSISEQCVSQYIKYNPSVLII
FNSINPPTETMNCKSSNIVRIDGFNEHTIKIISEFNSGSIIKKIDFMDEK
YGLKNIEELINCEPLVKDSPNFPDAIPNEINIFISSTFMDMEKERSIINT
IIIPSVKRNILLNVTNCIDINCIDLRWGVPIHWGQSEKLLQYCIEQIKRC
HIFVGILGSRSGWIPDSKVIRNLSEIYPELKDYEGLSVTNIEYQFASKNC
QKIFLLKNSRDEDLDNLQLKSFRDNIIANEYYYEYSNENVLNDFKILIPC
LNKIILEKINFQNEINNSILSECHGEQTRYKSIMKETLTFLKSYTENIES
FQKDEVNQLLLIVEKKLSFEIDIDSPVNCQSFITPKSTDKNENELLRSGG
ILIIDGKPGSGKTSIMSELISQYSEISKLPNRLKFIWIFDVIKFINNEKS
TDLYLYDLLTDIIEFLIYNLPFPMKSYLKKELQAHNEINSEEFWRPINIK
HALLIWNLILKKLLQLKNLYVTIFIDGIDNLRDFSEASTLSWIPLVLPPK
FRIIMTTLSNSNLSASSKFRKNSVIHEIQPISIFHKRKVIENLLKKIGKT
LQSNPFDNYMTYFSMKRDSNKPMFLKIAINHMTLNTKYDKVKEEIDNLPS
TLENLILYSLKSIEKEIPQEICLVFFSFLNHSKSGFTMKDLQMLMSIYFR
VYIEKNNFLLTANDYNDFKLASNLPLCFSMYPIIYIKNHSAILLDEDKKG
RIIIKNSFIGNLITKYSMSIDKTVVHCIISIYCDEMLKFDDKFAFRDIIY
YKFKSHLYEECCSLLTNIEYLKRRFDLGIAEGLLLDYNGFEETNSERNKL
WFDICNRQTYKDFKTFISENLTFLIENPSFCIQQAINEPLHSCVNVKCNE
IKIIPFNFSNTKPVILKKNKAFTYKKDISSLVYYLSDQISHVAFGSILNL
ISMSYESGLIQLFNLKQFEALLNLRHHFSRVNKTFFYNNDTRLISVSEDG
LALVWSSIEGALLKVLKGHLGPVTDCIVSTKANLIGTVSLDSQFIMWKTE
KFVLEKILKTKSPINCITSHPNNDFKVIVGCWNGNMFIYNLNNYKKVAVL
HNNKSTKSIVFHPYYDLFLTTTINGEINVWSSTNGMKLKVISMENKNYYS
NVQYSSDGLQVFEFGAFRSPFFGINVWSTTLGYNSNEKDLLDITCVDAND
QFIVCGTKFGEISILNSNFTNKLQKTICDVALTSICLEKSNKPLSVTFFV
TVDYERNFYLIQMIEDNIIIKKVESLHSRPVIVIYLLPNCIISGSDDCSI
GLLKFKNYEVTEKLQLFNIFLDSILTIDVCKELILVGCKDGSIGLIKIKK
LLLLNHEIKAHNDWITTVRFNSFNYFLSGSNDFTIKLWEIILMDTSNTNA
TFENSAKFNVLHVIGNHTGPITSISINSDDNFLSSSQDGTIKLWNMKGVF
LDNLIVEKDFSSDEEIIPIKWTKFLSTDYLLVVNARSVLYGLDFKKSCLI
NKISEHHEPIISVFDSQNELFTISVDGAVRKSSFHQIFQKNLKQHNNFKI
THSIHFSSIMNFSDFIVALSDSGKLLLFYKNNPNDNWGLCKEFDVKAHYT
KYNTQEFQTPFLQCSYFKKCGKHEVIMKICKSVFIFDLESLLFINFNGHV
KDVVEDFDSLDFNIHELIETESTLEILQNSDQKYFIRFIEKGHILELLSM
KNNEQNLHSLGKLPMSGIPCHIMMFENSYQEQEILIGYLDGNSDIIGFKQ
LL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR003593AAA+_ATPase
IPR025139DUF4062
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR027417P-loop_NTPase
IPR008858TROVE_dom
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding