Otoferlin

Overview
NameOtoferlin
Smed IDSMED30003490
Length (bp)6689
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Otoferlin (SMED30003490) t-SNE clustered cells

Violin plots show distribution of expression levels for Otoferlin (SMED30003490) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Otoferlin (SMED30003490) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Otoferlin (SMED30003490) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003490

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003490SMESG000037807.1 dd_Smed_v4_5915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003490SMESG000037807.1 dd_Smed_v4_5915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003490SMESG000037807.1 dd_Smed_v4_5915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003490SMESG000037807.1 dd_Smed_v4_5915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003490SMESG000037807.1 dd_Smed_v4_5915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003490SMESG000037807.1 dd_Smed_v4_5915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003490SMESG000037807.1 dd_Smed_v4_5915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003490SMESG000037807.1 Contig38828uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003490SMESG000037807.1 Contig38828newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003490SMESG000037807.1 Contig35026uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003490SMESG000037807.1 Contig35026newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003490SMESG000037807.1 Contig15730uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003490SMESG000037807.1 Contig15730newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 478/1306 (36.60%), Postives = 738/1306 (56.51%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEF--------------------------ENPITDRKLSDADDISIDSHGMGSDKRTLIDPQT-GEIGEFNYGQTDNESIESGE----DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS-----------EANEEEEKEV-------PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            MAL+++LK V  L  R DRI K+ FR     ++V+   +D   F E F+WP+   +D  + LE++++ YSK  +NKLIG+  + LQK++E+  +   + LID N++II+ ++  E+ Y + D  +  W   +F                            P  ++    A      +  +G ++    +PQ   E         D+ +I  G+    D  S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+S   +FD++I++  +   N+    L  G L+G F+MDV TVY+ P+H F HKWA+L DP DI SG KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   VKIY+AE LPRMNT +MA +K A  G++K LVDP+VQV FAG  G+T V+K++Y P WNE++VFT++FP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   ++   ++LN GLGEGV++R RLL+ +   ++ + +  L +  +V      PIS+   GK E F L GAF EAS+ID   G K  PI FE+++G  GN +D            E  +EEE ++        + + G+   +     S+T PM P   D+ YFHL + E+KPC+Y+ S+  D + R +  NI++ + ++    +  + E+   E+     R++  L+         L+     +  S +T LD+ER+K     LE M  +A+ +     +  +  +L+ C+  ++KL  L   PQ+ +PDIFIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q ++++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRYQATDGTVGSWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSSRPPGEKSFRRAGRSVFSAMKLGKNRSHKEEPQRPDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNL----LRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPP--ERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDRRNGDK--PITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASV-----SSTPPMRPQVTDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMIKTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLP-------------------------------------PINGPVDVDRGP--------IMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1232          

HSP 2 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 425/598 (71.07%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLM--LYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVR+YV+RA DLHPAD NGK+DPY+ +RLG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCK+   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVIIWNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD++F+ F+NPLKS+KYLIC ++KW +IK ++    L +L LF+Y+ PGY+ K++LGA
Sbjct: 1405 IDELKVYPKELE--SEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHF-GPPGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLGLFLYSLPGYMVKKLLGA 1997          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 478/1306 (36.60%), Postives = 738/1306 (56.51%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEF--------------------------ENPITDRKLSDADDISIDSHGMGSDKRTLIDPQT-GEIGEFNYGQTDNESIESGE----DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS-----------EANEEEEKEV-------PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            MAL+++LK V  L  R DRI K+ FR     ++V+   +D   F E F+WP+   +D  + LE++++ YSK  +NKLIG+  + LQK++E+  +   + LID N++II+ ++  E+ Y + D  +  W   +F                            P  ++    A      +  +G ++    +PQ   E         D+ +I  G+    D  S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+S   +FD++I++  +   N+    L  G L+G F+MDV TVY+ P+H F HKWA+L DP DI SG KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   VKIY+AE LPRMNT +MA +K A  G++K LVDP+VQV FAG  G+T V+K++Y P WNE++VFT++FP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   ++   ++LN GLGEGV++R RLL+ +   ++ + +  L +  +V      PIS+   GK E F L GAF EAS+ID   G K  PI FE+++G  GN +D            E  +EEE ++        + + G+   +     S+T PM P   D+ YFHL + E+KPC+Y+ S+  D + R +  NI++ + ++    +  + E+   E+     R++  L+         L+     +  S +T LD+ER+K     LE M  +A+ +     +  +  +L+ C+  ++KL  L   PQ+ +PDIFIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q ++++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRYQATDGTVGSWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSSRPPGEKSFRRAGRSVFSAMKLGKNRSHKEEPQRPDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNL----LRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPP--ERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDRRNGDK--PITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASV-----SSTPPMRPQVTDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMIKTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLP-------------------------------------PINGPVDVDRGP--------IMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1232          

HSP 2 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 424/598 (70.90%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLM--LYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVR+YV+RA DLHPAD NGK+DPY+ +RLG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCK+   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVIIWNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD+SF+ F+NPLKS +Y + + ++W L+K L++  LL LL LF+Y+ PGYL K++LGA
Sbjct: 1405 IDELKVYPKELE--SEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHF-GPPGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLLALFLYSVPGYLVKKILGA 1997          
BLAST of Otoferlin vs. Ensembl Human
Match: FER1L6 (fer-1 like family member 6 [Source:HGNC Symbol;Acc:HGNC:28065])

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 411/1157 (35.52%), Postives = 628/1157 (54.28%), Query Frame = 3
Query:  669 AATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNE--GDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVL---RSESGGLPAGAKVYSVP----------------PISDGTCG-------------------------KKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS--------EANEEEEKEVPSVNQGN---RPKIPKWCHSTTEPMLP--DTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAI--RLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK------------GKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAI 3908
            +A+  R   +   +H    +++++QI+IT+ EARQL G NI+P++ + IG++ K + V+  TNSP+YN+Y  F+F   +  LFD++I++           +L+   LIG F++D+ TVYN P H F +KWA+L DP DI +G KGY+K D+++MGKG+ +K  PK+       + +E IE NLL+P       +R  A   V++YKAE LP+MN+ IMA +  A  GDSK LVDPFV+VSFAG  GRT V+KN   P W+E+++F EMFP LC R+++ V+D  ++ +  +ATH+IDL +I NE  GD GFLPTFGP+W+NLYG+PRN++   +M   +E+N G GEGV++RGR+L+ I   +   R++        K   +P                   DG                            K E FLL GAF+EA++ID +IG K  PI FE+S+G  GN +D          A   EE  +P +++G       +P    STT P  P     ++ Y +L F  KKPC+Y IS   D   R    N+LEK+ +    ++E + EL    +     +MK  L  FI    + ++  +    +  +T LDK+R+ L    LE M  +AK + Q   K  L++   + E +  ++K+  L+  PQ+ +PD+FIW++ + +R+A+ARI ++++LYS +  + G    ++ T FL+ PG+    P+GW++Q ++ +YLWLG ++        LP+GY    S+       PP  ++Y E+  FQLRAHM+ AR LI +D +GLSD FA++    H  TTK++ +TLSP W+Q L+ + ++ +     +  +PP++VVE++D D +        GK E+LG     P V L +++Y+ PRL +  I+ G ++ G+LLA FEL+QV P       +G+Q +                                      P E   +T     + PVP  IRP L  YRVE LFWGVREM++VQL+SVD+P+  IE G   + S VI S K  PNFS      ++ LPEN L  PPL I   D R FGR+ L+G + I+ + +++ K            G  P  + +  +    SS    ++ + P D I +
Sbjct:   60 SASPKRRSKLLTKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKISVFH------HKLIGSVLIGSFKVDLGTVYNQPGHQFCNKWALLTDPGDIRTGTKGYLKCDISVMGKGDVLKTSPKT------SDTEEPIEKNLLIPNGFPL--ERPWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCADPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALKELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFLLFGAFFEATMIDRKIGDK--PISFEVSIGNFGNLIDGGSHHGSKKSAESAEEDLLPLLHEGQGDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEKMKTVLSDFISRSSAFISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQ-QKKKLSVDEMIHEAQNFVEKIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPGK---RPAGWSVQAKVDVYLWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVVELYDSDAV--------GKPEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVPP-------SGLQGL-------------------------------------PPVEPPDITQ----IYPVPANIRPVLSKYRVEVLFWGVREMKKVQLLSVDRPQALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINYLKQFLCKLREPLAPITQVDGTQPGHDISDSLTATESSGAHSSSQDPPADHIYV 1137          

HSP 2 Score: 555.058 bits (1429), Expect = 1.480e-163
Identity = 282/591 (47.72%), Postives = 396/591 (67.01%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD-NRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEI-EEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
             ++Y   LE   EF  F  +++TF L +G+  +D+   D +R++G FKG+  IYK   +    +    +L + + +P N PV +L+R+Y++ A +L PADP+GKSDPY++++LG   I +++ YIPKQLNP+FG+ FE+   FP+ES L I + D D++  DD+IGETKIDLENR+YSKH+A+CGL   +E  GYN WRD   PT +L KLCK+   D P +     K+ +    F       EED  E  +S E LAL+V+ +W  +P  GC LVPEH+ETRPL++ +KPG++QG L+MW+DMFPK++  P  P+DI+PR+P  YELRV IWNTEDVIL D  + TG+KSSDI+VKGW+KGL  D Q TDVHY SL+GEGNFNWRF+F F Y+ AE ++V   +++ F++++ E K+P  L LQVWD + +++DDFLG LE+ L+  PR AKS + C L +       + ISIF+ KR RGWWPF+       K  ++ GK++AEF L++ EE E  PVG  R EP  L  PNRPD+SF  FM+P K L YLI   +K ++I A I+  L+  LVLFIY  PG +++R++
Sbjct: 1277 LQIYDGDLE--SEFNNFEDWVKTFELFRGKSTEDDHGLDGDRVIGKFKGSFCIYKSPQDSSSEDSG--QLRIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFHP--GKIQIGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDIPEVGCRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEETKISIFQQKRVRGWWPFS-------KSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKNYKKYIIIAFILIILIIFLVLFIYTLPGAISRRIV 1854          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 425/598 (71.07%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVR+YV+RA DLHPAD NGK+DPY+ +RLG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCK+   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVIIWNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD++F+ F+NPLKS+KYLIC ++KW +IK ++    L +L LF+Y+ PGY+ K++LGA
Sbjct:  638 IDELKVYPKELE--SEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHF-GPPGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLGLFLYSLPGYMVKKLLGA 1230          

HSP 2 Score: 355.525 bits (911), Expect = 1.969e-100
Identity = 187/501 (37.33%), Postives = 288/501 (57.49%), Query Frame = 3
Query: 2331 SPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            S +T LD+ER+K     LE M  +A+ +     +  +  +L+ C+  ++KL  L   PQ+ +PDIFIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q ++++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:   38 SSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLP-------------------------------------PINGPVDVDRGP--------IMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 485          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 424/598 (70.90%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLM--LYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVR+YV+RA DLHPAD NGK+DPY+ +RLG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCK+   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVIIWNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD+SF+ F+NPLKS +Y + + ++W L+K L++  LL LL LF+Y+ PGYL K++LGA
Sbjct:  715 IDELKVYPKELE--SEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHF-GPPGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLLALFLYSVPGYLVKKILGA 1307          

HSP 2 Score: 355.91 bits (912), Expect = 3.492e-100
Identity = 187/501 (37.33%), Postives = 288/501 (57.49%), Query Frame = 3
Query: 2331 SPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            S +T LD+ER+K     LE M  +A+ +     +  +  +L+ C+  ++KL  L   PQ+ +PDIFIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q ++++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:   95 SSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLP-------------------------------------PINGPVDVDRGP--------IMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 542          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 155.992 bits (393), Expect = 1.753e-37
Identity = 107/352 (30.40%), Postives = 159/352 (45.17%), Query Frame = 3
Query: 5625 LVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNK--------------------------------------------------DGSVSTISIFKNKRYRGWWPFTGE-------------NED---DPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKW 6482
            LVPEH+E+RPLF+ +    Q+G L M++D+FP E GA P P +IAPR+PI+Y+LR+ + +    I         E  SD++VK ++ G+      TD H+R L G G FNWRF+ NFDY   E K+V   K+  F     E+  P  L +++WD +    D  LG +EL L     G  SP   G++   K                                                  +G   T++IF+++   GWWP   E             N+D   DPK   + G ++ +  LL+K+E +  P G  R+EPN  P   +PD    ++ N     +   C K+ W
Sbjct: 1524 LVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPI-LVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKW--IMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK--SWANSWLVSRIKPCIKYFW 1867          

HSP 2 Score: 110.538 bits (275), Expect = 1.101e-23
Identity = 72/245 (29.39%), Postives = 116/245 (47.35%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNK------VTVAEVAFY 5519
            +E  +++  PLE++  +  F+ F+ TFP  K  + D ++  +    G  K  L I K+   +           +   +    P + LVR+Y+I AN L      G+ D Y+ L  G + +N K+NY  +  +PIFG+  ++ V  P E +L I VM    +  D  IG T IDLENR  +K +A  GL   F   G  +WRD   P  +L   C +     PK E+   +      +T+ ++ F+
Sbjct: 1178 MEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKGKPPAA-------INTVVDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTERGEEKGITIEKITFW 1415          

HSP 3 Score: 85.8853 bits (211), Expect = 3.955e-16
Identity = 119/575 (20.70%), Postives = 222/575 (38.61%), Query Frame = 3
Query:  990 IGEFRMDVRTVYNAPDHMFLHKWAML-------VDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANL-LLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKK-------NTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMR--VKAKTMYQDCTKANLAIRLKECRAIIKKLN-ELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKP 2660
            +GEF   +  V ++PD   + KW  L        +P DI     G++KV L++    E              D+  E I +   L+  T+K           ++++  E L R         +M      K     +V V    H   T ++        N  + ++ +EI     +PT+ + I  S++D       CI    + +  I   G+TG+LPTFGP+++N++   R   +    R   ++     +G  + GRL IAI  V   E          +S    ++  C   E +    +    ++I+ +      P+   +S+G+ G    S +NE                    C+S+T P  P+ +  +YF + +   +P   + +  E  + R  + N+L K+ N     +  +  +              AL+   + I+S+   +  +  VS    LD+  +   K  + K+R   + +    D +   +  +L      I+ +  EL  + Q  +P + I ++   K + FA+IP  EI  S    + G        + +Q P
Sbjct:   48 VGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDES-------PPTLIDDDGKEQIWSGAHLIDYTLK-----------IRVFSVEQLIR---------QMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPGETGYLPTFGPAFLNVFDCERVTRFSIFSR---KMRGSQQDGSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFA--SDPVCIMMSIGSFG----STSNEFRS-----------------CNSSTLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSSNA-LDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWP 568          

HSP 4 Score: 75.8702 bits (185), Expect = 3.726e-13
Identity = 36/110 (32.73%), Postives = 62/110 (56.36%), Query Frame = 3
Query: 3474 VPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPL-KYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV 3800
            +P E RP    + V+FL WGVR +++ +L++V +P + +  G        +   +  PNF  P+  + +++LP  L   PPL+I   D R F R  L+G+ ++S++ KYV
Sbjct:  999 IPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYV 1108          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 155.992 bits (393), Expect = 1.753e-37
Identity = 107/352 (30.40%), Postives = 159/352 (45.17%), Query Frame = 3
Query: 5625 LVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNK--------------------------------------------------DGSVSTISIFKNKRYRGWWPFTGE-------------NED---DPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKW 6482
            LVPEH+E+RPLF+ +    Q+G L M++D+FP E GA P P +IAPR+PI+Y+LR+ + +    I         E  SD++VK ++ G+      TD H+R L G G FNWRF+ NFDY   E K+V   K+  F     E+  P  L +++WD +    D  LG +EL L     G  SP   G++   K                                                  +G   T++IF+++   GWWP   E             N+D   DPK   + G ++ +  LL+K+E +  P G  R+EPN  P   +PD    ++ N     +   C K+ W
Sbjct: 1524 LVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPI-LVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKW--IMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK--SWANSWLVSRIKPCIKYFW 1867          

HSP 2 Score: 110.538 bits (275), Expect = 1.101e-23
Identity = 72/245 (29.39%), Postives = 116/245 (47.35%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNK------VTVAEVAFY 5519
            +E  +++  PLE++  +  F+ F+ TFP  K  + D ++  +    G  K  L I K+   +           +   +    P + LVR+Y+I AN L      G+ D Y+ L  G + +N K+NY  +  +PIFG+  ++ V  P E +L I VM    +  D  IG T IDLENR  +K +A  GL   F   G  +WRD   P  +L   C +     PK E+   +      +T+ ++ F+
Sbjct: 1178 MEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKGKPPAA-------INTVVDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTERGEEKGITIEKITFW 1415          

HSP 3 Score: 85.8853 bits (211), Expect = 3.955e-16
Identity = 119/575 (20.70%), Postives = 222/575 (38.61%), Query Frame = 3
Query:  990 IGEFRMDVRTVYNAPDHMFLHKWAML-------VDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANL-LLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKK-------NTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMR--VKAKTMYQDCTKANLAIRLKECRAIIKKLN-ELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKP 2660
            +GEF   +  V ++PD   + KW  L        +P DI     G++KV L++    E              D+  E I +   L+  T+K           ++++  E L R         +M      K     +V V    H   T ++        N  + ++ +EI     +PT+ + I  S++D       CI    + +  I   G+TG+LPTFGP+++N++   R   +    R   ++     +G  + GRL IAI  V   E          +S    ++  C   E +    +    ++I+ +      P+   +S+G+ G    S +NE                    C+S+T P  P+ +  +YF + +   +P   + +  E  + R  + N+L K+ N     +  +  +              AL+   + I+S+   +  +  VS    LD+  +   K  + K+R   + +    D +   +  +L      I+ +  EL  + Q  +P + I ++   K + FA+IP  EI  S    + G        + +Q P
Sbjct:   48 VGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDES-------PPTLIDDDGKEQIWSGAHLIDYTLK-----------IRVFSVEQLIR---------QMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPGETGYLPTFGPAFLNVFDCERVTRFSIFSR---KMRGSQQDGSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFA--SDPVCIMMSIGSFG----STSNEFRS-----------------CNSSTLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSSNA-LDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWP 568          

HSP 4 Score: 75.8702 bits (185), Expect = 3.726e-13
Identity = 36/110 (32.73%), Postives = 62/110 (56.36%), Query Frame = 3
Query: 3474 VPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPL-KYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV 3800
            +P E RP    + V+FL WGVR +++ +L++V +P + +  G        +   +  PNF  P+  + +++LP  L   PPL+I   D R F R  L+G+ ++S++ KYV
Sbjct:  999 IPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYV 1108          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 155.992 bits (393), Expect = 2.152e-37
Identity = 107/352 (30.40%), Postives = 159/352 (45.17%), Query Frame = 3
Query: 5625 LVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNK--------------------------------------------------DGSVSTISIFKNKRYRGWWPFTGE-------------NED---DPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKW 6482
            LVPEH+E+RPLF+ +    Q+G L M++D+FP E GA P P +IAPR+PI+Y+LR+ + +    I         E  SD++VK ++ G+      TD H+R L G G FNWRF+ NFDY   E K+V   K+  F     E+  P  L +++WD +    D  LG +EL L     G  SP   G++   K                                                  +G   T++IF+++   GWWP   E             N+D   DPK   + G ++ +  LL+K+E +  P G  R+EPN  P   +PD    ++ N     +   C K+ W
Sbjct: 1651 LVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPI-LVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKW--IMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK--SWANSWLVSRIKPCIKYFW 1994          

HSP 2 Score: 110.923 bits (276), Expect = 9.999e-24
Identity = 72/245 (29.39%), Postives = 116/245 (47.35%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNK------VTVAEVAFY 5519
            +E  +++  PLE++  +  F+ F+ TFP  K  + D ++  +    G  K  L I K+   +           +   +    P + LVR+Y+I AN L      G+ D Y+ L  G + +N K+NY  +  +PIFG+  ++ V  P E +L I VM    +  D  IG T IDLENR  +K +A  GL   F   G  +WRD   P  +L   C +     PK E+   +      +T+ ++ F+
Sbjct: 1305 MEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKGKPPAA-------INTVVDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTERGEEKGITIEKITFW 1542          

HSP 3 Score: 85.8853 bits (211), Expect = 4.187e-16
Identity = 119/575 (20.70%), Postives = 222/575 (38.61%), Query Frame = 3
Query:  990 IGEFRMDVRTVYNAPDHMFLHKWAML-------VDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANL-LLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKK-------NTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMR--VKAKTMYQDCTKANLAIRLKECRAIIKKLN-ELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKP 2660
            +GEF   +  V ++PD   + KW  L        +P DI     G++KV L++    E              D+  E I +   L+  T+K           ++++  E L R         +M      K     +V V    H   T ++        N  + ++ +EI     +PT+ + I  S++D       CI    + +  I   G+TG+LPTFGP+++N++   R   +    R   ++     +G  + GRL IAI  V   E          +S    ++  C   E +    +    ++I+ +      P+   +S+G+ G    S +NE                    C+S+T P  P+ +  +YF + +   +P   + +  E  + R  + N+L K+ N     +  +  +              AL+   + I+S+   +  +  VS    LD+  +   K  + K+R   + +    D +   +  +L      I+ +  EL  + Q  +P + I ++   K + FA+IP  EI  S    + G        + +Q P
Sbjct:  175 VGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDES-------PPTLIDDDGKEQIWSGAHLIDYTLK-----------IRVFSVEQLIR---------QMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPGETGYLPTFGPAFLNVFDCERVTRFSIFSR---KMRGSQQDGSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFA--SDPVCIMMSIGSFG----STSNEFRS-----------------CNSSTLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSSNA-LDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWP 695          

HSP 4 Score: 76.2554 bits (186), Expect = 3.216e-13
Identity = 36/110 (32.73%), Postives = 62/110 (56.36%), Query Frame = 3
Query: 3474 VPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPL-KYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV 3800
            +P E RP    + V+FL WGVR +++ +L++V +P + +  G        +   +  PNF  P+  + +++LP  L   PPL+I   D R F R  L+G+ ++S++ KYV
Sbjct: 1126 IPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYV 1235          
BLAST of Otoferlin vs. Ensembl Celegans
Match: ferl-1 (FER-1 Like [Source:UniProtKB/TrEMBL;Acc:O01596])

HSP 1 Score: 78.5666 bits (192), Expect = 5.189e-14
Identity = 115/568 (20.25%), Postives = 211/568 (37.15%), Query Frame = 3
Query:  990 IGEFRMDVRTVYNAPDHMFLHKWAML-------VDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWN-EEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMR--VKAKTMYQDCTKANLAIRLKECRAIIKKLN-ELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKP 2660
            +GEF   +  V  +PD   + KW  L        +P DI     G++KV L++    E                           P  I  G K Q+    ++++  E L R         KM      K     +V V    H  +T ++      + N   I+F             S++D       CI    + +  I   G  G+LPTFGP+++N++   R   +    R   ++     +G  + GRL IAI  V   E          YS    ++  C   + +    +    + ID +      P+   +S+G+ G    S +NE+++                 C+S+T P  P+ ++ E    ++   +P   + +  E    R  + N+L K+ N   + +  +  +              +L+   + IES+   ++ + HV+    LD+  +   K  + K+R   + +    D +   +  +L      I+ +  EL  + Q  +P + I ++   K + FA+IP  EI  S    + G        + +Q P
Sbjct:  175 VGEFSCYLSEVIRSPDRSLIAKWVALGFPGMSDEEPDDIAYENCGFLKVTLSVYRIDESP-------------------------PTLIDDGGKEQIWS-GIRVFSVEQLIR---------KMINERKIKKKQRFYVMVQCGAHKTKTTMESAFLDEDANIASIIF-------------SLFDKKGRGKTCIGKATLPMKMIYEPGVAGYLPTFGPAFLNVFDCERVSRFSIFSR---KMRGSQLDGSRFVGRLFIAIDCVEYMEKANAQIMHLDYSQIMEAESICKNLKWYNCFCSMSLVNKIDPQFA--SDPVCIMMSIGSFG----STSNEDKK-----------------CNSSTVPTYPERDEHECCSFAWGNLRPVAEVNAPWEVIDRRIEMSNVLMKMTNMLDSMISEIRHISSGAVDQIASVGIESLECLEQQIESASKFLRRINHVNSNA-LDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLQIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWP 667          
BLAST of Otoferlin vs. Ensembl Celegans
Match: snt-5 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700])

HSP 1 Score: 58.151 bits (139), Expect = 4.767e-8
Identity = 32/84 (38.10%), Postives = 48/84 (57.14%), Query Frame = 3
Query: 5070 IYVIRANDLHPADPNGKSDPYLLLRL---GNKVINEKENYIPKQLNPIFGKCFELDVKFPQ--ESNLLIQVMDWDLVSGDDIIG 5306
            I V +A +L P D  G SDPY+ +     G +  ++K +     LNP+F +    D+   Q  E+N+LIQVMDWD +  DD++G
Sbjct:  286 INVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNILIQVMDWDRIGKDDLLG 369          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273291)

HSP 1 Score: 298.516 bits (763), Expect = 1.772e-86
Identity = 168/476 (35.29%), Postives = 264/476 (55.46%), Query Frame = 3
Query: 5046 DPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDV--NGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLI 6464
            + V++LVR+YV++   + P D  G SD Y+ L LG K  +++ ++ P   NP+FG+ FE++   P +  L + V D D +  D++IG+T IDLE+R+ ++H+A  GL   +   GYN W D++LP+ +L  LC++ G   P Y    N + V  + F  +  I +D    ++  E L+L V+KN  K+P+ G  LVPEH+ETR L   + P ++QG L++WI++F   +  P  PIDI P  P  +E+RV++ N   +   D  +  G+  SD++V GW +      Q TD+HYRS +G+  FNWR +F   Y   ED +V  I+     ++E E K P  +YLQVWD D++T D++L  LEL LS +     + Q C  +   +      I++FK K   GW+P         +      NGK+    ++ +  E    P G G++ P AL  P RPDSSF    +P KS ++++
Sbjct:  151 ETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYG--NVIEVDGMLFGDETLISKD----EELQERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPS-PIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMV--IRRKAGLLEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR----KRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 610          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273287)

HSP 1 Score: 299.286 bits (765), Expect = 5.938e-82
Identity = 168/476 (35.29%), Postives = 264/476 (55.46%), Query Frame = 3
Query: 5046 DPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDV--NGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLI 6464
            + V++LVR+YV++   + P D  G SD Y+ L LG K  +++ ++ P   NP+FG+ FE++   P +  L + V D D +  D++IG+T IDLE+R+ ++H+A  GL   +   GYN W D++LP+ +L  LC++ G   P Y    N + V  + F  +  I +D    ++  E L+L V+KN  K+P+ G  LVPEH+ETR L   + P ++QG L++WI++F   +  P  PIDI P  P  +E+RV++ N   +   D  +  G+  SD++V GW +      Q TD+HYRS +G+  FNWR +F   Y   ED +V  I+     ++E E K P  +YLQVWD D++T D++L  LEL LS +     + Q C  +   +      I++FK K   GW+P         +      NGK+    ++ +  E    P G G++ P AL  P RPDSSF    +P KS ++++
Sbjct:  854 ETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYG--NVIEVDGMLFGDETLISKD----EELQERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPS-PIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMV--IRRKAGLLEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR----KRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1313          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273290)

HSP 1 Score: 298.901 bits (764), Expect = 1.224e-81
Identity = 168/476 (35.29%), Postives = 264/476 (55.46%), Query Frame = 3
Query: 5046 DPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDV--NGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLI 6464
            + V++LVR+YV++   + P D  G SD Y+ L LG K  +++ ++ P   NP+FG+ FE++   P +  L + V D D +  D++IG+T IDLE+R+ ++H+A  GL   +   GYN W D++LP+ +L  LC++ G   P Y    N + V  + F  +  I +D    ++  E L+L V+KN  K+P+ G  LVPEH+ETR L   + P ++QG L++WI++F   +  P  PIDI P  P  +E+RV++ N   +   D  +  G+  SD++V GW +      Q TD+HYRS +G+  FNWR +F   Y   ED +V + K     ++E E K P  +YLQVWD D++T D++L  LEL LS +     + Q C  +   +      I++FK K   GW+P         +      NGK+    ++ +  E    P G G++ P AL  P RPDSSF    +P KS ++++
Sbjct:  942 ETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYG--NVIEVDGMLFGDETLISKD----EELQERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPS-PIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAG--LLEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR----KRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1401          

HSP 2 Score: 59.3066 bits (142), Expect = 4.988e-8
Identity = 33/107 (30.84%), Postives = 56/107 (52.34%), Query Frame = 3
Query: 1371 PFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYG--TPRNYTYDQMMRPKEEL 1685
            PF++  F    G+T V KNT TP WN EI F  M+P++  R  + ++  + +  +C+A   + L +I   G     P+ GP++++LY    P  Y    +M  + E+
Sbjct:    3 PFLKYRFHPFKGKTPVVKNTTTPVWNYEINFAWMYPSVAQRFLILIFAHEHLQWKCVAEFELCLEEIAFNGT----PSLGPTYLHLYDPVNPMIYVGRLLMELRSEM 105          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273289)

HSP 1 Score: 298.516 bits (763), Expect = 3.560e-81
Identity = 168/476 (35.29%), Postives = 264/476 (55.46%), Query Frame = 3
Query: 5046 DPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDV--NGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLI 6464
            + V++LVR+YV++   + P D  G SD Y+ L LG K  +++ ++ P   NP+FG+ FE++   P +  L + V D D +  D++IG+T IDLE+R+ ++H+A  GL   +   GYN W D++LP+ +L  LC++ G   P Y    N + V  + F  +  I +D    ++  E L+L V+KN  K+P+ G  LVPEH+ETR L   + P ++QG L++WI++F   +  P  PIDI P  P  +E+RV++ N   +   D  +  G+  SD++V GW +      Q TD+HYRS +G+  FNWR +F   Y   ED +V  I+     ++E E K P  +YLQVWD D++T D++L  LEL LS +     + Q C  +   +      I++FK K   GW+P         +      NGK+    ++ +  E    P G G++ P AL  P RPDSSF    +P KS ++++
Sbjct: 1150 ETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYG--NVIEVDGMLFGDETLISKD----EELQERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPS-PIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMV--IRRKAGLLEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR----KRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1609          

HSP 2 Score: 108.997 bits (271), Expect = 4.446e-23
Identity = 88/333 (26.43%), Postives = 151/333 (45.35%), Query Frame = 3
Query:  732 EDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDP---KDILSGA---KGYVKVDLTIMGKGEQVXXX-------XXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYG--TPRNYTYDQMMRPKEEL 1685
            +++ I ITV +A Q+        + + + + TK+T+   +T +P++N+Y  FEFH +  EL    I        +M   +     ++GE  +D+ +V+N  +H +  KW  L  P      L  A    GY+++DL I+ +   V +         ++  K   D+D +DIE NLL    I   +        V  Y+   + + N                      +QVSFAG  G+T V KNT TP WN EI F  M+P++  R  + ++  + +  +C+A   + L +I   G     P+ GP++++LY    P  Y    +M  + E+
Sbjct:   13 QEFLICITVHKAAQVGVTTGELYVRISLDKMTKSTKSFPNTENPFFNEYFVFEFHCTLTELLRLTILFEL--KKHMTYKK---NVVVGELLVDLHSVWNQSNHGYFKKWGRLEAPIGENQTLENAVAPHGYLQLDLAIVSQHSPVSYALGSEEQDTQNLNKWTVDHDFDDIEKNLLTNVNIFAPSN---IRYFVAFYRGYFIKQSNY--------------------MIQVSFAGFNGKTPVVKNTTTPVWNYEINFAWMYPSVAQRFLILIFAHEHLQWKCVAEFELCLEEIAFNGT----PSLGPTYLHLYDPVNPMIYVGRLLMELRSEM 313          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273285)

HSP 1 Score: 280.026 bits (715), Expect = 5.473e-77
Identity = 159/455 (34.95%), Postives = 250/455 (54.95%), Query Frame = 3
Query: 5046 DPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDV--NGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSP 6401
            + V++LVR+YV++   + P D  G SD Y+ L LG K  +++ ++ P   NP+FG+ FE++   P +  L + V D D +  D++IG+T IDLE+R+ ++H+A  GL   +   GYN W D++LP+ +L  LC++ G   P Y    N + V  + F  +  I +D    ++  E L+L V+KN  K+P+ G  LVPEH+ETR L   + P ++QG L++WI++F   +  P  PIDI P  P  +E+RV++ N   +   D  +  G+  SD++V GW +      Q TD+HYRS +G+  FNWR +F   Y   ED +V  I+     ++E E K P  +YLQVWD D++T D++L  LEL LS +     + Q C  +   +      I++FK K   GW+P         +      NGK+    ++ +  E    P G G++ P AL  P
Sbjct:  607 ETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYG--NVIEVDGMLFGDETLISKD----EELQERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPS-PIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMV--IRRKAGLLEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYPKKR----KRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMALEPP 1045          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 490/1320 (37.12%), Postives = 747/1320 (56.59%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEF---------------ENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQT----------DNESIESGEDDE---------------SFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVYSVPP--ISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEA-------------------------NEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-SNDCFKF----RRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV 3800
            MALV++LK V  L  + DRI K+ FR     ++V+   +D   F + F+WP+G ++D  + LE++++ YSK   N+LIG+  + LQK++E+  +   + LID N++ I+ T+S E+ Y + D  +  W   EF               ++ ++ R  S         HG+ + ++       G       G+T          D+ +I   ED +               S A+  A T  V        + + P+  +  D+QIS+TVIEARQL G N++P++ V IGE+ K T ++ STN PYYN+Y  F+FH+    +FD++I++  +   N+    L  G L+G F++DV TVY  P+H F HKWAML DP DI +G KGYVK D+ ++GKG+ +K   K++     + D++DIE NLLLP+ + +  +RQ A   VKIY+AE LP+MNT IMA +K A  G+++ LVDP+V V FAG  G+T V+K++Y P WNE+++FTEMFP LC R++V + D D V +  I TH+IDL ++ N+GD GFLPT GP+WVN+YG+ RNYT   +M   ++LN GLGEGV++R RLLI+I   +L + S  + +  +V+  P   IS+   GK E F L G+F EA++ID +IG K  PI FE+++G  GN++D  +                         + EEE E    + G+   +P     +T PM P   D+ YFHL + EKKPC+Y+ S+ +D + R +  NI++K+ ++    +  + E+   E+     R++  L+    +    +      +++S +T LD+ER+K     +E M  +AKT+     +  +  +LK     +++L  L   PQ+ +PD+FIW+I + KR+A+ARIP+++ILYS + EE G    +V  VFL+ PG+ G GP+GWT+Q +L+MYLWLGL +  K F  GLP G+  N   K       PP+ ++Y  K  FQLRAHM+ AR+L  +D SGLSD FAR+  + H   T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK+EF+GR F KP   + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P    R A                               L  ++G  + D  P            ++PVP  IRP L  YR+E LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR IL+G+H ++ + K++
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKYQTMDGSVKVWSDGEFLDIPDDLDGTFQFETDSLLSGRSQSSGTSPGRSIHGIPTFRKA----GKGVFSAMKLGKTRTSKDDHKKGDDAAILDAEDLDRKAMRLGGILDPDTISLASVTAVTTNVSNKRSKPDIKMEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKNL----LRSGTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKAS-----EADEDDIEGNLLLPEGVPS--ERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDKGFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGDK--PISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAE----DDGDLTSVP-----STPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERRLRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFLRLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTV--------GKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGP--AGRAA-------------------------------LPPIDGPTDSDRGP------------ILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTLRKFI 1238          

HSP 2 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 326/599 (54.42%), Postives = 431/599 (71.95%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS---DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            ++   VY   LE   EF  F  ++ TF L +G+  DD++ +   ++RIVG FKG+L +YK+   E           + +++S+P+NDP+ +LVRIY+IRA DLHPAD NGK+DPY++++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENRYYSKH+A CG+   +  HGYN WRD Q P  +LAKLCKE   D P Y     +V VA   F    EIE+++G KKQ+ E LAL V+++W ++P  GC L+PEH+ETRPL N +KPGI+QG +EMW+DMFP ++ AP   IDI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L+K PRGAK+ + C L  + K+  + TISIFK KR +GWWPF  +NE+D  E ++ GK++AE  LL+ EE E  PVGLGRN+P  L  PNRPD++FL F++PLK+++YLICN++KW +IK ++   LL ++ LF+Y+ PGYL K++LGA
Sbjct: 1399 VDELMVYNKELES--EFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDPNMGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHY-GPGGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFVAQNEND--EFELTGKVEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTTFLWFLSPLKAIRYLICNRYKWLIIKIVLALLLLIMVGLFLYSMPGYLVKKLLGA 1992          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 490/1320 (37.12%), Postives = 747/1320 (56.59%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEF---------------ENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQT----------DNESIESGEDDE---------------SFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVYSVPP--ISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEA-------------------------NEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-SNDCFKF----RRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV 3800
            MALV++LK V  L  + DRI K+ FR     ++V+   +D   F + F+WP+G ++D  + LE++++ YSK   N+LIG+  + LQK++E+  +   + LID N++ I+ T+S E+ Y + D  +  W   EF               ++ ++ R  S         HG+ + ++       G       G+T          D+ +I   ED +               S A+  A T  V        + + P+  +  D+QIS+TVIEARQL G N++P++ V IGE+ K T ++ STN PYYN+Y  F+FH+    +FD++I++  +   N+    L  G L+G F++DV TVY  P+H F HKWAML DP DI +G KGYVK D+ ++GKG+ +K   K++     + D++DIE NLLLP+ + +  +RQ A   VKIY+AE LP+MNT IMA +K A  G+++ LVDP+V V FAG  G+T V+K++Y P WNE+++FTEMFP LC R++V + D D V +  I TH+IDL ++ N+GD GFLPT GP+WVN+YG+ RNYT   +M   ++LN GLGEGV++R RLLI+I   +L + S  + +  +V+  P   IS+   GK E F L G+F EA++ID +IG K  PI FE+++G  GN++D  +                         + EEE E    + G+   +P     +T PM P   D+ YFHL + EKKPC+Y+ S+ +D + R +  NI++K+ ++    +  + E+   E+     R++  L+    +    +      +++S +T LD+ER+K     +E M  +AKT+     +  +  +LK     +++L  L   PQ+ +PD+FIW+I + KR+A+ARIP+++ILYS + EE G    +V  VFL+ PG+ G GP+GWT+Q +L+MYLWLGL +  K F  GLP G+  N   K       PP+ ++Y  K  FQLRAHM+ AR+L  +D SGLSD FAR+  + H   T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK+EF+GR F KP   + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P    R A                               L  ++G  + D  P            ++PVP  IRP L  YR+E LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR IL+G+H ++ + K++
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKYQTMDGSVKVWSDGEFLDIPDDLDGTFQFETDSLLSGRSQSSGTSPGRSIHGIPTFRKA----GKGVFSAMKLGKTRTSKDDHKKGDDAAILDAEDLDRKAMRLGGILDPDTISLASVTAVTTNVSNKRSKPDIKMEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKNL----LRSGTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKAS-----EADEDDIEGNLLLPEGVPS--ERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDKGFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGDK--PISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAE----DDGDLTSVP-----STPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERRLRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFLRLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTV--------GKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGP--AGRAA-------------------------------LPPIDGPTDSDRGP------------ILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTLRKFI 1238          

HSP 2 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 325/599 (54.26%), Postives = 428/599 (71.45%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS---DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            ++   VY   LE   EF  F  ++ TF L +G+  DD++ +   ++RIVG FKG+L +YK+   E           + +++S+P+NDP+ +LVRIY+IRA DLHPAD NGK+DPY++++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENRYYSKH+A CG+   +  HGYN WRD Q P  +LAKLCKE   D P Y     +V VA   F    EIE+++G KKQ+ E LAL V+++W ++P  GC L+PEH+ETRPL N +KPGI+QG +EMW+DMFP ++ AP   IDI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L+K PRGAK+ + C L  + K+  + TISIFK KR +GWWPF  +NE+D  E ++ GK++AE  LL+ EE E  PVGLGRN+P  L  PNRPD+S + FMNPL+S++Y I + ++W ++KAL +  LL L+ LF+Y+ PGYL K++LGA
Sbjct: 1399 VDELMVYNKELE--SEFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDPNMGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHY-GPGGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFVAQNEND--EFELTGKVEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTSLMWFMNPLRSIRYFIWHNYRWLILKALALLLLLLLVGLFLYSIPGYLVKKLLGA 1992          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 431/1104 (39.04%), Postives = 649/1104 (58.79%), Query Frame = 3
Query:  654 DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEA----------NEEEEKEV------PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-SNDCFKF----RRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSS 3860
            D  S A+  A T  V        + + P+  +  D+Q+S+TVIEARQL G N++P++ V IG+  K T ++ STN PYYN+Y  F+FH+    +FD+++++  +   N+    L  G L+G F++DV T+Y  PDH F HKWA L DP+DI +G KGYVK D+ ++ KG+ +K   K+      +ND++DIE+NLLLP+ +    +RQ A   +KIY+AE LP+MNT IMA +K A  G++K LVDP+VQV FAG  G+T ++K++Y P WNE+IVFTE FP LC R+++ + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ R+YT   +M   ++LN GLGEGV++R RLLI++   +L + S  + +  +V    +P ISD   GK E F L G+F EA++ID +IG K  PI FE+++G  G+ LD+             ++EE E+        V+ G          STT PM P   D+ YFHL + E+KPC+Y+ S+ +D + R +  N+L+K+ ++    +  + E+   E+     R++  L+    +  + ++     ++ + +T LDKER+KL    +E M  +AKTM     K+N+  R+K  +  + KL  L   PQ+ +PDI+IW+I + KR+A+AR+P+++ILYS++ EE G    +V T+F + PG+   GP+GWT+Q + ++YLWLGL R  K +  GLP G+  N   K       PP+ ++YT K  FQLR HM+ AR+L  +D +GLSD FARI  + H   T+V+ ETL P WDQ L+ DH+  Y     +  +PP++V+E++D+D +        GK++F+GR F KP   + +E Y  PR    L +++IYRG   AGE+LAAFEL+Q+ P                                                D+ P +G T    G  ++PVP  IRP L  YR+E LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H ++ + K++ +       PA K + N S+
Sbjct:   33 DTISLASVTAVTTNVSNKRSKPDIKIEPSAGRPMDFQVSVTVIEARQLVGLNMDPVVCVEIGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNL----LRSGTLVGSFKLDVGTIYTQPDHQFFHKWATLCDPEDITAGLKGYVKCDIAVVAKGDTIKTPHKAN-----ENDEDDIESNLLLPEDVPA--ERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGENKDLVDPYVQVLFAGQKGKTSIQKSSYEPIWNEQIVFTEQFPPLCRRMKLQIRDSDKVNDVAIGTHFIDLRKIANDGDKGFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLISLAVEILDTSSPEVMSSTEVQVEGIPNISDNATGKVEEFFLFGSFLEATMIDRKIGDK--PINFEVTIGNYGSELDTPTKPKSKKKKGDGDDEESELIHGSSDEEVDDGGDVT----SVSTTPPMKPVITDRNYFHLPYFERKPCIYIYSWWQDQRRRLYNANVLDKMADKLEEGLNDVQEIIKTEKAYPERRLRGVLEELSNSCSTFVSLANNDQNQAGRTKLDKERVKLCMQEVESMGQQAKTMRSQVKKSNVKDRIKLAQNFLHKLRFLSDEPQHSVPDIYIWMISNNKRIAYARVPSKDILYSSVEEECGKDCGKVQTIFFKLPGKKSFGPAGWTVQAKTELYLWLGLNRQRKDYLCGLPNGFEENKAVKGPGVQSSPPISLMYTMKQIFQLRVHMYQARSLFAADSTGLSDPFARIFFSTHSQVTEVLNETLCPTWDQLLVFDHVELYGEAGELRDDPPIIVIEIYDQDTV--------GKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQIYRGNCTAGEMLAAFELLQIGPGG--------------------------------------------KADLPPIDGPTDIDRGP-ILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTTLRKFIYR-------PADKSVNNWSA 1056          

HSP 2 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 314/600 (52.33%), Postives = 433/600 (72.17%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEE-----SSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLM-LYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            IE FKVY   LE   E+  F  ++ TF L +G+  DD +     + ++R++G FKG+L IYKV  ++   ++     M +++++P+NDP+ +LVRIYV+RA DLHPAD NGK+DPY+ ++LG   I +KENYI KQLNP+FGK F+++   P +S L + + DWDLV  DD+IGETKIDLENR+YSKH+A CG+   +  HGYN WRD   P+ +LAKLCK+   D P+Y     +V V    +    E+E++NG KKQ++E LAL V+ +W  +P  GC LVPEHMETRPL N +KPGI+QG +EMW+DMFPK++ AP   +DI+PR+P  +ELRVI+WNT++V+L D  + TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRFI+ FDY++AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L++ PRGAK+ + C +  +  +  +  ++IFK KR +GWWPF   +E+D  EL++ GK++AE QLL+ EE E  PVG GRNEP  L  PNRPD++FL FM PLK++++L+CN++KW +IK ++   LLA+L LF+Y+ PGY+ K++LGA
Sbjct: 1179 IEEFKVYNRELE--YEYNQFEDWLHTFNLHRGKCSDDADVDQNAADEDRLIGKFKGSLCIYKVSSDDMSRDMGFDSNMGMFQNIPHNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKSEIKDKENYISKQLNPVFGKSFDVEATLPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGISSTYAIHGYNVWRDPLKPSHILAKLCKDGKIDAPQY-GPGGRVKVTNRVYTGPTEVEDENGLKKQTDEHLALAVLNHWEDIPRIGCKLVPEHMETRPLLNPDKPGIEQGRIEMWVDMFPKDMSAPGPALDISPRKPKKFELRVIVWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLQAEEKIVISKKESMFSWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMVTNENEMPMVNIFKQKRIKGWWPFVARDEND--ELEITGKVEAELQLLTGEEAEKSPVGEGRNEPEPLEKPNRPDTAFLWFMMPLKAIRHLVCNQYKWLVIKIVVALLLLAMLGLFLYSMPGYMVKKLLGA 1773          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: fer1l4 (fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-815])

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 420/1329 (31.60%), Postives = 670/1329 (50.41%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADW-RQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIG----EFNYGQTDNESIESGEDDESFAATNARTLGV------PLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIK-------TVLRSESGGL--------------------------------PAG-----------------AKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTG---------NRLDSEANEEEEKE--VPSVNQGNR--PKIPKWCHSTTEPMLPDTN--DQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLN-SIKCVRHVSPK-TLLDKERIKLTK---VCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY--------SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKY 3797
            M++ + LK + NL  + DR ++++FR F   TK+++ ++   F E F+WP   K++  + L + ++  SK  +N+L+G + ISLQ ++   ++  +E L D+ HS+  + +  E+ Y         W  QD      +D  L   +    +       +   +D +T  IG    +      D +     +DD  FA      L +       L  H         Q+++ VIEA++L G NINP + V +G++ K T  Q STN P+YN+   FEF  ++  LFD+VI +  +    +A         IG F++D+ TVY  PDH F  KWA L DPKD  SG KGYVK  ++++ KG+ +     +      D    DIE NLLLP+  +  ++R  A+  +KIY+AE LP MN+  M      I  D K  +DP+VQV+FAG  G T V  NT  PEWNE+I F E FP L  RI++ + D   + +  +ATH++DL QI N    GF PTFGP+WVNLYG+P+N T   + R   +LN GL +G+ YRGR+L+++        T + +ES  +                                P+G                  +V  V P+ +   G+K+ FLL  +F+E ++ID  IG K  P+ FELS+G  G         ++  S+ N  E+++  + S ++  R  P  P+   S T P  P     D+ +  +    +KPC+++ SY EDH  R    N L K+ +     ++   E+ M  +R      +  +D  +E   S    S    R  +P+   LDK R+ L K   V L K  ++ +   +  T+  +  RL + R I K+L  L   PQ+ LPD+F+W++   +R+A+ARIPA  +L+S + EEKG    ++  V+++ PG    GP G  +  +L++Y+WLG+ +  K     LP  +        S        PP ++   +  YFQLRAH++ AR +I +D++GLSD FA+++ +     T+V+ ETLSP W + L  D ++   SKD    +PPV+++ ++D         N+ G  + LGR F +P +   EE YK P+L ++EI +G+  AGE+LAA ELI++                               S F +  L +         DV P +   +  E +++  +P+ +RP L  YR+E L+WG+R ++RV L  V++P++ +E     + S+ I S K+ PNFS+ +K+ D+ LPE +   PPL I   + R FGR +L+G HV+ N+ ++
Sbjct:    1 MSITVLLKKIFNLPGKYDRKVELSFRGFTHKTKILQCENIAIFNEHFRWPHYGKVERDEVLSISVFNCSKMFSNRLLGKLVISLQHVVSVGQLILREPLTDAQHSLTDMYIELEVKYSPLQGAAGGWDSQDFIREEDSDGLLVIRNTGFTEPSSSDGLRPQQLDRETRMIGRGLLKTEDENGDEDDDNDYDDDYDFADMECANLTLFDGNLKNLLFHSLFSSP---QVNVNVIEAQKLVGVNINPAVYVTVGDEKKHTATQKSTNCPFYNENFMFEFQETQDVLFDKVIEISVVHKKVLAFLM----THIGSFKIDISTVYQQPDHRFYQKWAPLTDPKDTRSGIKGYVKCTVSVVMKGDPMGMASLAPAGSQND----DIEKNLLLPK--RMPSERPWAKFILKIYRAEGLPSMNSGFMG----KIMRDKKVFLDPYVQVTFAGQQGETSVDSNTNAPEWNEQISFIEQFPPLARRIKIQILDDANIGDVAVATHFLDLLQISNPNRNGFNPTFGPAWVNLYGSPQNSTLRDIHR---DLNEGLSDGIFYRGRILLSLSVEVYFSPTAVVTESKAIANVKSTISRLNLKRRSRKSKEKKTGRKEGMQSPSGPAEESEDVGAEVPAAVTVEVEEVHPLPENFTGEKDEFLLFASFFEVTMIDPSIGSK--PVTFELSIGNYGKTAEVVVKSSKSGSQENLAEDRQPLLESDDELERDEPVNPR-DQSITAPRRPQPTEYDRSFSCIPLFREKPCIFVWSYFEDHTFRFHNSNWLSKMADRLEYGID---EVEMLLKRSKIKAKERLVDVVLEFFSSCKQYSSNLERKRNPRQNNLDKCRVGLIKRNIVLLAKQTLRVR---KRVTRNTVKDRLADLRNITKRLRFLAIEPQSTLPDVFLWMLSGGRRVAYARIPAPSVLFSLVEEEKGKDCGKITAVYMKTPG----GPVG-EIFAKLEVYMWLGITKYAKNCVTSLPAEFRPIYEDATSGASIPRNMPPTKLAVEDSRYFQLRAHIYQARGIIAADDNGLSDPFAKVVFSTQCQVTRVMEETLSPTWCELLFYDQVLMEGSKDEYREDPPVVIINIYD--------YNKLGSPQALGRAFARPELKFVEEPYKKPQLQFFEITKGKSKAGEILAALELIEL-----------------------------DYSSFGEPALPV---------DVDPKKPQYMEEECYYI--IPEGVRPVLRKYRIEVLYWGLRGLKRVNLFEVERPQVRMECAGQMIESEEIQSYKLNPNFSDVVKHFDVELPELVYLHPPLTIFVMEQRAFGRLVLVGTHVVQNLVQF 1247          

HSP 2 Score: 470.7 bits (1210), Expect = 9.236e-135
Identity = 257/616 (41.72%), Postives = 373/616 (60.55%), Query Frame = 3
Query: 4800 LIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDN--RIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYE----ALVNKV------TVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKV----PNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPF------------------------------TGENEDDPKELD----------VNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFK 6479
            LI   ++Y   LE   +F  F  ++  FP+ KG+   ++E  D   R +G +KG+  IY +  E+           +   +P N P+++LVR+YV++A +L P DPNGK+DPY+++++G + ++ KE YIPKQLNP+FG+ FEL V FP E+ L + V D DLV  DD+IG+T++DLENR++S+H+A CGL   ++  GYNKWRD + PT +L +LC++ G   P+Y      ++NK+         E     + + EED  E    +E  AL V+  W ++       C LVPEH+E R L N+EKPG+ QG + MWIDMFP ++  PP  ++I PR P SYELRVIIWNT+DV+L D    TGE SSDI+VKGW+KGL  + Q TDVH+ SL+GEGNFNWRF+F+FDY+  E +++YK K+S FA++ETE + P  L LQVWD D + ++DFLG +EL LS + R  K+ + C + ++ KD +    SIF++KR +GWWP                               +  ++  P++L           + GK++AEF L++ EE E  PVG  R EP  L  PNRP +SF  F+NP+K+  + I  K+K
Sbjct: 1354 LIAFLQLYKFELE--NDFSQFMDWLHIFPVYKGKSSLEDEEEDESSRYMGKYKGSFLIYPIAPEDEEA-----DCQITNGIPKNTPIKVLVRVYVVKATNLAPTDPNGKADPYVVVKVGQQQMDSKERYIPKQLNPVFGEVFELTVSFPLETELTLYVFDHDLVGSDDLIGKTRVDLENRFFSRHRAGCGLALHYDKDGYNKWRDAKKPTAILLELCRKNGIPSPEYRESEIKVLNKIFRVPNEAFPEELLKKNKKTEEDYAE---LDEHKALSVLHRWKEMREFCEGACPLVPEHVEVRSLLNAEKPGLPQGYVHMWIDMFPVDVPPPPP-VNIKPRLPESYELRVIIWNTDDVVLDDVNPFTGEPSSDIYVKGWIKGLEDEKQETDVHFNSLTGEGNFNWRFVFHFDYLPTEKEVIYKKKESLFALEETEFRQPAVLVLQVWDYDRIGSNDFLGSIELRLSDMVRAVKTSEQCSV-KMAKDKAGPRFSIFRSKRMKGWWPLIKLKSQEDIEREEREAEQEKKNKKKKKKKSSKRSQMKPEDLQFVDNSGNTFLLMGKVEAEFHLVTPEEAEKNPVGKARKEPEPLDKPNRPKTSFNWFVNPMKTFVFFIWKKYK 1957          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: fer1l4 (fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-815])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 426/1377 (30.94%), Postives = 680/1377 (49.38%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGM----GSD--KRTLIDPQTGEIGE----------------FNYGQTDNESIESGEDDESFAATNARTLGV-PLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIK-------TVLRSESGGL-------------------------------PAG-----------------AKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTG---------NRLDSEANEEEEKE--VPSVNQGNR--PKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILH---------------------------------------ELHMNERRGTHLRMKNALDTFIENIESSLN-SIKCVRHVSPK-TLLDKERIKLTK---VCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY--------SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKY 3797
            M++ + LK + NL  + DR ++++FR F   TK+++ ++   F E F+WP   K++  + L + ++  SK  +N+L+G + ISLQ ++   ++  +E L D+ HS+  + +  E+ Y         W   +F       + SD  ++ I + G      SD  +   +D +T  IG                       D   +E      +   +  R L    LA+ P   K + +Q+++ VIEA++L G NINP + V +G++ K T  Q STN P+YN+   FEF  ++  LFD+VI +  +    +A   L+    IG F++D+ TVY  PDH F  KWA L DPKD  SG KGYVK  ++++ KG+ +     +      D    DIE NLLLP+  +  ++R  A+  +KIY+AE LP MN+  M      I  D K  +DP+VQV+FAG  G T V  NT  PEWNE+I F E FP L  RI++ + D   + +  +ATH++DL QI N    GF PTFGP+WVNLYG+P+N T   + R   +LN GL +G+ YRGR+L+++        T + +ES  +                               P+G                  +V  V P+ +   G+K+ FLL  +F+E ++ID  IG K  P+ FELS+G  G         ++  S+ N  E+++  + S ++  R  P  P+   S T P  P   + +     F E KPC+++ SY EDH  R    N L K+ +  ++ V  +                                        E+ M  +R      +  +D  +E   S    S    R  +P+   LDK R+ L K   V L K  ++ +   +  T+  +  RL + R I K+L  L   PQ+ LPD+F+W++   +R+A+ARIPA  +L+S + EEKG    ++  V+++ PG    GP G  +  +L++Y+WLG+ +  K     LP  +        S        PP ++   +  YFQLRAH++ AR +I +D++GLSD FA+++ +     T+V+ ETLSP W + L  D ++   SKD    +PPV+++ ++D         N+ G  + LGR F +P +   EE YK P+L ++EI +G+  AGE+LAA ELI++                               S F +  L +         DV P +   +  E +++  +P+ +RP L  YR+E L+WG+R ++RV L  V++P++ +E     + S+ I S K+ PNFS+ +K+ D+ LPE +   PPL I   + R FGR +L+G HV+ N+ ++
Sbjct:    1 MSITVLLKKIFNLPGKYDRKVELSFRGFTHKTKILQCENIAIFNEHFRWPHYGKVERDEVLSISVFNCSKMFSNRLLGKLVISLQHVVSVGQLILREPLTDAQHSLTDMYIELEVKYSPLQGAAGGWDSQDF----IREEDSDGSELVIRNTGFTEPSSSDGLRPQQLDRETRMIGRGLLKTEDENGDEDDDNDYDDDYDFADMECANVTFTPILSRCRALAKHELAITP---KVKSFQVNVNVIEAQKLVGVNINPAVYVTVGDEKKHTATQKSTNCPFYNENFMFEFQETQDVLFDKVIEISVVHKKVLAF--LMTH--IGSFKIDISTVYQQPDHRFYQKWAPLTDPKDTRSGIKGYVKCTVSVVMKGDPMGMASLAPAGSQND----DIEKNLLLPK--RMPSERPWAKFILKIYRAEGLPSMNSGFMG----KIMRDKKVFLDPYVQVTFAGQQGETSVDSNTNAPEWNEQISFIEQFPPLARRIKIQILDDANIGDVAVATHFLDLLQISNPNRNGFNPTFGPAWVNLYGSPQNSTLRDIHR---DLNEGLSDGIFYRGRILLSLSVEVYFSPTAVVTESKAIANVKSTISRLNLKRRSRKSKEKKTGRKEVQSPSGPAEESEDVGAEVPAAVTVEVEEVHPLPENFTGEKDEFLLFASFFEVTMIDPSIGSK--PVTFELSIGNYGKTAEVVVKSSKSGSQENLAEDRQPLLESDDELERDEPVNPR-DQSITAPRRPQPTEYDSCIPLFRE-KPCIFVWSYFEDHTFRFHNSNWLSKMADRLASEVRKMSLKTLEELYIILAITSISFLFLEFSKINLCPTFFKEYGIDEVEMLLKRSKIKAKERLVDVVLEFFSSCKQYSSNLERKRNPRQNNLDKCRVGLIKRNIVLLAKQTLRVR---KRVTRNTVKDRLADLRNITKRLRFLAIEPQSTLPDVFLWMLSGGRRVAYARIPAPSVLFSLVEEEKGKDCGKITAVYMKTPG----GPVG-EIFAKLEVYMWLGITKYAKNCVTSLPAEFRPIYEDATSGASIPRNMPPTKLAVEDSRYFQLRAHIYQARGIIAADDNGLSDPFAKVVFSTQCQVTRVMEETLSPTWCELLFYDQVLMEGSKDEYREDPPVVIINIYD--------YNKLGSPQALGRAFARPELKFVEEPYKKPQLQFFEITKGKSKAGEILAALELIEL-----------------------------DYSSFGEPALPV---------DVDPKKPQYMEEECYYI--IPEGVRPVLRKYRIEVLYWGLRGLKRVNLFEVERPQVRMECAGQMIESEEIQSYKLNPNFSDVVKHFDVELPELVYLHPPLTIFVMEQRAFGRLVLVGTHVVQNLVQF 1293          

HSP 2 Score: 469.159 bits (1206), Expect = 4.475e-134
Identity = 252/600 (42.00%), Postives = 366/600 (61.00%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGRQDDDEESSDN--RIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYE----ALVNKV------TVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKV----PNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPF------------------------------TGENEDDPKELD----------VNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFK 6479
            +F  F  ++  FP+ KG+   ++E  D   R +G +KG+  IY +  E+           +   +P N P+++LVR+YV++A +L P DPNGK+DPY+++++G + ++ KE YIPKQLNP+FG+ FEL V FP E+ L + V D DLV  DD+IG+T++DLENR++S+H+A CGL   ++  GYNKWRD + PT +L +LC++ G   P+Y      ++NK+         E     + + EED  E    +E  AL V+  W ++       C LVPEH+E R L N+EKPG+ QG + MWIDMFP ++  PP  ++I PR P SYELRVIIWNT+DV+L D    TGE SSDI+VKGW+KGL  + Q TDVH+ SL+GEGNFNWRF+F+FDY+  E +++YK K+S FA++ETE + P  L LQVWD D + ++DFLG +EL LS + R  K+ + C + ++ KD +    SIF++KR +GWWP                               +  ++  P++L           + GK++AEF L++ EE E  PVG  R EP  L  PNRP +SF  F+NP+K+  + I  K+K
Sbjct: 1443 DFSQFMDWLHIFPVYKGKSSLEDEEEDESSRYMGKYKGSFLIYPIAPEDEEA-----DCQITNGIPKNTPIKVLVRVYVVKATNLAPTDPNGKADPYVVVKVGQQQMDSKERYIPKQLNPVFGEVFELTVSFPLETELTLYVFDHDLVGSDDLIGKTRVDLENRFFSRHRAGCGLALHYDKDGYNKWRDAKKPTAILLELCRKNGIPSPEYRESEIKVLNKIFRVPNEAFPEELLKKNKKTEEDYAE---LDEHKALSVLHRWKEMREFCEGACPLVPEHVEVRSLLNAEKPGLPQGYVHMWIDMFPVDVPPPPP-VNIKPRLPESYELRVIIWNTDDVVLDDVNPFTGEPSSDIYVKGWIKGLEDEKQETDVHFNSLTGEGNFNWRFVFHFDYLPTEKEVIYKKKESLFALEETEFRQPAVLVLQVWDYDRIGSNDFLGSIELRLSDMVRAVKTSEQCSV-KMAKDKAGPRFSIFRSKRMKGWWPLIKLKSQEDIEREEREAEQEKKNKKKKKKKSSKRSQMKPEDLQFVDNSGNTFLLMGKVEAEFHLVTPEEAEKNPVGKARKEPEPLDKPNRPKTSFNWFVNPMKTFVFFIWKKYK 2032          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 794.653 bits (2051), Expect = 0.000e+0
Identity = 461/1255 (36.73%), Postives = 705/1255 (56.18%), Query Frame = 3
Query:  243 PMGRKLDPIDTLELRLYQYSKYL--NNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDI--SIDSHGMGSDKRTLIDPQTGE--IGEFNYGQTDNESIESGEDDE-------------------------SFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLL-PGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLD-------------SEANEEEEKEVPSVNQGNRPKIPKWCHSTTEP-MLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRR-------PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            P   ++ P + L  R   Y  +L    +LIG+  + LQ+++E+ ++   + LID N+S IR +VS EL Y + D  +  W   EF +    +  S A  +      H   S++R  +  + G+        G+T     ES + DE                         S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G++ K T ++ STN PYYN+       +S       V R R + +  +    LL  G L+G F++DV TVY  P+H F HKWA+L DP DI +G KGY+K D+ ++GKG+ +K   K+      + D++DIE NLLLP  +    +RQ A   VKIY+AE LPRMNT IMA +K A+ G++K LVDP+VQV+FAG  G+T V+K++Y P WNE+I+FTEMFP LC R++V + D D V +  I TH+IDL +I NEGD GFLPTFGP+WVN+YG+ RNYT   +M   ++LN GLGEGV++R RLL+++   +L + +  L +  +V      P+++   GK E F L GAF E+++ID +IG K  PI FE+++G  GN++D              +  EEE + + + +     +  +    ++ P M P   D+ YFHL F +KKPC Y+ S+ +D + R +  NI++K+ ++    +  +HE+   E+     R++  L+    +    +      ++ + +T LD+ER+K     LE M  +AKTM     K  +  +LK  +  ++KL  L   PQ+ +PDIFIW++ + KR+A+ARIP+++ILYS + EE G    +V  VFL+ PG+ G GP+GWT+Q ++++Y+WLGL +  + F  GLP G+     K  +       PP+ + YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+  N     T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LL AFEL+Q+ P                        + +S+         L  +EG  + +  P            ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:   28 PSDSRVVPGEPLRTRTGAYCVFLRFGARLIGTFRMVLQQVVEEAQLEVTDTLIDDNNSAIRTSVSIELRYQTMDGSVGAWNDGEFMDGTNLQSESMATPLWPVPTPHRTLSNRRLPLICRVGKGVFSAMKLGKTRPPKDESRKQDEPAVLETEDLDRKAIRLAGGLDPDTISLASVTAVTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVPRDRAVKVSVIHSKNLLRSGTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPDGVPA--ERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDKGFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAETCTGKMEEFFLFGAFLESTMIDRKIGDK--PINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLEEGLNDVHEMIKTEKPYPERRLRGVLEELSSSCFRFVTLANKDQNQNGQTKLDRERLKSCMRELENMGTQAKTMRSQVKKNTVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLKLPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEE--IKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTV--------GKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQIGP------------------------AGKSD---------LPQIEGPTDIERGP------------ILPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1208          

HSP 2 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 317/583 (54.37%), Postives = 420/583 (72.04%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGR--QDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            E++ F  ++ TF L +G+   DDD  S + RIVG FKG++ +YKV   E   +   +     +++ +PNNDP+ +LVR+YV+RA DLHPAD NGK+DPY++++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENRYYSKH+A CG+ + +  HGYN WRD   PT +L+KLCKE   D P Y     +V V    F    EI+++NG+KKQ++E LAL V+++W  +P  GC LVPEH+ETRPL N +KPGI+QG +EMW+DMFP ++ AP   IDI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L++ PRGAK+ + C +     D  +  +SIFK KR +GWWPF   NE+D  E+++ GK++AE  LLS EE E  P GLGRNEP+ L  PNRPD+SF+ F+NPLKS++Y I + ++W ++K LI+  LL ++ LF+Y+ PGYL K++LGA
Sbjct: 1341 EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYDPNFGMFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHY-GPGGRVKVTNRVFTGPTEIDDENGQKKQTDEHLALSVLQHWEDIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMAEPDVDLPMVSIFKQKRVKGWWPFVARNEND--EMELTGKVEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPDTSFIWFLNPLKSIRYFIWHTYRWLILKILILILLLLMVGLFLYSLPGYLVKKILGA 1920          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 415/1069 (38.82%), Postives = 604/1069 (56.50%), Query Frame = 3
Query:  741 QISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDG----------TC-GKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS----------EANEEEEKEVPSVNQGNRPKIPK----WCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSN-----AVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCL---EKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRR-------PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            Q+SITVIEARQL G N++P++ V +G++ K T ++ STN PYYN+       +S       VI  + L         L  G L+G F++DV TVY  P+H F HKWA+L DP DI +G KGY+K D+ ++GKG+ +K   K+      + D++DIE NLLLP  +    +RQ A   VKIY+AE LPRMNT IMA +K A+ G++K LVDP+VQV+FAG  G+T V+K++Y P WNE+I+FTEMFP LC R++V + D D V +  I TH+IDL +I NEGD GFLPTFGP+WVN+YG+ RNYT   +M   ++LN GLGEGV++R RLL+++   +L + +  L +  +V      P+++           TC GK E F L GAF E+++ID +IG K  PI FE+++G  GN++D           E  +  E+E   +   +  +  +       S++  M P   D+ YFHL F +KKPC Y+ S+ +D + R +  NI++K+ ++  N       E+LHE               A + F+      L       H                 C    E M  +AKTM     K  +  +LK  +  ++KL  L   PQ+ +PDIFIW++ + KR+A+ARIP+++ILYS + EE G    +V  VFL+ PG+ G GP+GWT+Q ++++Y+WLGL +  + F  GLP G+     K  +       PP+ + YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+  N     T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LL AFEL+QV                       P G                        D+   EG T    G  ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:   39 QVSITVIEARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVIHSKNL---------LRSGTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPDGVPA--ERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDKGFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAEVRTTLSYHLHLTCTGKMEEFFLFGAFLESTMIDRKIGDK--PINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLVNETGQGEAEVLHE--------------GAGNVFVLEGLGRLTGDGLTNH----------------DCFAQQENMGTQAKTMRSQVKKNTVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLKLPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEE--IKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTV--------GKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQVI---------------------GPAG----------------------KSDLPQIEGPTDIERGP-ILPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 995          

HSP 2 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 298/581 (51.29%), Postives = 401/581 (69.02%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGR--QDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
            E++ F  ++ TF L +G+   DDD  S + RIVG FKG++ +YKV   E   +   +     +++ +PNNDP+ +LVR+YV+RA DLHPAD NGK+DPY++++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENRYYSKH+A CG+ + +  HGYN WRD   PT +L+KLCKE   D P Y     +V V    F          G+KKQ++E LAL V+++W  +P  GC LVPEH+ETRPL N +KPGI+QG +EMW+DMFP ++ AP   IDI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L++ PRGAK+ + C +     D  +  +SIFK KR +GWWPF   NE+D  E+++ GK++AE  LLS EE E  P GLGRNEP+ L  PNRP+ S    ++PL+ +  L+  +++W ++  +   A+L  + L +Y  PG +++R++
Sbjct: 1018 EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYDPNFGMFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHY-GPGGRVKVTNRVF---------TGQKKQTDEHLALSVLQHWEDIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMAEPDVDLPMVSIFKQKRVKGWWPFVARNEND--EMELTGKVEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPNPSLAWMLSPLRVVCVLLWRQYRWHVLGIIGSCAVLMFVALVLYTLPGAISERLI 1586          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 406/1055 (38.48%), Postives = 595/1055 (56.40%), Query Frame = 3
Query:  759 IEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS----------EANEEEEKEVPSVNQGNRPKIPK----WCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAV--------EILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCL---EKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRR-------PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
             +ARQL G N++P++ V +G++ K T ++ STN PYYN+       +S       VI  + L         L  G L+G F++DV TVY  P+H F HKWA+L DP DI +G KGY+K D+ ++GKG+ +K   K+      + D++DIE NLLLP  +    +RQ A   VKIY+AE LPRMNT IMA +K A+ G++K LVDP+VQV+FAG  G+T V+K++Y P WNE+I+FTEMFP LC R++V + D D V +  I TH+IDL +I NEGD GFLPTFGP+WVN+YG+ RNYT   +M   ++LN GLGEGV++R RLL+++   +L + +  L +  +V      P+++   GK E F L GAF E+++ID +IG K  PI FE+++G  GN++D           E  +  E+E   +   +  +  +       S++  M P   D+ YFHL F +KKPC Y+ S+ +D + R +  NI++K+ ++ S           E   E    E    H   + A + F+      L       H                 C    E M  +AKTM     K  +  +LK  +  ++KL  L   PQ+ +PDIFIW++ + KR+A+ARIP+++ILYS + EE G    +V  VFL+ PG+ G GP+GWT+Q ++++Y+WLGL +  + F  GLP G+     K  +       PP+ + YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+  N     T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LL AFEL+QV                       P G                        D+   EG T    G  ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    3 FKARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVIHSKNL---------LRSGTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPDGVPA--ERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDKGFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAETCTGKMEEFFLFGAFLESTMIDRKIGDK--PINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLSICYLGQQGPEPEWADETGQGEAEVLH---EGAGNVFVLEGLGRLTGDGLTNH----------------DCFAQQENMGTQAKTMRSQVKKNTVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLKLPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEE--IKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTV--------GKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQVI---------------------GPAG----------------------KSDLPQIEGPTDIERGP-ILPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 956          

HSP 2 Score: 593.193 bits (1528), Expect = 5.931e-179
Identity = 295/581 (50.77%), Postives = 397/581 (68.33%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGR--QDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
            E++ F  ++ TF L +G+   DDD  S + RIVG FKG++ +YKV   E   +   +     +++ +PNNDP+ +LVR+YV+RA DLHPAD NGK+DPY++++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENRYYSKH+A CG+ + +  HGYN WRD   PT +L+KLCKE   D P Y                        G+KKQ++E LAL V+++W  +P  GC LVPEH+ETRPL N +KPGI+QG +EMW+DMFP ++ AP   IDI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L++ PRGAK+ + C +     D  +  +SIFK KR +GWWPF   NE+D  E+++ GK++AE  LLS EE E  P GLGRNEP+ L  PNRP+ S    ++PL+ +  L+  +++W ++  +   A+L  + L +Y  PG +++R++
Sbjct: 1036 EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYDPNFGMFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHYGP----------------------GQKKQTDEHLALSVLQHWEDIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMAEPDVDLPMVSIFKQKRVKGWWPFVARNEND--EMELTGKVEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPNPSLAWMLSPLRVVCVLLWRQYRWHVLGIIGSCAVLMFVALVLYTLPGAISERLI 1592          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: FER1L6 (fer-1-like family member 6 [Source:NCBI gene;Acc:100497075])

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 405/1091 (37.12%), Postives = 598/1091 (54.81%), Query Frame = 3
Query:  741 QISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNE--GDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAI-------------------------KTVLRSESGGLPAGAK----------------------VYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGN------------RPKIPKWCHSTTEPMLPDTND--QEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRR------PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            QI+IT+ EARQL G NI+P++ + IG+  K T V+  TN+P+YN+Y  F+F   + +LFD++IRL  +       ++LL   LIG FR+D+ TVYN P H F  KWA+L DP DI +G KGY+K D+++ GKG+ V+   K        + +E IE NLL+P+   +  +R  A   V+IY+AE LP+MN+ IMA +  A  GDSK LVDP+V V FAG  GRT  +KN   P W+E+IVF EMFP LC R+++ V+D  ++ +  +ATH+IDL +I +E  GD GFLPTFGP+W+NLYG+PRN T   +M   +ELN G GEGV++RGR+LI I                         K    S+  G   G K                       + VPP  +    K E FLL G+ +EA++ID +IG K   I FE SVG  GN LD  ++   +K+ P    G              P++     S T P  P   D  + Y +L F E+KPC+Y+ S   D   R +  N+L+K+ +   + +E + EL          +M++ L  FI    + +++ +    ++  T LDK+R+ L +  LE M   AK + Q   K +L+   +E +++I  +  L+  PQ+ +PD+FIWL+ + KR+A+ARIPAR+ILYS + EE+G    ++ T+F + PG+    P GW +Q ++ +YLWLG  +      + LP GY  +            PP  ++Y  +  FQLRAHM+ AR LI +D SGLSD FA++    H  TTK++ +TLSP W+Q L+ ++++ Y     I  +PP +V+E++D+D ++        KSE++G     PTV L  + Y   +LT+  ++ G ++ GELLAAFEL+QV P+ G             ++S  PI                                   T +   + PVP  IRP L  YRVE LFWGVRE+++VQL+SVD+P++ IE     + S VI S K  PNF+    + ++ LPEN +  PPL I   D R FGR+ L+G H I+ + +++ K
Sbjct:   20 QIAITITEARQLIGENIDPVVIIEIGDDKKQTTVKEGTNAPFYNEYFVFDFIGPQEQLFDKIIRLSVMH------NKLLGSILIGSFRVDLGTVYNEPGHQFCDKWALLTDPSDIRTGVKGYLKCDISVAGKGDTVQSSQKI------SDAEEQIEKNLLIPKGFPS--ERPWARFYVRIYRAEGLPKMNSSIMANVTKAFIGDSKDLVDPYVVVMFAGQMGRTTAQKNCADPLWHEQIVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISDEQDGDKGFLPTFGPAWINLYGSPRNTT---LMEDHQELNEGHGEGVSFRGRILIEIAVEILSGGAHESKFSKAIKDMKLPLKDSKSSKGSGKEKGEKGSEDAKPTSAVDKTNSIQVEVEPFDVPP--EFQEEKSEDFLLFGSIFEATLIDRKIGDKG--ISFECSVGNYGNVLDGVSHSGTKKKSPEHEDGEGAPLLQPEEGEAAPEVSLSFISVTTPEKPLITDGNRNYHYLPFYERKPCIYVKSTWGDQTFRLYSSNMLQKMADHLEDGLEQVKELVKISDLAPEEKMRDVLTEFINQSRAFISTAEKRSKMTNTTALDKKRVTLCRQELEAMSANAKAIVQQKKKMSLSDMTREMQSLIDNIKFLVDEPQHTVPDVFIWLLSNNKRVAYARIPARDILYSTLAEERGHHCGKIKTLFFKLPGK---RPPGWNVQAKVDVYLWLGSSKYSHFIFENLPGGYEVETHSASSGHHGSPPPGNLVYKSQHMFQLRAHMYQARGLIAADTSGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNNLVIYGELKDIAEDPPNIVIEVYDDDALS--------KSEYIGSTVASPTVILANQTYSPAKLTYHPLFCGNLSGGELLAAFELLQV-PESG-------------VQSLPPIE----------------------------------TPDAAQIYPVPSNIRPVLSKYRVEVLFWGVRELKKVQLLSVDRPQVLIECAGKGVKSCVIQSYKSNPNFNVIGDWFEVELPENEVLHPPLSICVVDWRAFGRSTLVGTHTINCLKQFLYK 1030          

HSP 2 Score: 543.888 bits (1400), Expect = 2.159e-160
Identity = 279/592 (47.13%), Postives = 394/592 (66.55%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEES-SDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
             ++Y   LE   EF+ F  +++TF L +G+  DDE S  D+RI+G FKG+ +IYK  D+    +    +L + + +P N  V++L+R+Y++   +L PADP+GKSDPY++LRLG   I +++NYIPKQLNP+FG+ FE+   FP++S L I + D D++  DD+IGETKIDLENR++S+H+A CGL   +E  GYN WRD   PT +LAKLCK+   D P       ++ +    F       +D+ E+ +S E LAL+ + +WS +P+ GC LVPEH+ETRPL++ +KPGI+QG ++MW+DMFP +L  P  P+DI+PR+P  YELR+IIWNTEDVIL D  + TG+KSSDI+VKGW+KG+  D Q TDVHY SL+GEGNFNWRF+F F Y+ AE  +V   +++ F++++TE K P  L LQVWD D +++DDFLG +EL L+   RGAK+ + C L         + ISIF+ KR RGWWPF    E       + GK++AEF L++ EE E  PVG  R EP  L  PNRP++SF  F+NP K L +LI   +K ++I  L++  +   LVLF Y  PG ++ R+L  
Sbjct: 1177 LQIYSNELE--NEFKNFEDWVRTFELLRGKSTDDEHSVHDDRIIGKFKGSFSIYKNVDDTNPKDGG--QLRILQGIPPNHTVKVLIRVYIVAGFNLSPADPDGKSDPYIVLRLGKTEIKDRDNYIPKQLNPVFGRSFEMQATFPKDSILSIVIYDHDMIGTDDLIGETKIDLENRFFSRHRATCGLQSQYEIEGYNAWRDSTKPTEILAKLCKDNKLDGPYLRP--GQIQIGGKIFTGQTIFNQDD-EQVESYEHLALKALHSWSDIPDIGCNLVPEHIETRPLYHKDKPGIEQGRIQMWVDMFPTDLPLPGPPVDISPRKPKGYELRIIIWNTEDVILEDENIFTGQKSSDIYVKGWLKGIEDDSQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKLMVVSKRENIFSLEKTERKIPTVLLLQVWDFDRLSSDDFLGSMELNLNAFHRGAKTAKGCDLSMAATPKDENKISIFQQKRIRGWWPFVKSGE-------LTGKVEAEFHLVTTEEAEKNPVGRARKEPEPLEKPNRPNTSFNWFVNPFKCLYHLIWRNYKKYIIIGLVLLIITLFLVLFFYTLPGAISNRILSG 1754          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: FER1L6 (fer-1-like family member 6 [Source:NCBI gene;Acc:100497075])

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 396/1092 (36.26%), Postives = 584/1092 (53.48%), Query Frame = 3
Query:  741 QISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNE--GDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAI-------------------------KTVLRSESGGLPAGAK----------------------VYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFE-LSVGTTGNRLDSEANEEEEKEVPSVNQGN------------RPKIPKWCHSTTEPMLPDTND--QEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRR------PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            QI+IT+ EARQL G NI+P++ + IG+  K T V+  TN+P+YN+Y  F+F   + +LFD++IRL  +       ++LL   LIG FR+D+ TVYN P H F  KWA+L DP DI +G KGY+K D+++ GKG+ V+   K        + +E IE NLL+P+   +  +R  A   V+IY+AE LP+MN+ IMA +  A  GDSK LVDP+V V FAG  GRT  +KN   P W+E+IVF EMFP LC R+++ V+D  ++ +  +ATH+IDL +I +E  GD GFLPTFGP+W+NLYG+PRN T   +M   +ELN G GEGV++RGR+LI I                         K    S+  G   G K                       + VPP    +  K E FLL G+ +EA++ID +IG K   I FE +S G  GN LD  ++   +K+ P    G              P++     S T P  P   D  + Y +L F E+KPC+Y+ S   D   R +  N+L+K+ +   + +E + EL          +M++ L  FI    + +++ +    ++  T LDK+R+ L   C +++ V  K                        L+  +  PQ+ +PD+FIWL+ + KR+A+ARIPAR+ILYS + EE+G    ++ T+F + PG+    P GW +Q ++ +YLWLG  +      + LP GY  +            PP  ++Y  +  FQLRAHM+ AR LI +D SGLSD FA++    H  TTK++ +TLSP W+Q L+ ++++ Y     I  +PP +V+E++D+D ++        KSE++G     PTV L  + Y   +LT+  ++ G ++ GELLAAFEL+Q          +G+Q       S  PI                                   T +   + PVP  IRP L  YRVE LFWGVRE+++VQL+SVD+P++ IE     + S VI S K  PNF+    + ++ LPEN +  PPL I   D R FGR+ L+G H I+ + +++ K
Sbjct:   40 QIAITITEARQLIGENIDPVVIIEIGDDKKQTTVKEGTNAPFYNEYFVFDFIGPQEQLFDKIIRLSVMH------NKLLGSILIGSFRVDLGTVYNEPGHQFCDKWALLTDPSDIRTGVKGYLKCDISVAGKGDTVQSSQKI------SDAEEQIEKNLLIPKGFPS--ERPWARFYVRIYRAEGLPKMNSSIMANVTKAFIGDSKDLVDPYVVVMFAGQMGRTTAQKNCADPLWHEQIVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISDEQDGDKGFLPTFGPAWINLYGSPRNTT---LMEDHQELNEGHGEGVSFRGRILIEIAVEILSGGAHESKFSKAIKDMKLPLKDSKSSKGSGKEKGEKGSEDAKPTSAVDKTNSIQVEVEPFDVPPEVSFSVEKSEDFLLFGSIFEATLIDRKIGDKG--ISFEIISTGNYGNVLDGVSHSGTKKKSPEHEDGEGAPLLQPEEGEAAPEVSLSFISVTTPEKPLITDGNRNYHYLPFYERKPCIYVKSTWGDQTFRLYSSNMLQKMADHLEDGLEQVKELVKISDLAPEEKMRDVLTEFINQSRAFISTAEKRSKMTNTTALDKKRVTL---CRQELVVGPKRY---------------------NLSHFLAQPQHTVPDVFIWLLSNNKRVAYARIPARDILYSTLAEERGHHCGKIKTLFFKLPGK---RPPGWNVQAKVDVYLWLGSSKYSHFIFENLPGGYEVETHSASSGHHGSPPPGNLVYKSQHMFQLRAHMYQARGLIAADTSGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNNLVIYGELKDIAEDPPNIVIEVYDDDALS--------KSEYIGSTVASPTVILANQTYSPAKLTYHPLFCGNLSGGELLAAFELLQ----------SGVQ-------SLPPIE----------------------------------TPDAAQIYPVPSNIRPVLSKYRVEVLFWGVRELKKVQLLSVDRPQVLIECAGKGVKSCVIQSYKSNPNFNVIGDWFEVELPENEVLHPPLSICVVDWRAFGRSTLVGTHTINCLKQFLYK 1026          

HSP 2 Score: 545.043 bits (1403), Expect = 4.484e-161
Identity = 280/591 (47.38%), Postives = 394/591 (66.67%), Query Frame = 3
Query: 4815 KVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEES-SDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            K+Y   LE   EF+ F  +++TF L +G+  DDE S  D+RI+G FKG+ +IYK  D+    +    +L + + +P N  V++L+R+Y++   +L PADP+GKSDPY++LRLG   I +++NYIPKQLNP+FG+ FE+   FP++S L I + D D++  DD+IGETKIDLENR++S+H+A CGL   +E  GYN WRD   PT +LAKLCK+   D P       ++ +    F       +D+ E+ +S E LAL+ + +WS +P+ GC LVPEH+ETRPL++ +KPGI+QG ++MW+DMFP +L  P  P+DI+PR+P  YELR+IIWNTEDVIL D  + TG+KSSDI+VKGW+KG+  D Q TDVHY SL+GEGNFNWRF+F F Y+ AE  +V   +++ F++++TE K P  L LQVWD D +++DDFLG +EL L+   RGAK+ + C L         + ISIF+ KR RGWWPF    E       + GK++AEF L++ EE E  PVG  R EP  L  PNRP++SF  F+NP K L +LI   +K ++I  L++  +   LVLF Y  PG ++ R+L  
Sbjct: 1137 KIYSNELE--NEFKNFEDWVRTFELLRGKSTDDEHSVHDDRIIGKFKGSFSIYKNVDDTNPKDGG--QLRILQGIPPNHTVKVLIRVYIVAGFNLSPADPDGKSDPYIVLRLGKTEIKDRDNYIPKQLNPVFGRSFEMQATFPKDSILSIVIYDHDMIGTDDLIGETKIDLENRFFSRHRATCGLQSQYEIEGYNAWRDSTKPTEILAKLCKDNKLDGPYLRP--GQIQIGGKIFTGQTIFNQDD-EQVESYEHLALKALHSWSDIPDIGCNLVPEHIETRPLYHKDKPGIEQGRIQMWVDMFPTDLPLPGPPVDISPRKPKGYELRIIIWNTEDVILEDENIFTGQKSSDIYVKGWLKGIEDDSQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKLMVVSKRENIFSLEKTERKIPTVLLLQVWDFDRLSSDDFLGSMELNLNAFHRGAKTAKGCDLSMAATPKDENKISIFQQKRIRGWWPFVKSGE-------LTGKVEAEFHLVTTEEAEKNPVGRARKEPEPLEKPNRPNTSFNWFVNPFKCLYHLIWRNYKKYIIIGLVLLIITLFLVLFFYTLPGAISNRILSG 1713          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Otof (otoferlin [Source:MGI Symbol;Acc:MGI:1891247])

HSP 1 Score: 861.292 bits (2224), Expect = 0.000e+0
Identity = 480/1305 (36.78%), Postives = 748/1305 (57.32%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIY-FGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGM--GSDKRTLI---------------------------DPQ-TGEIGEFNYGQTDNESIESGE----DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS-----------EANEEEEKEV---PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            MAL+++LK V  L  + DRI K+ FR     ++V+   + +  F E F+WP+   +D  + LE++++ YSK  +NKLIG+  + LQK++E+ ++   + L+D +++II+ ++S E+ Y + D  +  W   +F   + D  L +  D S ++ G+  GS   T I                           +PQ   E         D+ +I+ G+    D  S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+S   +FD++I++  +   N+    L  G L+G F+MDV TVY+ P+H F HKWA+L DP DI +G KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   VKIY+AE LPRMNT +MA +K A  G++K LVDP+VQV FAG  G+T V+K++Y P WNE++VFT++FP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   ++   ++LN GLGEGV++R RL++ +   +L + +  L +  +V      P+S+   G+ E F L GAF EAS+ID + G K  PI FE+++G  GN +D            E  +EEE ++    S ++G+         S+T PM P   D+ YFHL + E+KPC+Y+ S+  D + R +  NI++ + ++    +  + E+   E+     R++  L+         L+     +  S +T LD+ER+K     LE M  +AK++     +  +  +L+ C+  ++KL  L   PQ+ +PD+FIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q +L++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRYQATDGTVGPWDDGDF---LGDESLQEEKD-SQETDGLLPGSRPSTRISGEKSFRRAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNL----LRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPP--ERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGDK--PITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASV-SSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGKADLP-------------------------------------PINGPVDMDRGP--------IMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1231          

HSP 2 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 424/598 (70.90%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVRIYV+RA DLHPAD NGK+DPY+ ++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCKE   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVI+WNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD+SF+ F+NPLKS +Y + + ++W L+K L++  LL L  LF+Y+ PGYLAK++LGA
Sbjct: 1405 IDELKVYPKELE--SEFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHF-GPHGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKFLLLFLLLLLFALFLYSLPGYLAKKILGA 1997          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Otof (otoferlin [Source:MGI Symbol;Acc:MGI:1891247])

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 481/1320 (36.44%), Postives = 751/1320 (56.89%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIY-FGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGM--GSDKRTLIDPQT------------GEIGEFNYGQT-------------------------------DNESIESGE----DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS-----------EANEEEEKEV---PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            MAL+++LK V  L  + DRI K+ FR     ++V+   + +  F E F+WP+   +D  + LE++++ YSK  +NKLIG+  + LQK++E+ ++   + L+D +++II+ ++S E+ Y + D  +  W   +F   + D  L +  D S ++ G+  GS   T I  +             G  GE   G++                               D+ +I+ G+    D  S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+S   +FD++I++  +   N+    L  G L+G F+MDV TVY+ P+H F HKWA+L DP DI +G KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   VKIY+AE LPRMNT +MA +K A  G++K LVDP+VQV FAG  G+T V+K++Y P WNE++VFT++FP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   ++   ++LN GLGEGV++R RL++ +   +L + +  L +  +V      P+S+   G+ E F L GAF EAS+ID + G K  PI FE+++G  GN +D            E  +EEE ++    S ++G+         S+T PM P   D+ YFHL + E+KPC+Y+ S+  D + R +  NI++ + ++    +  + E+   E+     R++  L+         L+     +  S +T LD+ER+K     LE M  +AK++     +  +  +L+ C+  ++KL  L   PQ+ +PD+FIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q +L++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRYQATDGTVGPWDDGDF---LGDESLQEEKD-SQETDGLLPGSRPSTRISGEKSFRSKGREKTKGGRDGEHKAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNL----LRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPP--ERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGDK--PITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASV-SSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGKADLP-------------------------------------PINGPVDMDRGP--------IMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1246          

HSP 2 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 425/598 (71.07%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVRIYV+RA DLHPAD NGK+DPY+ ++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCKE   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVI+WNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD++F+ F+NPLKS+KYLIC ++KW +IK ++    L +L LF+Y+ PGY+ K++LGA
Sbjct: 1400 IDELKVYPKELE--SEFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHF-GPHGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLALFLYSLPGYMVKKLLGA 1992          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l6 (fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:MGI:3645398])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 415/1137 (36.50%), Postives = 625/1137 (54.97%), Query Frame = 3
Query:  618 GQTDNESIESGEDDESF-----AATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNE--GDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRS------------------------------------------------ESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANE---------EEEKEVPSVNQGNRPKIPKWC---HSTTEPMLPDTND--QEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAK-TMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSND----CFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            G +  E  E    D++F     +A + R   +   +H    K++++QI++T+ EARQL G NI+P++ + IG+  K + V+  TNSP+YN+Y  F+F   +  LFD++I++  L        +L+   LIG FR+DV TVYN P H F  KWA+L DP DI +G KGY+K D+++ GKG+ +K  PK+       + +E IE NLL+PQ   +  +R  A   V++Y+AE LP+MN+ IMA +  A  GDSK LVDPFV+VSFAG TGRT V+KN   P W+E++VF EMFP LC R+++ V+D  ++ +  +ATH+IDL +I NE  GD GFLPTFGP+W+NLYG+PRN++   +M   +ELN G GEGV++RGR+L+ I   + S                                                ++       + ++VPP  +    K E FLL GAF+EA++ID +IG K  PI FE+SVG  GN +D  ++           EE  +P +++G +           STT P  P   D  + Y +L F  KKPC+  IS   D   R    N+LEK+ +     +E + EL    +     +MK AL  FI      ++  +       +T LDK+R+ L    L+ M  +A+  + Q   K +L   ++E +  ++K++ L+  PQ+ +PD+FIW++ + KR+A+ARI A+++LYS I E+ G    ++ T FL+ PG+    P GWT+Q ++ +YLWLG  R   T    LP+GY  +          PP  ++Y  +  FQLRAHM+ AR LI +D +GLSD FA++       TTK++ +TLSP W+Q L+ + ++ +  +  ++ +PP +VVE++D D +        GK E+LG     P V L +++Y+ P+L++  I+ G ++ G+LLA FEL+QV P       +G+Q +        P G                        D+T             + PVP  IRP L  YRVE LFWGVREM++VQL+SVD+P++ IE G   + S VI S K  PNFS   +  ++ LPEN L  PPL I   D R FGR+ L+G + I+ + +++ K
Sbjct:   37 GPSHQEGPEDLTKDDAFLAPGPSAPSKRRAKLLTKIHDGEIKSQNYQITVTITEARQLVGENIDPVVTIEIGDDKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKISVLH------HKLIGSILIGSFRVDVGTVYNQPGHQFCDKWALLTDPGDIRTGTKGYLKCDISVTGKGDILKTNPKT------SDAEEQIEKNLLIPQGFPS--ERPWARFYVRLYRAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTGRTSVQKNCADPVWHEQVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGAQESKFSKALKELKLSSKDKDSKSSKGSSKDKADKADDSKAQQTTDKTNSTEVEVESFAVPP--EIIPEKYEDFLLFGAFFEATMIDRKIGDK--PISFEVSVGNFGNLIDGGSHHGSKKKSTELTEEDVLPLLHEGEKDVAQDSAISMASTTHPEKPLVTDGNRNYNYLPFGAKKPCVSFISSWGDQTFRLHWSNMLEKMADLLEEGIEEVRELVKVSQEAPEEKMKTALRDFITQSRVFISEAEKKPKTLNQTALDKKRLTLCWQELKAMADEAEGVIRQQKKKLSLDEMIREAQNFVEKIHFLVDEPQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKIKTHFLKLPGK---RPPGWTVQAKVDIYLWLGSTRYSNTILDNLPVGYEAEMPPKSSGTHHPPSALLYQAQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSQCQTTKIISQTLSPTWNQMLLFNELVLHGEEKELLESPPHVVVELYDSDAV--------GKPEYLGATVAAPVVTLADQDYEPPKLSYHPIFCGNLSGGDLLAVFELLQVPP-------SGLQGL-------PPTGP----------------------PDITQ------------IYPVPSNIRPVLSKYRVEVLFWGVREMKKVQLLSVDRPQVLIECGGGGVKSCVIQSYKNNPNFSVQAEAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINCLKQFLCK 1093          

HSP 2 Score: 544.658 bits (1402), Expect = 4.532e-160
Identity = 280/591 (47.38%), Postives = 396/591 (67.01%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD-NRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEI-EEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
             K+Y   LE   EF  F  +++TF L +G+  +++   D +R++G FKG+  IYK  ++    +    +L + + +P N PVQ+L+R+Y++ A +L PADP+GKSDPY++LRLG   I +++ YIPKQLNP+FG+ FE+   FP+ES L + + D D++  DD+IGETKIDLENR+YSKH+A+CGL   +E  GYN WRD   PT +L KLCK+   D P +     K+ + +  F       EED+ E  +S E LAL+V+ +W  +P  G  LVPEH+ETRPL++ +KPG++QG L+MW+DMFPK+      P+DI+PR+P  YELRV IWNTEDVIL D  + TG+KSSDI+VKGW+KGL  D Q TDVHY SL+GEGNFNWRF+F F Y+ AE ++V   +++ F++++ E K+P  L LQVWD + +++DDFLG LE+ L+  PR AKS + C L +       + ISIF+ KR RGWWPF        K  ++ GK++AEF L++ EE E  PVG  R EP  L  PNRPD+SF  F++P K L +LI   +K ++I A I+  L+  LVLFIY  PG +++R++
Sbjct: 1281 LKIYDGDLE--SEFNNFEDWVKTFELFRGKSTEEDHGLDGDRVIGKFKGSFCIYKSPEDSTSEDSG--QLRIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYIVLRLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSVLIYDHDMIGSDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFRP--GKIQIGKKVFSGKTVFNEEDSEEMVESYEHLALKVLHSWEDIPEAGWRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDTPQLGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWIKGLEDDRQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVISKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENAVQENKISIFQQKRVRGWWPFA-------KSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFVSPFKCLYHLIWKNYKKYIIIAFILIILIVFLVLFIYTLPGAISRRIV 1858          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l6 (fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:MGI:3645398])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 415/1137 (36.50%), Postives = 625/1137 (54.97%), Query Frame = 3
Query:  618 GQTDNESIESGEDDESF-----AATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNE--GDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRS------------------------------------------------ESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANE---------EEEKEVPSVNQGNRPKIPKWC---HSTTEPMLPDTND--QEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAK-TMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSND----CFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            G +  E  E    D++F     +A + R   +   +H    K++++QI++T+ EARQL G NI+P++ + IG+  K + V+  TNSP+YN+Y  F+F   +  LFD++I++  L        +L+   LIG FR+DV TVYN P H F  KWA+L DP DI +G KGY+K D+++ GKG+ +K  PK+       + +E IE NLL+PQ   +  +R  A   V++Y+AE LP+MN+ IMA +  A  GDSK LVDPFV+VSFAG TGRT V+KN   P W+E++VF EMFP LC R+++ V+D  ++ +  +ATH+IDL +I NE  GD GFLPTFGP+W+NLYG+PRN++   +M   +ELN G GEGV++RGR+L+ I   + S                                                ++       + ++VPP  +    K E FLL GAF+EA++ID +IG K  PI FE+SVG  GN +D  ++           EE  +P +++G +           STT P  P   D  + Y +L F  KKPC+  IS   D   R    N+LEK+ +     +E + EL    +     +MK AL  FI      ++  +       +T LDK+R+ L    L+ M  +A+  + Q   K +L   ++E +  ++K++ L+  PQ+ +PD+FIW++ + KR+A+ARI A+++LYS I E+ G    ++ T FL+ PG+    P GWT+Q ++ +YLWLG  R   T    LP+GY  +          PP  ++Y  +  FQLRAHM+ AR LI +D +GLSD FA++       TTK++ +TLSP W+Q L+ + ++ +  +  ++ +PP +VVE++D D +        GK E+LG     P V L +++Y+ P+L++  I+ G ++ G+LLA FEL+QV P       +G+Q +        P G                        D+T             + PVP  IRP L  YRVE LFWGVREM++VQL+SVD+P++ IE G   + S VI S K  PNFS   +  ++ LPEN L  PPL I   D R FGR+ L+G + I+ + +++ K
Sbjct:   37 GPSHQEGPEDLTKDDAFLAPGPSAPSKRRAKLLTKIHDGEIKSQNYQITVTITEARQLVGENIDPVVTIEIGDDKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKISVLH------HKLIGSILIGSFRVDVGTVYNQPGHQFCDKWALLTDPGDIRTGTKGYLKCDISVTGKGDILKTNPKT------SDAEEQIEKNLLIPQGFPS--ERPWARFYVRLYRAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTGRTSVQKNCADPVWHEQVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGAQESKFSKALKELKLSSKDKDSKSSKGSSKDKADKADDSKAQQTTDKTNSTEVEVESFAVPP--EIIPEKYEDFLLFGAFFEATMIDRKIGDK--PISFEVSVGNFGNLIDGGSHHGSKKKSTELTEEDVLPLLHEGEKDVAQDSAISMASTTHPEKPLVTDGNRNYNYLPFGAKKPCVSFISSWGDQTFRLHWSNMLEKMADLLEEGIEEVRELVKVSQEAPEEKMKTALRDFITQSRVFISEAEKKPKTLNQTALDKKRLTLCWQELKAMADEAEGVIRQQKKKLSLDEMIREAQNFVEKIHFLVDEPQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKIKTHFLKLPGK---RPPGWTVQAKVDIYLWLGSTRYSNTILDNLPVGYEAEMPPKSSGTHHPPSALLYQAQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSQCQTTKIISQTLSPTWNQMLLFNELVLHGEEKELLESPPHVVVELYDSDAV--------GKPEYLGATVAAPVVTLADQDYEPPKLSYHPIFCGNLSGGDLLAVFELLQVPP-------SGLQGL-------PPTGP----------------------PDITQ------------IYPVPSNIRPVLSKYRVEVLFWGVREMKKVQLLSVDRPQVLIECGGGGVKSCVIQSYKNNPNFSVQAEAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINCLKQFLCK 1093          

HSP 2 Score: 544.658 bits (1402), Expect = 4.532e-160
Identity = 280/591 (47.38%), Postives = 396/591 (67.01%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD-NRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEI-EEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
             K+Y   LE   EF  F  +++TF L +G+  +++   D +R++G FKG+  IYK  ++    +    +L + + +P N PVQ+L+R+Y++ A +L PADP+GKSDPY++LRLG   I +++ YIPKQLNP+FG+ FE+   FP+ES L + + D D++  DD+IGETKIDLENR+YSKH+A+CGL   +E  GYN WRD   PT +L KLCK+   D P +     K+ + +  F       EED+ E  +S E LAL+V+ +W  +P  G  LVPEH+ETRPL++ +KPG++QG L+MW+DMFPK+      P+DI+PR+P  YELRV IWNTEDVIL D  + TG+KSSDI+VKGW+KGL  D Q TDVHY SL+GEGNFNWRF+F F Y+ AE ++V   +++ F++++ E K+P  L LQVWD + +++DDFLG LE+ L+  PR AKS + C L +       + ISIF+ KR RGWWPF        K  ++ GK++AEF L++ EE E  PVG  R EP  L  PNRPD+SF  F++P K L +LI   +K ++I A I+  L+  LVLFIY  PG +++R++
Sbjct: 1281 LKIYDGDLE--SEFNNFEDWVKTFELFRGKSTEEDHGLDGDRVIGKFKGSFCIYKSPEDSTSEDSG--QLRIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYIVLRLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSVLIYDHDMIGSDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFRP--GKIQIGKKVFSGKTVFNEEDSEEMVESYEHLALKVLHSWEDIPEAGWRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDTPQLGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWIKGLEDDRQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVISKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENAVQENKISIFQQKRVRGWWPFA-------KSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFVSPFKCLYHLIWKNYKKYIIIAFILIILIVFLVLFIYTLPGAISRRIV 1858          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l4 (fer-1-like 4 (C. elegans) [Source:MGI Symbol;Acc:MGI:1921812])

HSP 1 Score: 591.267 bits (1523), Expect = 1.914e-175
Identity = 378/1317 (28.70%), Postives = 639/1317 (48.52%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDR----------KLSDADDISIDSHGMGSDKRTL--IDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLP--GDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEG-DTGFLPTFGPSWVNLYGT-PRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAI--------------KTVLRS----------------ESGGLPAG---------------------AKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLD-----SEANEEEEKE-------VPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKG 3809
            MAL + ++++  L    DR +++ FR F + T+ +        GE F+WP        ++L +++   S+  + + +G++ ISLQ+L     +  +E L+D    +  I V  +L Y  P+     W +++F  PI D           +  +  +  ++   +   +R    +  Q  E  E        E  +       F+   +R LG+P      + K +D+Q+ +TV+EA++L G NINP + VR+G++ K T     TN P+YN+Y  FEFH ++  L D ++ +          S+ LP     IG FRMD+    + PD  F  KWA L DP+D  +G KG+VK+ L++  +G+     P             DIE NLLLP  ++   +R  A + V++Y+AE LP + T ++ ++  A+  D   L+DP+V+VSF G  G T V+     P+WNE++ F E+FP L   +R+ + D   + +  +ATH +DL QI N G   GF PTFGP+WV LYG+ P     D +    + LN GLGEG+ +RGRLL+A+              +T  RS                  G  PAG                      +V  + P+ +      E FLL G  +EA++ID  + KK  PI  E+S+G  G + +     S A+E  E         + S ++G   +  +   +  +   P   +  Y  L    +KPCL++ S  ED+  R    N + K+     + ++ + ++      G   R+K  L+  +       +  +  R ++    LD+ R KL    L  M  +   + +     N+   +   + ++ +L  L   PQ  LPD+ +W+    +R+A+ARIPA++ILYS + EE+G    ++ ++ L  P   G  P    +  +L+++LWLGL +  K     LP+    +       P  +   +  YFQLRAH++ AR ++ +D+SGLSD FAR+L++    TT+V+ +TLSP WD+ L+ D +I    ++ +   PP++V+ +FD         N+ G + FLGR F  P V L E+ Y+ P L ++ + +G   AGE++A FELI++     Y                                    ++E  +  DV P +  ++       + +P  +RP L  +RVE LFWG+R + RV L  ++KP++ +E     + S+V+P+ +  PNF+  ++++ + LPE     PPL I   + R FGRT+L+G+H++ ++ +++++G
Sbjct:    1 MALTVCVRHLTGLPGTHDRQVRLCFRGFTQKTRKIHCGREADVGELFRWPHYGSPLAGESLSVQVVNCSRVFSPRPLGTLVISLQQLQSAGHLVLREALVDERLRVSPIQVELDLKYQPPEGAAGTWAEEDFGTPIRDSLELIIPNVGFQDMEPGEAQLERRAVALGRRLARSLGTQDDEENELELEPELEEEPDVEISGVVFSPLKSRALGLPRGDPFKVCKAQDFQVGVTVLEAQKLVGVNINPYVAVRVGDQRKVTATLRGTNCPFYNEYFLFEFHETRLHLQDLLLEITAFH------SQTLPFMATRIGTFRMDLGMALDQPDGHFHQKWAPLHDPRDTRAGTKGFVKITLSVRARGDLPLPPPPPCP-----GTSSDIEKNLLLPHGVQ--AERPWARLRVRVYRAEGLPTVRTGLLGSLARALH-DQNVLLDPYVRVSFLGQQGETSVRGEETAPKWNEQLSFVELFPPLTRSLRLQLRDNAPLVDVALATHVLDLRQISNSGRAAGFNPTFGPAWVPLYGSLPSGRLRDDL----QSLNEGLGEGIWFRGRLLVAVSMEVYEGRVEPKPSQTTQRSGLSRLTGKKKKKKEKTRQGQTPAGILQPASASTSEDAPEIPSAMEVEVEDLLPLPENALASFEDFLLFGVLFEATMIDPSLAKK--PISLEISIGHAGRQEEQSGQGSRADEGSESSTLEVQPLLESEDRGAGQEEQELLGTPAQWPEPVDGNGPYLCLPLRHRKPCLHVWSCWEDYTWRLQSSNSVCKVAERLDHGLQEVEKMQRRSGPGACTRLKQTLEELVAGSRQFCHGAE-RRTMTRPNALDRCRAKLLTHSLNLMARQGLRLLRSLRLNNMQRTVVLAKKLLARLRFLAQEPQPPLPDVLVWMFSGQRRVAYARIPAQDILYSVVEEERGRDCGKIQSLLLTVP---GAAPG--EVCAKLELFLWLGLGKQAKACTSELPMDLLPEPSSGL--PQSLYRDDFRYFQLRAHLYQARGVLAADDSGLSDPFARVLISTQCQTTRVLEQTLSPLWDELLVFDQLIVDGRREHLREEPPLVVINVFDH--------NKFGPAVFLGRAFAAPRVKLIEDPYQRPELQFFPLRKGPQAAGEVIATFELIEL----DYS----------------------------------GHLEPSVPSDVEPRDLASLVEPISGHLSLPPSVRPVLRAFRVEVLFWGLRGLGRVHLFEIEKPQVVLEVAGRRVESEVLPNYRENPNFTELVRHVTVDLPEQPYLQPPLSILVIERRAFGRTVLVGSHIVPHMLRFILQG 1243          

HSP 2 Score: 501.901 bits (1291), Expect = 5.284e-145
Identity = 266/599 (44.41%), Postives = 364/599 (60.77%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEES--SDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEK-----KQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFT--GENED---------------------DPKELD----------VNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKF 6476
            I   K+Y   LE+  EF  F  ++  FPL +G+   D E   +    VG FKG+  IY   + +        +  + + +P N P+++LVR+Y+++A +L PADPNGK+DPY+++  G +  + KE YIPKQLNPIFG+  EL V  P +  L + V D DLV  DD+IGET IDLENR+YS H+A CGL   ++ +GYN WRD   P+ +LA LC+  G   P+Y A    V V    F   +E    +  K     + S E  AL V++ W ++P  G  LVPEH+ETRPL++   PG+ QGSL MWID+FP ++ APP P+DI PRQPISYELRV+IWNT+DV L D   LTGE+SSDI+VK W+KGL  D Q TDVH+ SL+GEGNFNWRF+F FDY+  E ++  + K  PFA++E E + P  L LQVWD D ++A+DFLG LEL L  + RGA+ P+ C + +L  DG+    ++F+  R RGWWP     + ED                      P++L+          + GK++AEF+LL+ EE E  PVG GR EP  L  PNRP +SF  F+NPLK+  + I  ++
Sbjct: 1368 IATLKIYNSSLED--EFSHFEDWLSVFPLYRGQGGQDGEGEGASGHFVGKFKGSFLIYPESEAKSFS-----EPQISRGVPQNRPIKLLVRVYIVKATNLAPADPNGKADPYVVVSAGKEQRDTKERYIPKQLNPIFGEVLELSVSLPAQPELTVAVFDHDLVGSDDLIGETHIDLENRFYSHHRANCGLASQYDVNGYNAWRDAFRPSQILAGLCQRCGLPVPEYRA--GAVKVGSRVFLTPSEAPPPDDRKPKVTSEASEEAQALHVLRRWQEMPGLGIQLVPEHVETRPLYHPRSPGLLQGSLHMWIDIFPSDVPAPP-PVDIKPRQPISYELRVVIWNTDDVALDDVNPLTGERSSDIYVKSWVKGLEQDRQETDVHFNSLTGEGNFNWRFVFRFDYLPTEREVSVRRKPGPFALEEAEFRQPAVLVLQVWDYDRISANDFLGSLELQLPDMVRGARDPEHCSV-RLALDGAGPRCNLFRCHRLRGWWPVVKMKDMEDVEREAREAQAGKKRKRKRRAGRPEDLEFTDTGGNVYILTGKVEAEFELLTVEEAEKRPVGKGRKEPEPLEKPNRPKTSFNWFVNPLKTFIFFIWRRY 1955          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q5SPC5|OTOF_DANRE (Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 490/1320 (37.12%), Postives = 747/1320 (56.59%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEF---------------ENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQT----------DNESIESGEDDE---------------SFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVYSVPP--ISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEA-------------------------NEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-SNDCFKF----RRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV 3800
            MALV++LK V  L  + DRI K+ FR     ++V+   +D   F + F+WP+G ++D  + LE++++ YSK   N+LIG+  + LQK++E+  +   + LID N++ I+ T+S E+ Y + D  +  W   EF               ++ ++ R  S         HG+ + ++       G       G+T          D+ +I   ED +               S A+  A T  V        + + P+  +  D+QIS+TVIEARQL G N++P++ V IGE+ K T ++ STN PYYN+Y  F+FH+    +FD++I++  +   N+    L  G L+G F++DV TVY  P+H F HKWAML DP DI +G KGYVK D+ ++GKG+ +K   K++     + D++DIE NLLLP+ + +  +RQ A   VKIY+AE LP+MNT IMA +K A  G+++ LVDP+V V FAG  G+T V+K++Y P WNE+++FTEMFP LC R++V + D D V +  I TH+IDL ++ N+GD GFLPT GP+WVN+YG+ RNYT   +M   ++LN GLGEGV++R RLLI+I   +L + S  + +  +V+  P   IS+   GK E F L G+F EA++ID +IG K  PI FE+++G  GN++D  +                         + EEE E    + G+   +P     +T PM P   D+ YFHL + EKKPC+Y+ S+ +D + R +  NI++K+ ++    +  + E+   E+     R++  L+    +    +      +++S +T LD+ER+K     +E M  +AKT+     +  +  +LK     +++L  L   PQ+ +PD+FIW+I + KR+A+ARIP+++ILYS + EE G    +V  VFL+ PG+ G GP+GWT+Q +L+MYLWLGL +  K F  GLP G+  N   K       PP+ ++Y  K  FQLRAHM+ AR+L  +D SGLSD FAR+  + H   T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK+EF+GR F KP   + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P    R A                               L  ++G  + D  P            ++PVP  IRP L  YR+E LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR IL+G+H ++ + K++
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKYQTMDGSVKVWSDGEFLDIPDDLDGTFQFETDSLLSGRSQSSGTSPGRSIHGIPTFRKA----GKGVFSAMKLGKTRTSKDDHKKGDDAAILDAEDLDRKAMRLGGILDPDTISLASVTAVTTNVSNKRSKPDIKMEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKNL----LRSGTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKAS-----EADEDDIEGNLLLPEGVPS--ERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDKGFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGDK--PISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAE----DDGDLTSVP-----STPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERRLRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFLRLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTV--------GKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGP--AGRAA-------------------------------LPPIDGPTDSDRGP------------ILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTLRKFI 1238          

HSP 2 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 325/599 (54.26%), Postives = 428/599 (71.45%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS---DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            ++   VY   LE   EF  F  ++ TF L +G+  DD++ +   ++RIVG FKG+L +YK+   E           + +++S+P+NDP+ +LVRIY+IRA DLHPAD NGK+DPY++++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENRYYSKH+A CG+   +  HGYN WRD Q P  +LAKLCKE   D P Y     +V VA   F    EIE+++G KKQ+ E LAL V+++W ++P  GC L+PEH+ETRPL N +KPGI+QG +EMW+DMFP ++ AP   IDI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L+K PRGAK+ + C L  + K+  + TISIFK KR +GWWPF  +NE+D  E ++ GK++AE  LL+ EE E  PVGLGRN+P  L  PNRPD+S + FMNPL+S++Y I + ++W ++KAL +  LL L+ LF+Y+ PGYL K++LGA
Sbjct: 1399 VDELMVYNKELE--SEFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDPNMGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHY-GPGGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFVAQNEND--EFELTGKVEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTSLMWFMNPLRSIRYFIWHNYRWLILKALALLLLLLLVGLFLYSIPGYLVKKLLGA 1992          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q9ERC5|OTOF_RAT (Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2)

HSP 1 Score: 862.448 bits (2227), Expect = 0.000e+0
Identity = 479/1324 (36.18%), Postives = 744/1324 (56.19%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDE-----------------------------------------------------SFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS-----------EANEEEEKEV---PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            MAL+++LK V  L  R DRI K+ FR     ++V+   +D   F E F+WP+   +D  + LE++++ YSK  +NKLIG+  + LQK++E+ ++   + LID N++II+ ++S E+ Y + D  +  W   +F   + D  L + +  S ++ G+    R    P T   GE ++     E  + G D E                                                     S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+S   +FD++I++  +   N+    L  G L+G F+MDV TVY+ P+H F HKWA+L DP DI +G KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   VKIY+AE LPRMNT +MA +K A  G++K LVDP+VQV FAG  G+T V+K++Y P WNE++VFT++FP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   ++   ++LN GLGEGV++R RL++ +   +L + +  L +  +V      P+S+   G+ E F L GAF EAS+ID + G K  P+ FE+++G  GN +D            E  +EEE ++    S ++G+         S+T PM P   D+ YFHL + E+KPC+Y+ S+  D + R +  NI++ + ++    +  + E+   E+     R++  L+         L+     +  S +T LD+ER+K     LE M  +AK++     +  +  +L+ C+  ++KL  L   PQ+ +PD+FIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q +L++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D +GLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    1 MALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQAADGTVGPWDDGDF---LGDESLQEEEKDSQETDGLLPGSR----PSTRTPGEKSFRSKGKEKTKGGRDGEHKAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNL----LRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPP--ERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGDK--PVTFEVTIGNYGNEVDGTSRPQRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASV-SSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGHSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQTFQLRAHMYQARSLFAADSTGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPSGKADLP-------------------------------------PINGPVDMDRGP--------IMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1247          

HSP 2 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 425/598 (71.07%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVRIYV+RA DLHPAD NGK+DPY+ ++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCKE   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVI+WNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD++F+ F+NPLKS+KYLIC ++KW +IK ++    L +L LF+Y+ PGY+ K++LGA
Sbjct: 1401 IDELKVYPKELE--SEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHF-GPHGRVKVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLALFLYSLPGYMVKKLLGA 1993          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q9HC10|OTOF_HUMAN (Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3)

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 478/1306 (36.60%), Postives = 738/1306 (56.51%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEF--------------------------ENPITDRKLSDADDISIDSHGMGSDKRTLIDPQT-GEIGEFNYGQTDNESIESGE----DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS-----------EANEEEEKEV-------PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            MAL+++LK V  L  R DRI K+ FR     ++V+   +D   F E F+WP+   +D  + LE++++ YSK  +NKLIG+  + LQK++E+  +   + LID N++II+ ++  E+ Y + D  +  W   +F                            P  ++    A      +  +G ++    +PQ   E         D+ +I  G+    D  S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+S   +FD++I++  +   N+    L  G L+G F+MDV TVY+ P+H F HKWA+L DP DI SG KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   VKIY+AE LPRMNT +MA +K A  G++K LVDP+VQV FAG  G+T V+K++Y P WNE++VFT++FP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   ++   ++LN GLGEGV++R RLL+ +   ++ + +  L +  +V      PIS+   GK E F L GAF EAS+ID   G K  PI FE+++G  GN +D            E  +EEE ++        + + G+   +     S+T PM P   D+ YFHL + E+KPC+Y+ S+  D + R +  NI++ + ++    +  + E+   E+     R++  L+         L+     +  S +T LD+ER+K     LE M  +A+ +     +  +  +L+ C+  ++KL  L   PQ+ +PDIFIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q ++++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRYQATDGTVGSWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSSRPPGEKSFRRAGRSVFSAMKLGKNRSHKEEPQRPDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTTNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNL----LRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPP--ERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDRRNGDK--PITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASV-----SSTPPMRPQVTDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMIKTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLP-------------------------------------PINGPVDVDRGP--------IMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1232          

HSP 2 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 424/598 (70.90%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLM--LYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVR+YV+RA DLHPAD NGK+DPY+ +RLG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCK+   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVIIWNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD+SF+ F+NPLKS +Y + + ++W L+K L++  LL LL LF+Y+ PGYL K++LGA
Sbjct: 1405 IDELKVYPKELE--SEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHF-GPPGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLLALFLYSVPGYLVKKILGA 1997          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q9ESF1|OTOF_MOUSE (Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1)

HSP 1 Score: 859.751 bits (2220), Expect = 0.000e+0
Identity = 480/1305 (36.78%), Postives = 748/1305 (57.32%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIY-FGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGM--GSDKRTLI---------------------------DPQ-TGEIGEFNYGQTDNESIESGE----DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS-----------EANEEEEKEV---PSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK 3806
            MAL+++LK V  L  + DRI K+ FR     ++V+   + +  F E F+WP+   +D  + LE++++ YSK  +NKLIG+  + LQK++E+ ++   + L+D +++II+ ++S E+ Y + D  +  W   +F   + D  L +  D S ++ G+  GS   T I                           +PQ   E         D+ +I+ G+    D  S A+  A T  V        + + P+  +  D+Q+SITVIEARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+S   +FD++I++  +   N+    L  G L+G F+MDV TVY+ P+H F HKWA+L DP DI +G KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   VKIY+AE LPRMNT +MA +K A  G++K LVDP+VQV FAG  G+T V+K++Y P WNE++VFT++FP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   ++   ++LN GLGEGV++R RL++ +   +L + +  L +  +V      P+S+   G+ E F L GAF EAS+ID + G K  PI FE+++G  GN +D            E  +EEE ++    S ++G+         S+T PM P   D+ YFHL + E+KPC+Y+ S+  D + R +  NI++ + ++    +  + E+   E+     R++  L+         L+     +  S +T LD+ER+K     LE M  +AK++     +  +  +L+ C+  ++KL  L   PQ+ +PD+FIW++ + KR+A+AR+P++++L+S + EE G   ++V T+FL+ PG+ G G +GWT+Q +L++YLWLGL +  K F  GLP G+     +        PP+ ++YT+K  FQLRAHM+ AR+L  +D SGLSD FAR+   +    T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D M        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AG+LLAAFEL+Q+ P     L                                       ING V  + G         ++PVP  IRP L  YRVE LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNF+  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H +S++ +++ +
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRYQATDGTVGPWDDGDF---LGDESLQEEKD-SQETDGLLPGSRPSTRISGEKSFRRAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNL----LRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPP--ERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGDK--PITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASV-SSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM--------GKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGKADLP-------------------------------------PINGPVDMDRGP--------IMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYR 1231          

HSP 2 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 316/598 (52.84%), Postives = 424/598 (70.90%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS--DNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            I+  KVYP  LE   EF+ F  ++ TF L +G+  DDE+ S  + RIVG FKG+L +YKV   E       +     +++ +P+NDP+ +LVRIYV+RA DLHPAD NGK+DPY+ ++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSKH+A CG+ Q +  HGYN WRD   P+ +L +LCKE   D P +     +V VA   F   +EIE++NG++K ++E +AL  +++W  +P  GC LVPEH+ETRPL N +KPGI+QG LE+W+DMFP ++ AP  P+DI+PR+P  YELRVI+WNT++V+L D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWR++F FDY+ AE+KIV   K+S F+ DETE K P +L LQ+WDAD  +ADDFLG +EL L++ PRGAK+ + C +     +  V  +SIFK KR +GWWP    NE+D  E ++ GK++AE  LL+ EE E  PVGL RNEP+ L  PNRPD+SF+ F+NPLKS +Y + + ++W L+K L++  LL L  LF+Y+ PGYLAK++LGA
Sbjct: 1405 IDELKVYPKELE--SEFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHF-GPHGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNEND--EFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKFLLLFLLLLLFALFLYSLPGYLAKKILGA 1997          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q2WGJ9|FR1L6_HUMAN (Fer-1-like protein 6 OS=Homo sapiens OX=9606 GN=FER1L6 PE=2 SV=2)

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 411/1157 (35.52%), Postives = 628/1157 (54.28%), Query Frame = 3
Query:  669 AATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNE--GDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVL---RSESGGLPAGAKVYSVP----------------PISDGTCG-------------------------KKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS--------EANEEEEKEVPSVNQGN---RPKIPKWCHSTTEPMLP--DTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAI--RLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY----SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIK------------GKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAI 3908
            +A+  R   +   +H    +++++QI+IT+ EARQL G NI+P++ + IG++ K + V+  TNSP+YN+Y  F+F   +  LFD++I++           +L+   LIG F++D+ TVYN P H F +KWA+L DP DI +G KGY+K D+++MGKG+ +K  PK+       + +E IE NLL+P       +R  A   V++YKAE LP+MN+ IMA +  A  GDSK LVDPFV+VSFAG  GRT V+KN   P W+E+++F EMFP LC R+++ V+D  ++ +  +ATH+IDL +I NE  GD GFLPTFGP+W+NLYG+PRN++   +M   +E+N G GEGV++RGR+L+ I   +   R++        K   +P                   DG                            K E FLL GAF+EA++ID +IG K  PI FE+S+G  GN +D          A   EE  +P +++G       +P    STT P  P     ++ Y +L F  KKPC+Y IS   D   R    N+LEK+ +    ++E + EL    +     +MK  L  FI    + ++  +    +  +T LDK+R+ L    LE M  +AK + Q   K  L++   + E +  ++K+  L+  PQ+ +PD+FIW++ + +R+A+ARI ++++LYS +  + G    ++ T FL+ PG+    P+GW++Q ++ +YLWLG ++        LP+GY    S+       PP  ++Y E+  FQLRAHM+ AR LI +D +GLSD FA++    H  TTK++ +TLSP W+Q L+ + ++ +     +  +PP++VVE++D D +        GK E+LG     P V L +++Y+ PRL +  I+ G ++ G+LLA FEL+QV P       +G+Q +                                      P E   +T     + PVP  IRP L  YRVE LFWGVREM++VQL+SVD+P+  IE G   + S VI S K  PNFS      ++ LPEN L  PPL I   D R FGR+ L+G + I+ + +++ K            G  P  + +  +    SS    ++ + P D I +
Sbjct:   60 SASPKRRSKLLTKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKISVFH------HKLIGSVLIGSFKVDLGTVYNQPGHQFCNKWALLTDPGDIRTGTKGYLKCDISVMGKGDVLKTSPKT------SDTEEPIEKNLLIPNGFPL--ERPWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCADPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALKELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFLLFGAFFEATMIDRKIGDK--PISFEVSIGNFGNLIDGGSHHGSKKSAESAEEDLLPLLHEGQGDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEKMKTVLSDFISRSSAFISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQ-QKKKLSVDEMIHEAQNFVEKIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPGK---RPAGWSVQAKVDVYLWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVVELYDSDAV--------GKPEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVPP-------SGLQGL-------------------------------------PPVEPPDITQ----IYPVPANIRPVLSKYRVEVLFWGVREMKKVQLLSVDRPQALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINYLKQFLCKLREPLAPITQVDGTQPGHDISDSLTATESSGAHSSSQDPPADHIYV 1137          

HSP 2 Score: 555.058 bits (1429), Expect = 7.107e-163
Identity = 282/591 (47.72%), Postives = 396/591 (67.01%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD-NRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEI-EEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
             ++Y   LE   EF  F  +++TF L +G+  +D+   D +R++G FKG+  IYK   +    +    +L + + +P N PV +L+R+Y++ A +L PADP+GKSDPY++++LG   I +++ YIPKQLNP+FG+ FE+   FP+ES L I + D D++  DD+IGETKIDLENR+YSKH+A+CGL   +E  GYN WRD   PT +L KLCK+   D P +     K+ +    F       EED  E  +S E LAL+V+ +W  +P  GC LVPEH+ETRPL++ +KPG++QG L+MW+DMFPK++  P  P+DI+PR+P  YELRV IWNTEDVIL D  + TG+KSSDI+VKGW+KGL  D Q TDVHY SL+GEGNFNWRF+F F Y+ AE ++V   +++ F++++ E K+P  L LQVWD + +++DDFLG LE+ L+  PR AKS + C L +       + ISIF+ KR RGWWPF+       K  ++ GK++AEF L++ EE E  PVG  R EP  L  PNRPD+SF  FM+P K L YLI   +K ++I A I+  L+  LVLFIY  PG +++R++
Sbjct: 1277 LQIYDGDLE--SEFNNFEDWVKTFELFRGKSTEDDHGLDGDRVIGKFKGSFCIYKSPQDSSSEDSG--QLRIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFHP--GKIQIGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDIPEVGCRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEETKISIFQQKRVRGWWPFS-------KSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKNYKKYIIIAFILIILIIFLVLFIYTLPGAISRRIV 1854          
BLAST of Otoferlin vs. TrEMBL
Match: A0A1I8G049 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1459.12 bits (3776), Expect = 0.000e+0
Identity = 715/1304 (54.83%), Postives = 926/1304 (71.01%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISID--SHGMGSDKRTLIDPQTGEIGEFNYGQTDNE-SIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTM-YQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTG-LRSNQKGKSEFLGRCFCKPTVALEE---EEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV----IKGKIPTEEPAKKVITNTSSPNQQNNLETP--------EDKIAIPAIIEGVDNPAYI 3947
            MAL+LN++ ++ LD + +R++K  FRD  +T+    G+DS+YFG+QF+WP+GR+++  D LE+R+Y +SKYL NK+IGS+TISLQ+L+ +  +  +E LID+NHS +R T+ FE+ YYSPDSQI DWRQDEF+ P+   +   A +   D  S    SD ++LI      +      Q D   S+ +GEDD S      +TLGVP+ L PTLHK ED+Q+S+T+IEA+QL+GANINP IEVR+G++ K TE+QMSTNSPYYNQY  FEFHMSK+ELFDQVI +R L  G M ISRL  GDLIGEFR+DVRTVYNA DHMF HKWA L+DPKDIL G KGYVK D+ ++GKGEQ+K + + +      ND+EDIEANLLLP  +    KRQ AEI V+IY+AEDLP+MNTD MATIK AITGDSKPL DP+VQVSFAGH+G+TK KKNTY P+WNE IVFTEMFP LCNR+R+SVYDWDTV+NECIATH+IDL+QIMN+ ++GF+PTFGPSW+NLYGTPRNY+Y+ M+ PKEELN GLGEGVAYRGRLL+AIKT +++++ GL +GA+V S  P+ D   GKKE FLL+G  YEA  ID+EIGKK +P+ FELS+GT GNR+D   NE  E +    +   +  +P WCHS + PM P     EY+H+ FNEKKPCLYM   +EDH+ R FIPNILEKL  +F   +E + EL   E+RG   R++ AL T ++N+E +  +I+  R  + KTLLD +R K  +V LEKM++KAK+M  Q  +  N++ RLKECRA++K L +L  +PQ+ LPD+F+WLI D +R+AFARIPAR+IL+S   EEKG    +VVT+FL+KPGR GMG  GW+LQ QLKMYLWLGLL+D+K ++  +P GY  D FK+RRPP EI+YTEKSYF+ RA++FMARNLIGSDESGLSDAFARI++ND VVTT V+ E+LSP WD+T+I+  ++FY ++  +  +PPV+VVE+FDEDQ+T  L   Q GKSEFLGRCFCKP V L     + Y+ PRL WWEIYRGQ+NAGELLAAFELIQ+         +G + +   + ++                            D+ P+E           +PVP  IRP+L  YR+E LFWGVRE+ ++Q  SV+ P++T+EFG   L SD+I SCK KPNF N +K +D+MLPEN  YWPPLM QCED RQFGRT+L+GNHVI++V KY+     + K      A K    T++P ++ +             D  A     EG DN AY+
Sbjct:    1 MALILNVRLLEGLDGKGERLLKATFRDNVQTSNAASGRDSVYFGQQFKWPVGRRIEITDVLEIRVYNFSKYLANKMIGSLTISLQQLVHESSLKLREQLIDANHSTMRATLDFEINYYSPDSQIGDWRQDEFDYPVPPMRPGAAGEDQEDNASRISFSDAQSLIKENRNMLA---LAQGDEAGSLMTGEDDASLGNAMRKTLGVPVVLDPTLHKMEDYQLSVTIIEAKQLSGANINPCIEVRVGDRVKRTEIQMSTNSPYYNQYFPFEFHMSKSELFDQVIHIRALNKGTMMISRLFSGDLIGEFRLDVRTVYNAQDHMFFHKWACLIDPKDILGGPKGYVKCDINVIGKGEQMKTQTRKSK----SNDEEDIEANLLLPSGVPI--KRQNAEISVRIYRAEDLPKMNTDFMATIKQAITGDSKPLADPYVQVSFAGHSGKTKSKKNTYDPQWNEAIVFTEMFPPLCNRVRISVYDWDTVYNECIATHFIDLNQIMNDAESGFMPTFGPSWINLYGTPRNYSYENMIHPKEELNLGLGEGVAYRGRLLMAIKTEVKTDNSGLTSGARVASTHPVPDTVAGKKEDFLLVGVIYEAGAIDAEIGKKAKPLAFELSIGTYGNRIDGNFNEAFEDDEEDTDPNRKKILPMWCHSVSHPMTPTLTQNEYYHVPFNEKKPCLYMRCNYEDHRPRMFIPNILEKLYTQFEMEIEEMQELVNREKRGVLKRLQRALQTLLDNLEKASLAIRSCRGSAGKTLLDMQRQKTIRVQLEKMKIKAKSMRAQLISSDNVSGRLKECRALVKLLRDLSVDPQHALPDVFVWLIADGQRLAFARIPARQILHSLSEEEKGKDCGKVVTLFLRKPGRKGMGQGGWSLQCQLKMYLWLGLLKDIKHYRTTVPEGYVVDTFKYRRPPSEIVYTEKSYFEFRAYIFMARNLIGSDESGLSDAFARIIINDQVVTTHVIEESLSPMWDRTMIVSPVVFYLNEVTVQDHPPVIVVEIFDEDQVTSVLGGQQTGKSEFLGRCFCKPLVTLYNGPGDTYRPPRLDWWEIYRGQLNAGELLAAFELIQL---------DGDKCLPDFVPTAD---------------------------DLRPHEIEVEEGRQPEFIPVPPAIRPNLAHYRIEILFWGVRELAKIQFQSVESPKVTMEFGGKQLQSDMIESCKAKPNFPNNIKCLDLMLPENRWYWPPLMFQCEDCRQFGRTVLVGNHVIASVLKYIRRDETEKKASNFSMASKATVTTAAPQKRKSRTMSLRKKFGLFSDSKAKLLGSEGFDNLAYL 1259          

HSP 2 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 446/752 (59.31%), Postives = 564/752 (75.00%), Query Frame = 3
Query: 4422 KDELQDIDWWSRYYVX--------------------------------XXXXXXXXXXXXXXXNLDVLKDIEVDVKSD-DDQGGLAEIPEDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIFAKLPFGRVXXXXXXXXXXXXXXXXXXXNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXX-HKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
            KD+LQD+DWWSR+Y +                                +     D  ++ S+ ++D+LKDI+V++KS+ DD+ GL EIPE +E+    KKKKKK+ KK K  K KKK   +    KLPF +   A+   E+ D+   E     + + ++ I R K+Y  PLEEVK+F GF    ++FP+ +G+Q+DD+E S++R+VG FKGN+ IY++ + EF   V +  + +LYK LP+NDP+ +LVRIYVIR  DLHPADPNGKSDPYLL+RLG   INEKENYIPKQLNP+FGKCFE+D KFPQESNL I VMDWD++SGDD+IGETKIDLENR++SKH+A CGL   + + GYNKWRD Q P+++L KLC+++  + PKYE   N+VT+  + FY   EIE++ G+K QSNEPLAL+V+ NW  V  G  LVPEH+ETRPLF  EKPGI+QG +EMW+DMFPKELG PP P+DI PR+P+SYELRVIIW+TE+V L+D G+ TGE SSDIFVKGWMKGLGIDDQVTDVHYRSL+GEGNFNWRF+F FDY+KAEDKIVYK+KDSPFAIDE E KS CKLYLQVWDAD+V++DDFLGGL+LILSKIPRGAKS + C    L K+  V T SIF+NKR RGWWPF GE+EDDP E ++ GK+DAE QLL+  E EA P GLGR+EP  LP PNRP++SFL+ +NPLK++KYL+C K+KW LIK LII+ L A+LVLFIY++PGYLAKR++
Sbjct: 1497 KDDLQDLDWWSRFYATIDDLEDQDFRQKIKPGTALLSFAVGARMMYSKLATAQQDEDDEESNEDVDILKDIDVEIKSEADDKAGLVEIPEGDEEDDDKKKKKKKKGKKDKKDKKKKKKKPR----KLPFKKDARAEYLAEKDDELSYEVG---QQEDNSWISRIKIYQNPLEEVKDFGGFEQTFKSFPIYRGKQEDDDEPSESRVVGTFKGNICIYQISENEFRNPVAMPSQFVLYKDLPSNDPISVLVRIYVIRCIDLHPADPNGKSDPYLLIRLGGTTINEKENYIPKQLNPVFGKCFEIDAKFPQESNLQILVMDWDMLSGDDLIGETKIDLENRFFSKHRATCGLPLEYASAGYNKWRDQQPPSVILNKLCRDFKLEAPKYEPNYNRVTINGITFYEHVEIEDETGKKTQSNEPLALKVLNNWDSV-TGVALVPEHIETRPLFTPEKPGIEQGRIEMWVDMFPKELGVPPAPLDITPRKPMSYELRVIIWDTEEVKLNDTGI-TGEASSDIFVKGWMKGLGIDDQVTDVHYRSLTGEGNFNWRFVFQFDYLKAEDKIVYKVKDSPFAIDEEEKKSMCKLYLQVWDADIVSSDDFLGGLDLILSKIPRGAKSAKACDSFLLEKESGVKTFSIFRNKRCRGWWPFIGESEDDPNEKELGGKVDAELQLLTAAEAEANPAGLGRSEPQPLPPPNRPETSFLSILNPLKAIKYLVCVKYKWLLIKLLIITLLAAILVLFIYSSPGYLAKRLM 2239          
BLAST of Otoferlin vs. TrEMBL
Match: A0A267FUJ1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021872g3 PE=4 SV=1)

HSP 1 Score: 1328.54 bits (3437), Expect = 0.000e+0
Identity = 650/1266 (51.34%), Postives = 869/1266 (68.64%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISI-----DSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGD-TGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPE-EKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALE----EEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSS 3860
            M L+L +  ++ LD + +R +KI FRD  + + VV G+DS+   ++F+WP+ R ++  D L+ RLY +SK+L NKLIG++TISLQ+LL+  ++   E LID+NHS  R+++ F++ Y++P SQ  DW Q++F          + D+        +   + +  R+ +D  +  +     G  D  S   G+          ++LGVP+ L PTLHK ED+Q+S+TVIEA+QL+GANINP IEV +G++ + TE+QMSTNSPYYNQY  +EFHMSK ELFDQVI +R +  G M ISRLLPGDLIGEFR+DVR+VYNAPDH F HKWA L+DPKDIL G KGYVK D+ ++GKGEQ K  PK +      +DD+DIEANLLLP  +    KRQM E+ VKIY+AEDLPRMNTDIMAT+K A TGDSKPL+DP+VQVSFAGHTGRTK KKNTY P+WNE ++FTEMFP LCNRIR+SV+D D V +ECIATH++DL+QIMN  D  GFLPTFGPSWVNLYGTPR Y+Y+  MR KEELN GLGEGVAYRGRLL+A+KT L++++  L AGA+V +  P+ +   G +E FLL+G  YEA  +D EIG K +P+ FELS+GT G     + NE   ++        +   P WCHS +    P     EY+H+ FNE+KPCLYM   +EDH+ R F+ NILEKL  +F   +E + EL   ERRG   R+++AL +F E ++++   ++  +    +TLLD +R +  ++ LEKM+VK K M    T  ++ +RLKECRA+ + L + + + Q+ LPD+F+WL+ + +R+AFAR+PAR+IL+SA  E E+G     VVT+FL+KPGR G G +GW+LQ QLKMYLWLGLL+DM+ ++  +P GY    FK+RRPP EI+YTE+S F+ RA++FMARNLIGSDESGLSDAFAR++VND + TT V+ E+LSP WD+TL ++ +IFY+++  +   PPV+VVE+FD+D +         K EFLGRCFCKP V L      E Y+ PRL WWEIYRGQ+NAGELLAAFELIQ+ P  G   A     +E + R+  P+           +E          +G   P+            +PVP  IRP L  YR+E LFWGVRE+ +VQ  SV+ P++T+EFG   L+SDVI SC+ KPNF N +K++D++LPEN  YWPPLM QCED RQFGRT+L+GNHVIS+VTKY+ +     EE  K V+++T S
Sbjct:    1 MTLILTVNRLEGLDGKGERQLKIRFRDSVQNSAVVNGRDSVEVNQEFKWPLARSIEIADVLDFRLYNFSKFLANKLIGTLTISLQQLLQASRLHLCERLIDANHSTTRVSLDFDIAYHTPGSQPDDWLQEDFFGVTRGESRDELDEAETRLLLQEREALEALHRSGLDETS--VNSAAMGNDDAASSTGGD-----GGAMRKSLGVPVVLDPTLHKLEDFQLSVTVIEAKQLSGANINPCIEVCVGDQVQRTEIQMSTNSPYYNQYFAYEFHMSKWELFDQVIHIRAINKGTMMISRLLPGDLIGEFRLDVRSVYNAPDHSFFHKWACLIDPKDILGGPKGYVKCDINVIGKGEQAKETPKKSKP----SDDDDIEANLLLPMGVSV--KRQMVELAVKIYRAEDLPRMNTDIMATLKHAFTGDSKPLIDPYVQVSFAGHTGRTKSKKNTYDPQWNEAVIFTEMFPPLCNRIRISVFDSDPVHSECIATHFVDLNQIMNSSDNAGFLPTFGPSWVNLYGTPRGYSYENAMRQKEELNLGLGEGVAYRGRLLMAVKTDLKTDTASLVAGARVSATQPVPENVAGMREDFLLVGIIYEAGAMDEEIGSKGKPVSFELSIGTYGYDPGGKTNEALLEDEEDTGSTVKKSAPMWCHSVSPGRAPRLTRDEYYHVPFNERKPCLYMRCCYEDHRPRLFVSNILEKLCCQFEQDIEDVQELVSRERRGVLSRLQSALQSFAEALDTAAADLRACKGTGGRTLLDMQRQRQLRLMLEKMKVKLKAMRSQLTTDSVPVRLKECRALARLLRDSLLDQQHSLPDVFVWLLCEGQRLAFARVPARQILHSATSEAERGKDCGRVVTLFLRKPGRKGAGQAGWSLQCQLKMYLWLGLLKDMRNYRGTVPEGYQATTFKYRRPPNEIVYTERSLFEFRAYLFMARNLIGSDESGLSDAFARVIVNDQIATTHVISESLSPMWDRTLAVNPVIFYFNEQTVKDQPPVVVVEIFDDDDVA--IKMPFDKPEFLGRCFCKPMVTLATSALREPYRPPRLDWWEIYRGQLNAGELLAAFELIQLDPATGQTPAFA-PSLEDLRRAPIPV-----------EEQDDGGDGDSADGGRKPD-----------WIPVPASIRPRLARYRIEILFWGVRELAKVQFQSVESPKVTVEFGGRQLVSDVINSCRAKPNFPNSIKFLDLLLPENKWYWPPLMFQCEDNRQFGRTVLVGNHVISSVTKYIKR-----EETEKTVVSDTQS 1223          
BLAST of Otoferlin vs. TrEMBL
Match: A0A267GRG1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021872g1 PE=4 SV=1)

HSP 1 Score: 1321.22 bits (3418), Expect = 0.000e+0
Identity = 651/1266 (51.42%), Postives = 873/1266 (68.96%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADD-----ISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGD-TGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPE-EKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALE----EEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSS 3860
            M L+L +  ++ LD + +R +KI FRD  + + VV G+DS+   ++F+WP+ R ++  D L+ RLY +SK+L NKLIG++TISLQ+LL+  ++   E LID+NHS  R+++ F++ Y++P SQ  DW Q++F          + D+     +  +   + + +R+ +D  +  +     G  D  S   G+          ++LGVP+ L PTLHK ED+Q+S+TVIEA+QL+GANINP IEV +G++ + TE+QMSTNSPYYNQY  +EFHMSK ELFDQVI +R +  G M ISRLLPGDLIGEFR+DVR+VYNAPDH F HKWA L+DPKDIL G KGYVK D+ ++GKGEQ K  PK+  K    +DD+DIEANLLLP  +    KRQM E+ VKIY+AEDLPRMNTDIMAT+K A TGDSKPL+DP+VQVSFAGHTGRTK KKNTY P+WNE ++FTEMFP LCNRIR+SV+D D V++ECIATH++DL+QIMN  D  GFLPTFGPSWVNLYGTPR Y+Y+  MR KEELN GLGEGVAYRGRLL+AIKT L++++  L AGA+V +  P+ +   G +E FLL+G  YEA  +D EIG K +P+ FELS+GT G     + NE   ++        +   P WCHS +    P     EY+H+ FNE+KPCLYM   +EDH+ R F+ NILEKL  +F   +E + EL   ERRG   R+++AL +F E ++++   ++  +    +TLLD +R +  ++ LEKM+VK K M    T  ++ +RLKECRA+ + L + + + Q+ LPD+F+WL+ + +R+AF+R+PAR+IL+SA  E E+G     VVT+FL+KPGR G G +GW+LQ QLKMYLWLGLL+DM+ ++  +P GY    FK+RRPP EI+YTE+S F+ RA++FMARNLIGSDESGLSDAFAR++VND + TT V+ E+LSP WD+TL ++ +IFY+++  +   PPV+VVE+FD+D +         K EFLGRCFCKP V L      E Y+ PRL WWEIYRGQ+NAGELLAAFELIQ+ P  G   A     +E + R+  P+           +E          +G   P+            +PVP  IRP L  YR+E LFWGVRE+ +VQ  SV+ P++T+EFG   L+SDVI SC+ KPNF N +K++D++LPEN  YWPPLM QCED RQFGRT+L+GNHVIS+VTKY+ +     EE  K V+++T S
Sbjct:    1 MTLILTVNRLEGLDGKGERQLKIRFRDSVQNSAVVNGRDSVEVNQEFKWPLARSIEIADVLDFRLYNFSKFLANKLIGTLTISLQQLLQASRLHLCERLIDANHSTTRVSLDFDIAYHTPGSQPDDWLQEDFFGVTRGESRDELDEAETRLLQQEREALEALQRSGLDETS--VNSAAMGNDDAASSTGGD-----GGAMRKSLGVPVVLDPTLHKLEDFQLSVTVIEAKQLSGANINPCIEVCVGDQVQRTEIQMSTNSPYYNQYFAYEFHMSKWELFDQVIHIRAINKGTMMISRLLPGDLIGEFRLDVRSVYNAPDHSFFHKWACLIDPKDILGGPKGYVKCDINVIGKGEQAKDAPKTPKKSKP-SDDDDIEANLLLPMGVSV--KRQMVELAVKIYRAEDLPRMNTDIMATLKHAFTGDSKPLIDPYVQVSFAGHTGRTKSKKNTYDPQWNEAVIFTEMFPPLCNRIRISVFDSDPVYSECIATHFVDLNQIMNSSDNAGFLPTFGPSWVNLYGTPRGYSYENAMRQKEELNLGLGEGVAYRGRLLMAIKTDLKTDTASLVAGARVSATQPVPENVAGMREDFLLVGIIYEAGAMDEEIGSKGKPVSFELSIGTYGYDPGGKTNEALLEDEEDTGSTVKKSAPMWCHSVSPGRAPRLTRDEYYHVPFNERKPCLYMRCCYEDHRPRLFVSNILEKLCCQFEQDIEDVQELVSRERRGVLSRLQSALQSFAEALDTAAADLRACKGTGGRTLLDMQRQRQLRLMLEKMKVKLKAMRSQLTTDSVPVRLKECRALARLLRDSLLDQQHSLPDVFVWLLCEGQRLAFSRVPARQILHSATSEAERGKDCGRVVTLFLRKPGRKGAGQAGWSLQCQLKMYLWLGLLKDMRNYRGTVPEGYQATTFKYRRPPNEIVYTERSLFEFRAYLFMARNLIGSDESGLSDAFARVIVNDQIATTHVISESLSPMWDRTLAVNPVIFYFNEQTVKDQPPVVVVEIFDDDDVA--IKMPFDKPEFLGRCFCKPMVTLATSALREPYRPPRLDWWEIYRGQLNAGELLAAFELIQLDPATGQTPAFA-PSLEDLRRAPIPV-----------EEQDDGGDGDSADGGRKPD-----------WIPVPASIRPRLARYRIEILFWGVRELAKVQFQSVESPKVTVEFGGRQLVSDVINSCRAKPNFPNSIKFLDLLLPENKWYWPPLMFQCEDNRQFGRTVLVGNHVISSVTKYIKR-----EETEKTVVSDTQS 1226          

HSP 2 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 423/728 (58.10%), Postives = 542/728 (74.45%), Query Frame = 3
Query: 4404 KKAKIPKDELQDIDWWSRYYVXXXXXXXXXXXXXXXX-NLDVLKDIEVDVKSD-DDQGGLAEIPEDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIFAKLPFGRVXXXXXXXXXXXXXXXXXXXNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            KK    K+E QD+DWWSRYYV+ EDL+      +    N D+L+DI+VD+KSD  D+ G+ EIPE E +  K KKKKKK+KKKKK KK +       +   LPFG      +     + DD    + V PD ++ I R ++Y CPLE+V EF GF    +TFP+ +G+Q+DD+E S++R VG FKGN+ IY++   E           L+K LP+N+P+ ++VR+Y++R  DLHPADPNGKSDPYL+++LGN  INEKENYIPKQLNP+FGKCFE+D KFPQESNLL+ VMDWD++S DD+IGETKIDLENR +SKH+A CGL   +   GYNKWRD QLP+ +LA+ C+E+G +PP YE   N+VTV     Y  A+ E++ G   +SNEPLAL+ + +W  +  G  LVPEH+ETRPLF  EKPGI+QG +EMW+D+FPKELG PP  +DI PRQP+SYELRVIIW+TE+V L+D G LTGE SSDIFVKGWMKGLGIDDQVTDVHYRSL+GEGNFNWRFIF FDY+KAEDKIVY++KDS FAIDE E K+ C+L LQVWDAD+V++DDFLGGLEL LSK+PRGAK  + CG   L+KD  V T S+F NKR RGWWPF GE ++D  E ++ GK+D E QLL+  E EA P GLGR EP  +P PNRP+S+F+N +NPLK+L  L+ ++FKW L+K LI+S ++A+L LFIY++PGY+AK+++GA
Sbjct: 1412 KKLPPSKEEEQDLDWWSRYYVTNEDLNQQEDVQAESDDNDDILRDIDVDIKSDAGDREGIVEIPEGEPEDDKKKKKKKKKKKKKKKKKKR------SLRQMLPFG---IDARSQYLAEKDDEIAFEGVHPDDNSWISRLRIYQCPLEDVPEFGGFEHLFRTFPIYRGKQEDDDEPSESREVGAFKGNICIYRLKPGESHRP---KNFALHKDLPSNEPLSVMVRVYIVRCIDLHPADPNGKSDPYLIIKLGNTTINEKENYIPKQLNPVFGKCFEIDAKFPQESNLLVVVMDWDMLSEDDLIGETKIDLENRLFSKHRATCGLPLEYSCTGYNKWRDQQLPSAILARQCREFGLEPPHYEPNYNRVTVGGQTLYEHADTEDETGRIIKSNEPLALKALCSWESI-TGVPLVPEHIETRPLFTPEKPGIEQGRIEMWVDLFPKELGTPPAAVDITPRQPVSYELRVIIWDTEEVPLNDTGGLTGEASSDIFVKGWMKGLGIDDQVTDVHYRSLNGEGNFNWRFIFKFDYLKAEDKIVYRVKDSLFAIDEEEKKAMCRLNLQVWDADIVSSDDFLGGLELSLSKMPRGAKLAKACGTFLLDKDSGVKTFSLFHNKRCRGWWPFLGEADEDSNERELAGKVDVELQLLTAAEAEANPAGLGREEPQPMPPPNRPESTFMNMLNPLKALA-LMWHRFKWVLLKLLIVSLIVAILALFIYSSPGYIAKKIIGA 2125          
BLAST of Otoferlin vs. TrEMBL
Match: A0A267H7D0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001532g2 PE=4 SV=1)

HSP 1 Score: 1243.41 bits (3216), Expect = 0.000e+0
Identity = 593/1010 (58.71%), Postives = 768/1010 (76.04%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISID--SHGMGSDKRTLIDPQTGEIGEFNYGQTDNE-SIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTM-YQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQK 3113
            MAL+LN++ ++ LD + +R++K  FRD  +T+    G+DS+YFG+QF+WP+GR+++  D LE+R+Y +SKYL NK+IGS+TISLQ+L+ +  +  +E LID+NHS +R T+ FE+ YYSPDSQI DWRQDEF+ P+   +   A +   D  S    SD ++LI      +      Q D   S+ +GEDD S      +TLGVP+ L PTLHK ED+Q+S+T+IEA+QL+GANINP IEVR+G++ K TE+QMSTNSPYYNQY  FEFHMSK+ELFDQVI +R L  G M ISRL  GDLIGEFR+DVRTVYNA DHMF HKWA L+DPKDIL G KGYVK D+ ++GKGEQ+K +PK+ T+K K ND+EDIEANLLLP  +    KRQ AEI V+IY+AEDLP+MNTD MATIK AITGDSKPL DP+VQVSFAGH+G+TK KKNTY P+WNE IVFTEMFP LCNR+R+SVYDWDTV+NECIATH+IDL+QIMN+ ++GF+PTFGPSW+NLYGTPRNY+Y+ M+ PKEELN GLGEGVAYRGRLL+AIKT +++++ GL +GA+V S  P+ D   GKKE FLL+G  YEA  ID+EIGKK +P+ FELS+GT GNR+D   NE  E +    +   +  +P WCHS + PM P     EY+H+ FNEKKPCLYM   +EDH+ R FIPNILEKL  +F   +E + EL   E+RG   R++ AL T ++N+E +  +I+  R  + KTLLD +R K  +V LEKM++KAK+M  Q  +  N++ RLKECRA++K L +L  +PQ+ LPD+F+WLI D +R+AFARIPAR+IL+S   EEKG    +VVT+FL+KPGR GMG  GW+LQ QLKMYLWLGLL+D+K ++  +P GY  D FK+RRPP EI+YTEKSYF+ RA++FMARNLIGSDESGLSDAFARI++ND VVTT V+ E+LSP WD+T+I+  ++FY ++  +  +PPV+VVE+FDEDQ+T +   Q+
Sbjct:    1 MALILNVRLLEGLDGKGERLLKATFRDNVQTSNAASGRDSVYFGQQFKWPVGRRIEITDVLEIRVYNFSKYLANKMIGSLTISLQQLVHESSLKLREQLIDANHSTMRATLDFEINYYSPDSQIGDWRQDEFDYPVPPMRPGAAGEDQEDNASRISFSDAQSLIKENRNMLA---LAQGDEAGSLMTGEDDASLGNAMRKTLGVPVVLDPTLHKMEDYQLSVTIIEAKQLSGANINPCIEVRVGDRVKRTEIQMSTNSPYYNQYFPFEFHMSKSELFDQVIHIRALNKGTMMISRLFSGDLIGEFRLDVRTVYNAQDHMFFHKWACLIDPKDILGGPKGYVKCDINVIGKGEQMKSRPKTQTRKSKSNDEEDIEANLLLPSGVPI--KRQNAEISVRIYRAEDLPKMNTDFMATIKQAITGDSKPLADPYVQVSFAGHSGKTKSKKNTYDPQWNEAIVFTEMFPPLCNRVRISVYDWDTVYNECIATHFIDLNQIMNDAESGFMPTFGPSWINLYGTPRNYSYENMIHPKEELNLGLGEGVAYRGRLLMAIKTEVKTDNSGLTSGARVASTHPVPDTVAGKKEDFLLVGVIYEAGAIDAEIGKKAKPLAFELSIGTYGNRIDGNFNEAFEDDEEDTDPNRKKILPMWCHSVSHPMTPTLTQNEYYHVPFNEKKPCLYMRCNYEDHRPRMFIPNILEKLYTQFEMEIEEMQELVNREKRGVLKRLQRALQTLLDNLEKASLAIRSCRGSAGKTLLDMQRQKTIRVQLEKMKIKAKSMRAQLISSDNVSGRLKECRALVKLLRDLSVDPQHALPDVFVWLIADGQRLAFARIPARQILHSLSEEEKGKDCGKVVTLFLRKPGRKGMGQGGWSLQCQLKMYLWLGLLKDIKHYRTTVPEGYVVDTFKYRRPPSEIVYTEKSYFEFRAYIFMARNLIGSDESGLSDAFARIIINDQVVTTHVIEESLSPMWDRTMIVSPVVFYLNEVTVQDHPPVIVVEIFDEDQVTSVLGGQQ 1005          
BLAST of Otoferlin vs. TrEMBL
Match: A0A1I8H3Y7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 588/1067 (55.11%), Postives = 758/1067 (71.04%), Query Frame = 3
Query:  687 TLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXX---XXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGD-TGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPE-EKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALE----EEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSS 3860
            +LGVP+ L PTLHK ED+Q+S+TVIEA+QL+GANINP IEV +G++ + TE+QMSTNSPYYNQY  +EFHMSK ELFDQVI +R +  G M ISRLLPGDLIGEFR+DVR+VYNAPDH F HKWA L+DPKDIL G KGYVK D+ ++GKGEQ K     A    KK K +DD+DIEANLLLP  +    KRQM E+ VKIY+AEDLPRMNTDIMAT+K A TGDSKPL+DP+VQVSFAGHTGRTK KKNTY P+WNE ++FTEMFP LCNRIR SV+D D V +ECIATH++DL+QIMN  D  GFLPTFGPSWVNLYGTPR Y+Y+  MR KEELN GLGEGVAYRGRLL+AIKT L++++  L AGA+V +  P+ +   G +E FLL+G  YEA  +D EIG K +P+ FELS+GT G     + NE   ++        +   P WCHS +    P     EY+H+ FNE+KPCLYM   +EDH+ R F+ NILEKL  +F   +E + EL   ERRG   R+++AL +F E ++++   ++  +    +TLLD +R +  ++ LEKM+VK K M    T  ++ +RLKECRA+ + L + + + Q+ LPD+F+WL+ + +R+AF+R+PAR+IL+SA  E E+G     VVT+FL+KPGR G G +GW+LQ QLKMYLWLGLL+DM+ ++  +P GY    FK+RRPP EI+YTE+S F+ RA++FMARNLIGSDESGLSDAFAR++VND + TT V+ E+LSP WD+TL ++ +IFY+++  +   PPV+VVE+FD+D +         K EFLGRCFCKP V L      E Y+ PRL WWEIYRGQ+NAGELLAAFELIQ+ P  G   A     +E + R+  P+           +E          +G   P+            +PVP  IRP L  YR+E LFWGVRE+ +VQ  SV+ P++T+EFG   L+SDVI SC+ KPNF N +K++D++LPEN  YWPPLM QCED RQFGRT+L+GNHVIS+VTKY+ +     EE  K V+++T S
Sbjct:    1 SLGVPVVLDPTLHKLEDFQLSVTVIEAKQLSGANINPCIEVCVGDQVQRTEIQMSTNSPYYNQYFAYEFHMSKWELFDQVIHIRAINKGTMMISRLLPGDLIGEFRLDVRSVYNAPDHSFFHKWACLIDPKDILGGPKGYVKCDINVIGKGEQAKASAGDANLTPKKSKPSDDDDIEANLLLPMGV--SVKRQMVELAVKIYRAEDLPRMNTDIMATLKHAFTGDSKPLIDPYVQVSFAGHTGRTKSKKNTYDPQWNEAVIFTEMFPPLCNRIRFSVFDSDPVHSECIATHFVDLNQIMNSSDNAGFLPTFGPSWVNLYGTPRGYSYENAMRQKEELNLGLGEGVAYRGRLLMAIKTDLKTDTASLVAGARVSATQPVPENVAGMREDFLLVGIIYEAGAMDEEIGSKGKPVSFELSIGTYGYDPGGKTNEALLEDEEDTGSTVKKSAPMWCHSVSPGRAPRLTRDEYYHVPFNERKPCLYMRCCYEDHRPRLFVSNILEKLCCQFEQDIEDVQELVSRERRGVLSRLQSALQSFAEALDTAAADLRACKGTGGRTLLDMQRQRQLRLMLEKMKVKLKAMRSQLTTDSVPVRLKECRALARLLRDSLLDQQHSLPDVFVWLLCEGQRLAFSRVPARQILHSATSEAERGKDCGRVVTLFLRKPGRKGAGQAGWSLQCQLKMYLWLGLLKDMRNYRGTVPEGYQATTFKYRRPPNEIVYTERSLFEFRAYLFMARNLIGSDESGLSDAFARVIVNDQIATTHVISESLSPMWDRTLAVNPVIFYFNEQTVKDQPPVVVVEIFDDDDVA--IKMPFDKPEFLGRCFCKPMVTLATSALREPYRPPRLDWWEIYRGQLNAGELLAAFELIQLDPATGQTPAFA-PSLEDLRRAPIPV-----------EEQDDGGDGDSADGGRKPD-----------WIPVPASIRPRLARYRIEILFWGVRELAKVQFQSVESPKVTVEFGGRQLVSDVINSCRAKPNFPNSIKFLDLLLPENKWYWPPLMFQCEDNRQFGRTVLVGNHVISSVTKYIKR-----EETEKTVVSDTQS 1035          

HSP 2 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 389/668 (58.23%), Postives = 489/668 (73.20%), Query Frame = 3
Query: 4404 KKAKIPKDELQDIDWWSRYYVXXXXXXXXXXXXXXXX-NLDVLKDIEVDVKSD-DDQGGLAEIPEDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIFAKLPFGRVXXXXXXXXXXXXXXXXXXXNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSP 6401
            KK    K+E QD+DWWSRYYV+ EDL+      +    N D+L+DI+VD+KSD  D+ G+ EIPE E +  K KKKKKK+KKKKK +K             LPFG+     +     + DD    + V PD ++ I R ++Y CPLE+V EF GF    +TFP+ +G+Q+DD+E S++R VG FKGN+ IY++   E           L+K LP+N+P+ ++VR+Y++R  DLHPADPNGKSDPYL+++LGN  INEKENYIPKQLNP+FGKCFE+D KFPQESNLL+ VMDWD++S DD+IGETKIDLENR +SKH+A CGL   +   GYNKWRD QLP+ +LA+ C+E+G +PP YE   N+VTV     Y  A+ E++ G   +SNEPLAL+ + +W  +  G  LVPEH+ETRPLF  EKPGI+QG +EMW+D+FPKELG PP  +DI PRQP+SYELRVIIW+TE+V L+D G LTGE SSDIFVKGWMKGLGIDDQVTDVHYRSL+GEGNFNWRFIF FDY+KAEDKIVY++KDS FAIDE E K+ C+L LQVWDAD+V++DDFLGGLEL LSK+PRGAK  + CG   L+KD  V T S+F NKR RGWWPF GE ++D  E ++ GK+D E QLL+  E EA P GLGR EP  +P P
Sbjct: 1221 KKLPPSKEEEQDLDWWSRYYVTNEDLNQQEDVQAESDDNDDILRDIDVDIKSDAGDREGIVEIPEGEPEDDKKKKKKKKKKKKKKKRKRSA-------HCMLPFGK---DARSQYLAEKDDEIAFEGVHPDDNSWISRLRIYQCPLEDVPEFGGFEHLFRTFPIYRGKQEDDDEPSESREVGAFKGNICIYRLKPGESHRP---KNFALHKDLPSNEPLSVMVRVYIVRCIDLHPADPNGKSDPYLIIKLGNTTINEKENYIPKQLNPVFGKCFEIDAKFPQESNLLVVVMDWDMLSEDDLIGETKIDLENRLFSKHRATCGLPLEYSCTGYNKWRDQQLPSAILARQCREFGLEPPHYEPNYNRVTVGGQTLYEHADTEDETGRIIKSNEPLALKALCSWESI-TGVPLVPEHIETRPLFTPEKPGIEQGRIEMWVDLFPKELGTPPAAVDITPRQPVSYELRVIIWDTEEVPLNDTGGLTGEASSDIFVKGWMKGLGIDDQVTDVHYRSLNGEGNFNWRFIFKFDYLKAEDKIVYRVKDSLFAIDEEEKKAMCRLNLQVWDADIVSSDDFLGGLELSLSKMPRGAKLAKACGTFLLDKDSGVKTFSLFHNKRCRGWWPFLGEADEDSNERELAGKVDVELQLLTAAEAEANPAGLGREEPQPMPPP 1874          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 483/1291 (37.41%), Postives = 736/1291 (57.01%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISI-DSHG-----MGSDKRTLIDPQTGEIGEFNYGQTDNESIESG----EDDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVYSVPP--ISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS--------------------------EANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-SNDCFKFRR----PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYV 3800
            MALV+ LK V  L  + DRI K++FR     ++V+   +D   F E F+WP+  K+D  + LE+ +Y YSK   N+LIG+  + LQK++E+  +   + LID N++ I+ ++S E+ Y   D  +  W   EF +   +R++   +  S+  SH        +   +LI     +         D +++  G     D  S A+  A T  V        + + P+  +  D+QIS+TVIEARQL G N++P++ V IGE  K T ++ STN PYYN+Y  F+FH+    +FD++++L  +   N+    L  G L+G F++DV TVY+ P+H F HKWAML DP DI +G KGY+K D+ ++GKG+ +K   K+      + D++DIE NLLLP+ + +  +RQ A   VKIY+AE LP+MNT IMA +K A  G+++ LVDP+VQV FAG  G+T V+K++Y P WNE+I+FTEMFP LC R++V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ RNYT   +M   ++LN GLGEGV++R RLLI++   +L + S  + +  +V   P   IS+   GK E F L G+F EA+++D +IG K  PI FE+++G  GN+LD                           + + +EE E    + G+   +     S+T PM P   D+ YFHL + EKKPC+Y+ S+ +D + R +  NI++K+ ++    +  + E+   E+     R++  L+         +      ++ + +T LD+ER+K     +E M  +AKT+     +  +  +LK     +++L  L   PQ+ +PD+FIW++ + KR+A+ARIP ++IL+S + EE G    +V  VFL+ PG+ G GP+GWT+Q +L+MYLWLGL +  K F  GLP G+  N   K       PP+ + Y  K  FQLRAHM+ AR+L  +D SGLSD FAR+  + H   T+V+ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK+E++GR F KP   + +E Y  PR    L +++IYRG   AGELLAAFEL+Q+ P           R E                        L  ++G  + D  P            ++PVP  IRP L  YR+E LFWG+R+++R+ L  VD+PR+ IE     + S +  + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H ++++ K++
Sbjct:    1 MALVVYLKTVTELRGKGDRIAKVSFRGLSFYSRVLENCEDEARFEEAFRWPVASKVDGNEMLEIHIYNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTSISIEIRYQPMDGSVRVWSDGEFLDVPEEREMFQFETESLLSSHSHICSVCATSVFSLIFSFLDDAAILEMEDLDRKAMRLGGGLDPDTISLASVTAVTTNVSNKRSKPDIKMEPSAGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKLSVIHSKNL----LRSGTLVGTFKLDVGTVYSQPEHQFYHKWAMLSDPDDITAGCKGYIKCDIAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPS--ERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANDGDKGFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISVAVEILDTTSPEIMSSTEVQMEPVSNISESATGKLEEFFLFGSFLEATMVDRKIGDK--PINFEVTIGNYGNQLDGVSKPVSGKKKKREGGGESDEEESELIQNSSDEETE----DDGDLVSV-----SSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERRLRGVLEELSTGCSRFVTLANKDQNQAGRTKLDRERLKSCMREMESMGQQAKTIRSQVKRNTVRDKLKLALNFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPTKDILFSIVDEEMGKDCGKVKAVFLRLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLSGLPNGFEENKAVKGTGLQAVPPISLTYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEATELRDDPPIIVIEIYDQDTV--------GKAEYIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCTAGELLAAFELLQIGP---------AGRTE------------------------LPPIDGPTDVDRGP------------ILPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQVDRPRVDIECAGKGIQSALNQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSLRKFI 1213          

HSP 2 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 320/584 (54.79%), Postives = 419/584 (71.75%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGRQ---DDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            EF+ F  ++ TF L +G+    DD     D+RIVG FKG+L +YK+   +           + +++S+P+NDP+ +LVR+YVIRA DLHPAD NGK+DPY++++LG   I +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENRYYSKH+A CG+   +  HGYN WRD Q PT +LAKLCKE   D P Y     KV VA   F    +IE++NG KKQ+ E LAL  +K+W ++P  GC L+PEH+ETRPL N +KPGI+QG LEMW+DMFP ++ +P   IDI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L +QVWDAD  +ADDFLG +EL L++ PRGAK+ + C +  +  +  + TISIFK KR +GWWPF   +E+D  +L++ GK++AE  L++ EE E  PVGLGRNEP+ L  PNRPD+S + FMNPLKSL+Y I + ++W ++K L +  LL LL LF+Y+ PGYL K++LGA
Sbjct: 1293 EFDHFEDWLHTFNLYRGKAIDDDDQNIVDDDRIVGRFKGSLCMYKLPLSDEITRDVGFDPNMGMFQSIPHNDPINVLVRVYVIRATDLHPADINGKADPYVVIKLGKSEIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSLHGYNVWRDPQKPTQILAKLCKEGKLDGPHY-GPGGKVKVANRIFLGPTDIEDENGLKKQTEEHLALTALKHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRLEMWVDMFPMDVPSPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESLFSWDETEYKIPARLTMQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIDMVLNEQELPTISIFKQKRVKGWWPFVARDEND--DLELTGKVEAELHLMTAEEAEKSPVGLGRNEPDPLEKPNRPDTSLMWFMNPLKSLRYFIWHNYRWLILKTLGLMLLLLLLGLFLYSIPGYLVKKLLGA 1873          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 427/1102 (38.75%), Postives = 637/1102 (57.80%), Query Frame = 3
Query:  654 DDESFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEA--------------NEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-SNDCFKF----RRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSS 3860
            D  S A+  A T  V        + + P   +  D+QIS+TVIE RQL G N++P++ V IG++ K T ++ STN PYYN+Y  F+FH+    +FD++++L  +   N+    L  G ++G F+MDV TVY+  DH F HKWA+L DP DI +G KGYVK D+ ++ KG+ +K   K+      + D++DIE NLLLP+ +    +RQ A   +KIY+AE LP+MNT IMA +K A  G++K L+DP+VQV FAG  G+T V+K+ Y P WNE+IVFTE FP LC R++V + D D V +  + TH+IDL +I N+GD GFLPT GP+WVN+YG+ R+YT   +M   ++LN GLGEGV++R RLL+++   +L + S  +    +V    VP ISD   GK E F L GAF EA++ID +IG K  PI FE+++G  G+ +D                 +EE E    S ++           STT PM P   D+ YFHL + E+KPC+Y+ S+ +D + R +  NI++ + ++    +  + E+   E+     R++  L+       + L      ++ S KT LD+ER+K     LE M  +AKTM     K  +  + K+ +  ++KL  L   PQ+ +PDI+IW+I + KR+A+AR+P+++ILYS + EE G    +V T+F + PG+ G GP+GWT+Q + +MYLWLGL R  K F  GLP G+  N   K       PP+ +IYT K  FQLR H++ AR+L  +D +GLSD FAR+  + H   T+++ ETL P WDQ L+ D++  Y     +  +PP++V+E++D+D +        GK++F+GR F KP   + +E Y  PR    L ++++YRG   AGE+LAAFEL+Q+ P                                                D+ P +G T    G  ++PVP  IRP L  YR+E LFWG+R+++RV L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR  L+G+H ++++ K++ +       P+ K + N S+
Sbjct:  137 DTISLASVTAVTTNVSNKRSKPDIKIEPGAGRPMDFQISVTVIECRQLVGLNMDPVVCVEIGDEKKYTSMKESTNCPYYNEYFVFDFHLPPDVIFDKILKLSVIHSKNL----LRSGTVVGTFKMDVGTVYSQADHQFYHKWAILCDPDDITAGCKGYVKCDIAVVAKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGVPA--ERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGENKDLIDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIVFTEQFPPLCKRMKVQIRDSDKVNDVALGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLVSLAVEILDTSSPEVMCSTEVQVEGVPNISDNAAGKIEEFFLFGAFLEATMIDRKIGDK--PINFEVTIGNYGSEVDDTPTKPKSKKSKKGDGDDEESELIQGSSDEEVTDDGELVSVSTTPPMKPVITDRNYFHLPYFERKPCIYIKSWWQDQRRRLYNANIIDNIADKLEEGLNDVQEIFKTEKAFPERRLRGVLEDLSHGCSNFLELANKDQNQSGKTKLDRERLKSCMRELENMSQQAKTMRTQVKKKTVKDKFKQAQIFLQKLRFLADEPQHSVPDIYIWMISNGKRIAYARVPSKDILYSNVEEETGKDCGKVKTIFFKLPGKKGFGPAGWTVQAKTEMYLWLGLNRQRKDFLSGLPNGFEENKAVKGPGMQSAPPISLIYTMKQIFQLRVHLYQARSLFAADSTGLSDPFARVFFSTHSQVTEILNETLCPTWDQLLVFDNVELYGEACELRDDPPIIVIEIYDQDTV--------GKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQVYRGNCTAGEMLAAFELLQIGPGG--------------------------------------------KADLPPIDGPTDMDRGP-ILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGIQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSLRKFIYR-------PSDKSVNNWST 1162          

HSP 2 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 311/584 (53.25%), Postives = 426/584 (72.95%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGRQDDDEE---SSDNRIVGNFKGNLNIYK--XXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            EFE F  ++ TF L +G+  DD+E   S ++R++G FKG+L +YK  + D+          + +++++P+NDP+ ILVR+YVIRA DLHPAD NGK+DPY+ ++LG   I +KENYI KQLNP+FGK F+++  FP +S+L + V DWDLV  DD+IGETKIDLENRYY+KH+A CG+   +  HGYN WRD   PT +LAKLCK+   DPP+Y     +V VA   +    EIE++NG KKQ++E LAL V+ +W  +P  GC LVPEH+ETRPL N +KPGI+QG +EMW+DMFPK++ AP   +DI+PR+P  +ELRVIIWNT++V+L D  + TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRFI+ FDY+ AE+KIV   K+S F+ DETE K P +L +QVWDAD  +ADDFLG +EL L++ PRGAK+ + C +  +  +  +  ++IFK KR +GWWPF   +E+D  EL++ GK++AE  L++ EE E  PVG GRNEP  L  PNRPD++ L F+ PLK++K+L+CN +KW +IK +++  LLA+L LF+Y+ PGY+ K++LGA
Sbjct: 1240 EFEHFEDWLHTFNLYRGKSGDDDEQNASDEDRLIGKFKGSLCMYKVPMTDDMGREMGIDSNMGMFQNIPHNDPINILVRVYVIRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPVFGKSFDIEATFPMDSSLTVSVYDWDLVGTDDLIGETKIDLENRYYTKHRATCGITASYAIHGYNVWRDPMKPTHILAKLCKDGKLDPPQY-GPGGRVKVANRVYTGPTEIEDENGLKKQTDEHLALAVLNHWEDMPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPKDMPAPGPALDISPRKPKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLMAEEKIVISKKESMFSWDETEYKIPARLNIQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTIDMVLNEQEMPMVNIFKQKRIKGWWPFVARDEND--ELEITGKVEAELHLMTGEEAEKSPVGEGRNEPEPLEKPNRPDTTLLWFLMPLKAIKHLVCNSYKWLIIKIVVVLLLLAMLGLFLYSMPGYMVKKLLGA 1820          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 374/1066 (35.08%), Postives = 559/1066 (52.44%), Query Frame = 3
Query:  744 ISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNE--GDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGK---KEP----------------------------FLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEA----NEEEEKEVPSVNQGNRPKIPKW-------CHSTTEPMLPDTN--DQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIR--LKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRR---PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNV 3788
            ISI + EARQL G NI+P + + IG++ K + V+  TN+P+YN+Y  F+F   +   FD+VI+L  +       S+++    IG F++DV TVYN P H F +KWA L+DP DI +G KG++K D+ + GKG+       S   +   + +E IE N L+P+   +   R  A   VK+Y+AE LPRMN+ IMA +  A   D+  L+DP+V VSF    GRT  +K+T  P WNE++VF EMFP LC R+++ V D  ++ +  I THYIDL +I N+  GD GFLPTFGP+W+N+YG+ RN T   ++   +E+N G+GEGV+YRGRL I +   + +  GG  + +      P  D   GK   K+P                            F+L GA +EA++ID  IG K  PI FE ++G  GN +D  A     +  E+      Q      P         C STT P  P T   ++ Y++L  + +KPC+++    ED   R    N+L+++   F +      +                   FI ++E  +    C+      T+LDK+R+ L K  LE M   A T+ +   K  L I+  L+E R + +K+  L+  PQ+ LPDIF+W++ + KR+A+ARIPAR +LYS    EKG    ++ T+FL+ PG+ G   + W +Q ++ +YLWLG   +     + LP G+             P  ++Y +   FQLRAHM+ AR LI +D +GLSD FAR+    H   T ++ +TL+P W+Q L++D +  +     +   PP++ +E++D+D +        GK E+LG     P V L EE Y +P L +  ++ G ++ G++L AFELI+V P  G            +     P GS                                       + PVP  IRP L  YR+E LFWG+RE+++VQL++VD+P++ IE     + S VI S K  PNFS  +   ++ LPE+    PPL I   D R FGR+ L+GNHVI+N+
Sbjct:   38 ISINITEARQLVGENIDPSVVIEIGDEKKQSSVKEGTNAPFYNEYFVFDFFAHQEIFFDKVIKLSVMH------SKIMKSYCIGTFKIDVGTVYNQPGHQFTNKWAALIDPNDISTGVKGHLKCDICVTGKGD------VSPRSQKFSDAEEQIEKNPLVPEGFPS--MRPWARYYVKVYRAEGLPRMNSSIMANVTKAFVSDNTALIDPYVVVSFFSQVGRTSTQKSTADPVWNEQVVFKEMFPPLCRRLKIQVLDEGSMNDVAIGTHYIDLCRISNDQDGDKGFLPTFGPAWINIYGSARNST---LVDDNQEMNEGIGEGVSYRGRLYIQLAVEILT--GGAESKSMFSLKLPSKDAKGGKTAGKDPKAGTGGADTSFIVGNLVFVKVSEENMENFILFGAMFEATMIDRRIGDK--PISFEFTIGNCGNFIDGAAPPAAKKRGERGFDHPGQEGAMTTPLLEGQAALSCKSTTRPEKPHTGHGNRVYYYLPISTQKPCIHVQCSWEDRTYRLHHSNMLDRIAFLFVSTAYYCGQ------------------EFIASVEKKVKD-NCL------TMLDKKRLTLCKQELESMIEVAGTITEPKRKV-LTIKEMLQESRKLTQKIRFLVEEPQHTLPDIFVWMLSNNKRLAYARIPARNLLYSENVVEKGKDCGKISTLFLKPPGKRG---ATWAVQAKVDVYLWLGKCTESSNMLKNLPEGFEIHGVSSEESGGAPEIVLYKDHHEFQLRAHMYQARGLIAADNTGLSDPFARVSFQSHTHVTAIINQTLTPTWNQMLMMDKLSLHGMLTELAQEPPLITIEVYDDDAL--------GKPEYLGSTVAVPVVKLAEEPYTAPSLHYSPLFCGSLSGGDILGAFELIEV-PKSGKH---------SLPPYDDPEGS---------------------------------------IYPVPSYIRPVLRKYRIEVLFWGLRELKKVQLLTVDRPQVFIECAGKGVSSSVIQSYKSNPNFSMIVDAFEVELPEDEYLHPPLTITVVDWRAFGRSTLVGNHVINNL 996          

HSP 2 Score: 541.962 bits (1395), Expect = 3.632e-160
Identity = 275/591 (46.53%), Postives = 394/591 (66.67%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
             K+Y   LE   EF  F  +++TF L +G+ +++E SS  R VGNFKG   +YK+ D E    VD     + + +P N  V +L+R+Y++ A++LHPADP+GK+DPY++L+LG  VI +++NYIPKQLNP+FG+ FE+   FP+ES L I + D+D++ GDD+IGET+IDLENR+YS+H+A+CG+   +   GYN WRD   PT +L KLCK+   D P++     ++T+ E   Y    +  D  +  +S E LAL+V+  W ++P  GC LVPEH+ETR L+  +KPG+ QG ++MW+D+FP ++  P  P+DI+PR+P  YELR+IIWNTEDVIL D   +TG++SSDI+VKGW+KGL  D Q TDVHY SL+GEGNFNWRF+F F Y+ AE  +V   +++ F++D+TE K P  L +QVWD + +++DDFLG +EL L   PRGAK+ + C +  L +  S   ISIF+ KR +GWWPF        K  ++ GK++AEF L++ EE E  PVG  R EP  L  PNRPD++F  F+NP K   +LI   +K ++I AL++  L   L L  Y  PG L+ +++  
Sbjct: 1147 LKIYDKELE--AEFGPFDDWVKTFELYRGKANEEESSSAERFVGNFKGRFCLYKLPDSEEYDCVDSGDYKINQGIPPNTAVNVLIRVYIVSASNLHPADPDGKADPYIVLKLGKTVIKDRDNYIPKQLNPVFGRSFEIQASFPKESLLKILIYDYDVIGGDDLIGETQIDLENRFYSRHRAMCGIPSEYAIDGYNAWRDCIKPTDLLIKLCKDNRLDSPRFTP--GRITIGE-KVYTGKTVFADEDQMVESYEHLALKVLHRWEEMPGVGCKLVPEHIETRALYIKDKPGLDQGQVQMWVDIFPMDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFHYLPAEKLVVVSKRENIFSLDKTEQKLPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKTAKDCKMEMLKE--SNDNISIFQQKRSKGWWPFI-------KSEELTGKVEAEFHLVTAEEAEKNPVGRARKEPEPLEKPNRPDTTFSWFVNPFKCFFHLIWKNYKKYIIIALLLLILALFLALLFYTLPGALSNKIVSG 1723          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: fer1l4 (fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-815])

HSP 1 Score: 504.982 bits (1299), Expect = 1.652e-146
Identity = 328/1058 (31.00%), Postives = 523/1058 (49.43%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGM---GSDKRTLIDPQTGEIGE----------FNYGQTDNESIESGEDDESFAATNARTLGVPLALH----PTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMA--ISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRS------------------------------------ESGGLPAGA-----------------KVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS---------------------EANEEEEKEVPSVNQGNRPKIPKWCHSTTEP--MLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLG----YSNDCFKF----RRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVV 2960
            M++ + LK + NL  + DR ++++FRDF   TK+++ ++   F E F+WP   K+   + L + +Y  S+  +N+L+G + +SLQ ++   ++  +E L DSN+S+  I V  ++ Y+       +W  ++F   + DR   D   + I + G    G+ +   +D     +G            +    D +      D E  + T    L    AL         K + +Q+++ VIEA+ L G NINP + + +G + K T  Q STN P+YN+   FEF  ++  LFD+VI +  +    +A  ++R      IG F++D+ TVY  PDH F  KWA + DPKD  SG KGYVK  L++M KG+ +             + +EDIE NLLLP+  +   +R  A+  +KIY+AEDLP MN   + +    + GD K  +DP+VQV+FAG  G T V  NT  PEWNE+I F E FP L  RI+V + D   + +  +ATH++DL QI N    GF PTFGPSWVNLYG+P+N T   +    ++LN GL +G+ YRGR+ +++   + S                                    ES G  A +                 +V  + P+ +   G+KE FLL  +F+E ++ID  IG K   + FELS+G  G   D                      E+++E E+E P+    ++        S T P    P   D  +  +S   +KPC+Y+ +Y EDH  R    N L K+ +     ++ +  L    R     R+   L  F+   +   +S+   R   P   LDK R    K  +  +  +A  + +  T+  +  +L + R I+K+++ L   PQ+ LPD+F+W++   KR+A+ARIPA  +L+S + EE+G    +V T++++ PG    GP G  +  +L++Y+WLG+ +  K     LP      Y    F        PP ++   +  YFQLRAH++ AR +I +D++GLSD F +++ +     T+V 
Sbjct:    1 MSITVYLKTIYNLPGKYDRKVELSFRDFTHKTKILQCENVAIFKENFRWPHYGKIQKDEVLTISVYNSSRMFSNRLLGKLVVSLQHVVTAGRLVLREPLTDSNYSLTDIYVELDVRYHPLQGAAGEWSGEDFTK-VEDR---DESGLVIKNTGFLEPGNLRPQQLDRDARMLGRSLMKIDNEDGEDDDDDDYDDDYDFSDLEISSMTFTPILSRCRALSKHELAAAPKVKSFQVNVNVIEAQNLVGVNINPAVYITVGHEKKRTATQKSTNCPFYNENFMFEFQETQDVLFDKVIEISVVHKKTLAFLMTR------IGTFKIDISTVYQQPDHRFYQKWAPITDPKDTRSGVKGYVKCTLSVMMKGDSMNMASLPPAT----SQNEDIERNLLLPK--RMAAERPWAKFLLKIYRAEDLPSMNAGFLGSFS-KMMGDKKVFIDPYVQVTFAGQQGETSVVSNTNAPEWNEQISFIEQFPPLARRIKVQILDDSNMGDVAVATHFLDLQQISNPNRNGFNPTFGPSWVNLYGSPQNSTLRDI---HQDLNEGLSDGIFYRGRVQLSLSVEIYSSPTTAVIENKSSLSIKSPLSKLTFKRKSRKSREKSKESAGAQAASGPAEESEASEVPEAVTVEVEEIHPLPENFVGEKEEFLLFASFFEVTMIDPSIGSKF--VTFELSIGNYGKTADVVVKSKKSGSREDLSEDRQGLLESDDELEREEPAAGPLDK--------SVTAPRRAQPTEYDGSFSCISLLREKPCIYVWNYFEDHTFRYHNCNWLSKMADRLEYGIDEVEMLLKRPRSNAKERLMEVLLEFVSTCKQYSSSLDRKRQARPNP-LDKHRSTFIKRNIIILAKQALRVRRRVTRRTVRDKLADVRRILKRIHFLTKEPQSTLPDVFLWMMSGGKRVAYARIPAHTVLFSLVEEERGKDCGKVSTIYMKTPG----GPLG-EIFAKLEVYMWLGVTKYSKNCVTSLPAEFRPVYEGATFGTPLPPNMPPTKLAVEDSRYFQLRAHIYQARGIIAADDNGLSDPFTKVVFSTQCQVTQVT 1022          

HSP 2 Score: 488.034 bits (1255), Expect = 6.512e-141
Identity = 267/615 (43.41%), Postives = 385/615 (62.60%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQD--DDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYE----ALVNKV------TVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVP----NGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTG-ENEDD-----------------------------PKELD----------VNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFK 6479
            I   K+Y   LE   EF  F  ++ TFP+ KG+ +  D+++   +RI+G +KG+  IY +  EE   E D+    + + +P N P+++L R+YV++A +L PADPNGK+DPY+++++G + ++ KE YIPKQL+P+FG+ FEL V FP E+ L I + D DLV  DD+IGET+IDLENR+YS+H+A CGL   ++  GYNKWRD + P+ +LA LC++ G   P+Y      ++NK+         E     + + EED  E    +E  AL V++ W+++       C LVPEH+E R L N EKPG+ QG L MWIDMFP ++  PP  ++I PR P+SYELRVIIWNT+DV+L D    TGE SSDI+VKGW+KGL  + Q TDVH+ SL+GEGNFNWRF+F+FDY+  E +IVYK K+S F+++E+E +    L LQVWD D + ++DFLG +EL L+ + R AKS + C + ++ KD +    SIF++KR +GWWP    ++++D                             P++L           + GK++AEFQL++ EE E  PVG  R EP  L  PNRP +SF  F+NP+K+  + I  K+K
Sbjct: 1253 ISTLKLYKSELE--NEFSQFMDWLHTFPIYKGKANLEDEDDDDSDRIMGKYKGSFLIYPISSEEQEEEEDID-FQITRGIPKNSPIKVLTRVYVVKATNLAPADPNGKADPYVVVKIGQQQLDSKERYIPKQLHPVFGEVFELTVSFPLETELNIIIFDHDLVGSDDMIGETRIDLENRFYSRHRAGCGLALYYDKDGYNKWRDSRKPSAILADLCRKNGIPSPEYRDTEVKVLNKIFKIPNEAFPEELLKKNKKTEEDYAE---MDEHRALSVLQRWAEMREFTVGACPLVPEHVEVRSLLNPEKPGLPQGYLHMWIDMFPVDVPPPPP-VNIKPRLPVSYELRVIIWNTDDVVLDDVNPFTGEPSSDIYVKGWIKGLDDEKQETDVHFNSLTGEGNFNWRFVFHFDYLPTEKEIVYKKKESIFSLEESEFRQHAVLVLQVWDYDRIGSNDFLGSIELRLNDMVRAAKSSELCSV-KMAKDKASPRFSIFRSKRMKGWWPLIKLKSQEDIEREEREREMEKKNKKKKKKKQSKRGKMKPEDLQFVDSTGNTFLLMGKVEAEFQLVTAEEAEKNPVGKARKEPEPLDKPNRPKTSFNWFVNPMKTFVFFIWKKYK 1859          

HSP 3 Score: 65.4698 bits (158), Expect = 8.210e-10
Identity = 32/89 (35.96%), Postives = 54/89 (60.67%), Query Frame = 3
Query: 3417 DVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIM 3683
            DV P E   + AE  +++P  + +RP L  +R+E L+WG+R+++RV L  V+KP++ +E     + S  I S K  PNF   +K+ D++
Sbjct: 1043 DVDPREPEYLEAEKCYIIP--EGVRPVLKKFRIEVLYWGLRDLKRVNLFEVEKPQVRMECSGQLIESGEIESYKQDPNFKEVVKHFDVV 1129          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: myof (myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138])

HSP 1 Score: 436.417 bits (1121), Expect = 6.704e-124
Identity = 235/574 (40.94%), Postives = 345/574 (60.10%), Query Frame = 3
Query: 4806 ERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVA-----FYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSV-------STISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPS---PNRPDSSFLNFMNPLKSLKYLICNKFKW 6482
            +  KV+   LE V E++G   F  TF L +G+ +DDE+  D  +VG FKG+  +Y + D+             ++ LP++ P + +VRIYV+R  DL P D NG  DPY+ + LG K++++++NYIP  LNP+FG+ FE+    PQ+ +L I V D+DL++ D+ +GET IDLENR  S+  + CGL Q +   G N+WRD   P+ +L  + +  G  PP+ E   N +           F A+ E+ +  G    + E ++L V++          L+PEH+ETR L+++ +P + QG L+MW+D+FPK LG P  P DI+PR+   Y LRVI+WNT +VIL D   +TGE+ SDI+VKGWM G   D Q TDVHYRSL G+GNFNWRFI+ FDY+ AE   +   K+  +++D+TE K P +L +Q+WD D  + DD+LG +EL L  +   AK P+ C L  L +  +        S+ S+F  K  RGWWP   E +D  KEL   GK++   +++ ++E E  P G GR EPN  P    PNRP++SF  F NP K++K+++  +FKW
Sbjct: 1364 DTLKVFENELENVTEYKGLTDFCNTFKLYRGKTEDDED--DPTVVGEFKGSFKVYPLSDDPAIPSPPRQ----FRELPDSGPQECVVRIYVVRGIDLQPKDNNGLCDPYIKISLGKKIVDDRDNYIPNTLNPVFGRMFEVSCFLPQDKDLKISVYDFDLLTHDEKVGETVIDLENRLLSRFGSYCGLPQTYCTSGLNQWRDQLKPSQILQNVARLKGVSPPRSEDNGNTLAFNGQEYRLSDFEANKELHQHLGP---ATERISLHVLRTQG-------LIPEHVETRTLYSTFQPTLSQGCLQMWVDVFPKSLGLPGPPFDISPRKAKKYVLRVIVWNTTNVIL-DETSITGERMSDIYVKGWMPGKEEDKQKTDVHYRSLDGDGNFNWRFIYEFDYLPAEQLCLVSKKEHFWSLDKTEFKIPPQLIIQIWDNDKFSLDDYLGTVELDLHHLISPAKMPEKCNLKMLEQAKASKSPLKFDSSKSLFAQKSVRGWWPCYIE-KDGKKEL--GGKVEMTLEIVHEKEAEERPAGKGREEPNMNPKLNPPNRPETSFFWFTNPCKTMKFIVWRRFKW 1917          

HSP 2 Score: 293.123 bits (749), Expect = 4.155e-79
Identity = 206/693 (29.73%), Postives = 341/693 (49.21%), Query Frame = 3
Query:  738 WQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAI--TGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVF-NECIATHYIDLSQIMNEG----------DTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTC------GKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEF-SNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEK-GVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTF 2753
            ++I + VIE RQL G NI P+++V +  +T  T ++   N+P++N+ + F + +        +IR   + +  + I   +        ++D+  +Y+ P H  + KW +L DP D   GAKGY+KV   I+G G+          K  +D D +D+E+NLLLP     G   +   + +K+++AED+P+M+  I  ++K A   TGD K LVDPF++  FAG    TK+ ++   PEWN+ +     FP++C RI+++VYDWD +  N+ + T Y++L++I + G          D GFLP FGPS++NLYG+PR +T   +  P E+LN G GEG AYRGR+LI + T L         G     V  IS+          ++  + L   F+ A++I  E G   +PI FE+S+G  GN+LDS                      K   STT+      +   Y++L + + KP + ++S+ ED   R    NI+  + N    N  E+   +   + +   LR+       +  +   ++  +C    +    +    + L  +  E             T   L + +  C   I     + P PQN +PD+ IW+++  KR+A++R+PA ++LYS + E+  G    +  T+ LQ P     G     L  Q+++ +WLGL    + F
Sbjct:  138 FKIRVRVIEGRQLPGNNIKPVVKVNVCGETHRTRIKRG-NNPFFNEVISF-YTIFLIPGLMYLIRNYAVIVNKVKIYIFICFTSFIFPQIDIGYIYDEPAHCVMRKWLLLNDPDDSSCGAKGYLKVSAFIVGTGDD-----PPVEKTDRDTDSDDVESNLLLP----AGIALRWVTLQLKVFRAEDIPQMDDSISQSLKAAFGGTGDKKNLVDPFLEAWFAGKKICTKIIESNANPEWNQLVNLHVKFPSMCERIKLTVYDWDRLTRNDAVGTTYLNLTKIASSGGEVEAETGEPDVGFLPAFGPSYINLYGSPREFT--GLPDPYEDLNFGKGEGAAYRGRVLIELSTKLD--------GKADTDVEAISNDDILVAQKYQRRRKYCLCAVFHSATMI-LEPG---EPIQFEVSIGNYGNKLDSTC--------------------KPLASTTQYSCAVFDGNHYYYLPWADTKPVVAIMSFWEDISHRLDAVNIILNIANRLECNITELKTAV---QAKAPDLRLAEIWQKLVSQVLEDIS--RCFYFPT----IHHTNLFLLNILNE-------------TALKLFLYVSYCIFCITWTLHMFPQPQNSMPDVIIWMLRGEKRVAYSRVPAHQVLYSVLGEQACGQYCGKTQTIVLQYPMDKNKGSK---LPAQVRVNMWLGLSTHEQKF 760          

HSP 3 Score: 147.132 bits (370), Expect = 1.510e-34
Identity = 92/331 (27.79%), Postives = 152/331 (45.92%), Query Frame = 3
Query: 2805 PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKY 3797
            P +  ++ +   + LR +++ ARNL+  D+   SD +  +       TT+++  +L+P WDQTLI + +  Y     I  +PP +V+E+FD DQ+        GK E LGR  C P V L+      P+L W  +      AGE+L + ELI                                          L N  G+ +  + P +       G  +  VP+ +RP +    +E L WG+R M+  QL  V  P + +E G   + S VI + K  PNFS  +  + ++LP+  +Y PP++++  D R FGR  ++G   I+++ +Y
Sbjct: 1031 PNVSCVFDQGYEYHLRVYVYQARNLMALDKDSFSDPYVHVSFLHMSQTTEIIKASLNPMWDQTLIFNRVEIYGDPQTIARDPPQVVLEIFDSDQV--------GKDELLGRSTCPPLVKLDPGMDTPPKLLWRPVIHKGTPAGEVLVSAELI------------------------------------------LRNKTGETDLPLVPPK------RGDELYMVPQGVRPVVQLTAIEILAWGLRNMKMYQLAPVSSPSLVVECGGERVQSAVIKNIKKSPNFSGNVLQLKVLLPKEEMYTPPIVLKVIDHRPFGRKPVVGQCTINSLEEY 1305          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008905.1 (pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 gene:ENSPMAG00000008043.1 transcript:ENSPMAT00000008905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 429/1083 (39.61%), Postives = 625/1083 (57.71%), Query Frame = 3
Query:  714 PTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAK--VYSVPPISDGTC-GKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLD--SEAN-------------------------EEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVS---------PKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKE--CRAIIKKLNELIPNPQNGLPDIFIW-LIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRR-PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIP 3818
            PT  K + +Q+S+ +IEARQL G N++P++ V +GE+ K T  + STN PYYN+Y  F+FH     +FD++I+L  +   N+  S    G L+G F++DV TVY+ PDH F HKWA+L DP DI +G KGYV  D+ ++GKG+ +K   KS      DND + IE NLLLP+ I     RQ A   V+IYKAE LP+MNT I+A +K A+ G  + LVDP+VQVSFAG  G+T V++++Y P WNE++VFTE+FP LC R+++ + D D V +  I TH+IDL +I N+GD GFLPTFGP+WVN+YG+ RNYT   +M   +ELN GLGEGV++R RLL+ I   +L   S  L    +  V S+P ++D +C GK E F L GAF EA++ID +I  K   I FE+S+G  GN LD  +++N                         E ++ E+     G+         STT    P+TND++YFH+ + E+KPC+Y+ S   D + R +  NI++K+ ++    +  + E    ER     R++ AL+           S+ C R ++          +T LD++R+K+    LE+M  +AK + +  T+ + A         + ++    L+  PQ+ +PDIFIW L+  TKR+A+ARIPA++ILYS + EE G    +V T+FL+ PG+   G  GWT+Q +L+ YLWLGL +  K F  GLP G+          PP  + Y ++S F+LRAHM+ AR+L  +D +GLSD FAR++ + H  +T+V  ETL P WDQ L    +  Y     +  +PP++V+E+FD+D +        GK+EF+GR   KP V +  E Y+ PR    L +++IYRG + AGELLA+FEL+QV P +                                            N    P  G+  T  G  ++PVPK IRP L  YR+E LFWG+R+++RVQL SVD+PR+ IE     + S VI      PNFS+ +K+ ++ LPEN L+ PPL I+  D R FGR IL+G+  ++++ K++     P
Sbjct:   10 PTAGKPQSYQVSVMIIEARQLVGLNMDPVVIVEVGEEKKQTSQKESTNCPYYNEYFVFDFHTPPNMMFDKIIKLSVIHSKNLIRS----GTLVGTFKLDVGTVYSQPDHRFYHKWAVLTDPDDITAGIKGYVNCDIAVVGKGDNIKTPHKSV-----DNDADSIEGNLLLPEGIPA--DRQWARFFVRIYKAEGLPKMNTAIVANVKKALMGQERDLVDPYVQVSFAGQKGKTSVQRSSYEPVWNEQVVFTELFPPLCRRMKLQIRDSDKVNDTAIGTHFIDLKKICNDGDKGFLPTFGPAWVNMYGSTRNYT---LMDEHQELNDGLGEGVSFRARLLLGISMEILDITSPELSTNTEISVESIPHVADESCSGKMEEFFLFGAFLEATMIDRKISDKL--ISFEISIGNYGNSLDGLNKSNILDRSDDEDEYDEGDEDDETELLNDETDDAEMDDDTSGS---------STTPSYKPETNDRQYFHMPYYEQKPCVYVRSAWHDQRRRLYNSNIIDKIADKLEEGISDVLETMKMERPHPERRLRGALEEM---------SVGCSRFLTLANKDPSAFGRTRLDRDRLKICMRELEQMGPQAK-LGRARTRIHTAPHSTRHTTSSTLRSTAALMAAPQDSIPDIFIWMLVNKTKRVAYARIPAKDILYSIVEEETGKDCGKVKTLFLRLPGKRVFGSGGWTMQAKLEAYLWLGLNKQRKDFLTGLPSGFEEKKIGVTGVPPSVLNYHKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLQFQDVYMYGEPRELRDDPPMVVIEVFDQDTV--------GKAEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPVTAGELLASFELLQVPPAD--------------------------------------------NCKFPPVSGLNDTDRGP-IIPVPKGIRPVLAKYRIEVLFWGLRDLKRVQLQSVDRPRVDIECAGKGIQSVVIADFNKNPNFSHLVKFFEVDLPENELFHPPLNIRVVDCRAFGRYILVGSQTVTSLRKFIFHTTGP 1004          

HSP 2 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 325/600 (54.17%), Postives = 433/600 (72.17%), Query Frame = 3
Query: 4794 HNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDN-RIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            H  +E  KVY   LE   EF+ F  ++ TF L +G+  D+++  D  R+VG FKG+  +YK    +  ++   +  +  +++ +P NDP+ +LVR+Y++RA DLHPAD NGK+DPY++++LG   + + ENYI KQLNPIFGK F+++  FP ES L +QVMDWDLV  DD+IGETKIDLE+RYYS+H+A CG+ Q +  HGYN WRD   PT +LAKLCK+   D P Y     +V VA   F    E+E+D+G KKQ+ E LAL+V+ +W ++   GC LVPEH+ETRPL + +K GI+QG LEMW+DMFPK++  P  P+DI+PR+P SYELR+IIWNT++VIL D   +TGEK SDI+V+GW+KG   D Q TDVHY SL+GEGNFNWRFI+ FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L++ PRGAKS + C L+ L  DGSV  ISIFK KR +GWWPF   +E+D +EL   GK++AE  LL+ EE E  P GLGRNEP+ L  PNRPD+SF+ F+NPLKS+KY+IC+++KW +IK ++   +L LL LFIYN PGY+ K++LGA
Sbjct: 1175 HLQVEELKVYDKELE--AEFDNFEDWLHTFNLYRGKTSDEDDILDEERVVGRFKGSTCVYKWPLADNVLKEVGYDAQFGMFQGIPTNDPINVLVRVYIVRATDLHPADINGKADPYIVIKLGKTEVKDNENYISKQLNPIFGKSFDIEATFPMESMLTVQVMDWDLVGMDDLIGETKIDLESRYYSRHRATCGIAQQYAVHGYNTWRDPMKPTQILAKLCKDNKVDGPHY-GPGGRVKVANRIFNGPTEMEDDSGHKKQTEEHLALKVLHSWEEIARVGCKLVPEHVETRPLLHPDKTGIEQGRLEMWVDMFPKDMPHPGPPVDISPRKPKSYELRIIIWNTDEVILEDDAFMTGEKMSDIYVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLVAEEKIVISKKESLFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKSSKQCTLNMLKMDGSVPMISIFKLKRVKGWWPFVSRDENDEQEL--TGKVEAELHLLTAEEAEKNPAGLGRNEPDPLEKPNRPDTSFIWFLNPLKSIKYVICHRYKWIIIKLVVALLMLVLLGLFIYNMPGYMVKKLLGA 1769          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004363.1 (pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 gene:ENSPMAG00000003981.1 transcript:ENSPMAT00000004363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 408/1146 (35.60%), Postives = 635/1146 (55.41%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEF---------ENPITDRKLSDADD-------ISIDSHGMGSDKRTL-----IDPQTGEIGEFNYGQTD---------NESIESGEDDE-------SFAATNARTLGVPLA-----------------LHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESG---GLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLD--SEANEEEEKE---------------VPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNER-------RGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLT-KVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIW-LIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQV 3266
            MALV++LK V+ L  + DRI ++ FR     T V    +D   F + F+WP+   ++  +TLE+++Y + K L+ +L+G+  + LQ+L+E  ++   E L+D N++ I  TV+ EL Y + D  +  W + +F           P  D      +D       I  ++H + S  R L     + P+  +  +FN G+           N + E  ED +       S    N  T+ +                    + PT  K + +Q+S+ +I A++L G NI+P++ + +G+  K T ++ STN P YN+Y  F+F+ +   +FD +I+L  +   +   S    G  IG F++DV TVY+ PDH F HKWA L+DP DI +  +GYV+ D+T++GKG+ +K   KS      ++DD+ +E NL+LP   K   +RQ A   V IYKA  LP+MNT I+A +K A+ G  K LVDP+VQVSFAG  G+T V+ N+Y P WNE++V T++FP LC R+++ + D D V +  I +H+IDL++I N GD GF+PTFGP+WVN+YG+ RNYT   ++   +ELN GLGEGV++R RLL+ + T L  ++           V  +P I+D   GK E F L GAF EA++ID  I +K   I FE+S+G  GN +D  +++N +E  +               + +  +           STT PM P+TND++YFH+ + E+KPC+Y+ S   D + R +  NI++K+ ++    +  + E    ++       RG    M +  + F        +SI C       T LD++R+K+  K  +  ++   KTM        +   ++  R ++  L   I +PQ+ +PD+FIW L+  TKR+AFARIPA++ILY+   EE G    +V T+FL+ PG+   GP GW +Q +L++YLWLG  +    F  G+P G+          PP  + Y+++S F+LRAHM+ AR+L  +D +GLSD FAR++ + H  +T+V  ETL P WDQ L    +  Y     +  +PP++V+E++D++ M        GKSEF+GR   KP V +  E Y+ PR    L +++IYRG + AGELLA+FEL+QV
Sbjct:    1 MALVVHLKRVEKLRGKADRIARVTFRGLTFDTNVFENCEDEARFDKIFRWPLATAINGSETLEVQVYNHGKLLSKRLVGTFRMVLQQLVEQGQLELTETLLDENNASIMATVTLELQYQALDGTVGAWSERDFVAFHNRHLIPTPTGDTDTLMPEDETGGDVEIHYNTH-VHSGSRPLRCKKKLKPR--KFLKFNIGRKKSKDDEAAYVNPTFEDSEDSDGSGGMSVSGKGDNLDTISIASGKVETSDVSNKRSKPEQRVDPTAGKPQSYQVSVMIIRAQKLVGLNIDPMVILEVGDAKKKTRIEKSTNCPNYNEYFVFDFNTAPNTMFDTMIKLTVVHNKDAIRS----GTPIGTFKLDVGTVYSQPDHRFYHKWATLIDPDDITADVRGYVQCDITVVGKGDNIKKSHKSI-----ESDDDSLEGNLILPDGCKG--ERQWARFYVNIYKAVGLPKMNTAIVANVKKALMGQEKDLVDPYVQVSFAGQKGKTSVQNNSYEPVWNEQVVLTDIFPPLCRRMKLQIRDSDKVNDVAIGSHFIDLTKICNNGDKGFMPTFGPAWVNMYGSTRNYT---LVDEHQELNDGLGEGVSFRARLLLQLTTELLDKTSPELNNTTEVMVEDIPRINDSVLGKMEEFFLFGAFMEATMIDRSISEKL--ISFEISIGNYGNSIDGLNKSNPQERSDDEDEDDDEDDEEETVLLTAQKAKGTDELSSMFSTTPPMKPETNDRQYFHMPYYEQKPCVYVESTWHDQRRRLYNSNIIDKIADKLDEGISDVKEAMKTDKPHPERRLRGALEEMSSGCERFCSLANKDSSSIDC-------TDLDRKRLKMRLKELIYNIQHSFKTMLCMLFIQIINDMMRVMRNLLSALIACIKDPQHSIPDVFIWMLVNKTKRIAFARIPAKDILYANADEELGKDCGKVKTLFLKLPGKRSFGPGGWAMQAKLEVYLWLGTNKQRNNFLNGMPTGFVEKKSIDPTVPPRVLTYSKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLEYQDVYMYGEPRELRDDPPMVVIEVYDQNTM--------GKSEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPLTAGELLASFELLQV 1112          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001654.1 (pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 gene:ENSPMAG00000001492.1 transcript:ENSPMAT00000001654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 317/579 (54.75%), Postives = 426/579 (73.58%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGR-QDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
            EF+ F  ++ TF L +G+ +DDD    ++R+VG FKG+L +YK    E       +  +  +++ +P+NDP+ +LVR+YV+RANDLHPAD NGK+DPY++++LG   + +KENYI KQLNP+FGK F+++  FP +S L + + DWDLV  DD+IGETKIDLENR YSKH+A CG+ Q +  HGYN WRD   P+ +LA+LCKE   DPP+Y     +V VA   F A  E+E++NG+KK ++E +AL V+ +W ++P  C L+PEH+ETRPL + EKPGI+QG +EMW+DMFP ++  P  PIDIAPR+P S E+RVIIWNT+DVIL D  +LTGEKSSDIFV+ W+KG   D Q TDVHY S++GEGNFNWRF+F FDY+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L++ PRGAK+ + C L  L  DGSV  ISIFK KR +GWWPF   NE+D  EL++ GK++AE  LL+ EE E  P GLGRNEP+ L  PNRPD+SF+ F+ PL+S+KYLIC+++KW ++K ++   LLA+L LF+YN PGY+ K++L
Sbjct:  416 EFDNFEDWLHTFSLYRGKIEDDDSSMEEDRLVGRFKGSLCVYKYPLPEELAREVGYDPQFGMFQGIPSNDPIGVLVRVYVVRANDLHPADVNGKADPYIVVKLGKHEVKDKENYISKQLNPVFGKSFDIEAVFPMDSMLTVSIYDWDLVGTDDLIGETKIDLENRLYSKHRATCGISQRYSIHGYNMWRDPLKPSQILARLCKEVKVDPPQYSP-EGRVKVANRTFTAATEVEDENGQKKPTDEHMALTVLHHWEEIPGACKLIPEHIETRPLLHPEKPGIEQGRIEMWVDMFPADVPRPGPPIDIAPRKPKSLEMRVIIWNTDDVILEDDSLLTGEKSSDIFVRSWLKGQQEDKQDTDVHYNSVTGEGNFNWRFVFPFDYLVAEEKIVMSKKESVFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTSKLCSLDMLKTDGSVPMISIFKQKRIKGWWPFAARNEND--ELELTGKVEAEIHLLTSEEAEKSPAGLGRNEPDPLEKPNRPDTSFMWFLTPLRSIKYLICHRYKWLIVKIVLALLLLAMLALFLYNMPGYMVKKLL 991          

HSP 2 Score: 259.996 bits (663), Expect = 2.007e-71
Identity = 138/357 (38.66%), Postives = 207/357 (57.98%), Query Frame = 3
Query: 2805 PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSP 3863
            PP+ +IY EK  FQLR HM+ AR+L  +D +GLSD F RI+ + H   T+V+ ETL P WDQ L+ D +  Y     +  +PP++V+E+FD+D +        GK++F+GR   KP V +  E+Y +PR    L +++IYRG   AGELLAAFEL+QV     +  A          R+++P            +   L    G   GD+ P  G T T  G  ++PVP+ IRP L  YR+E LFWG+R+++R+QL++VD+PR+ +E     + S VIPS K  PNFS   K+ ++ LP+N L  PPL I+  D R FGR  L+G H ++++ K++++    T+    + I + + P
Sbjct:   21 PPISLIYKEKQMFQLRVHMYQARSLFAADSTGLSDPFGRIIFSTHSQATEVIPETLCPTWDQMLVFDSIELYGEAQELRDDPPIIVIEVFDQDTV--------GKADFIGRALAKPVVKMSNEKYDAPRFPPQLDYYQIYRGNSTAGELLAAFELLQVATSPTHHHAP---------RTTAP------------RPATLIPPSG--KGDLPPISGPTDTEHGT-ILPVPRGIRPILSKYRIEVLFWGLRDLKRIQLVTVDRPRVDVECSGKSVQSVVIPSYKQNPNFSTLFKHFEVDLPDNELLHPPLNIRVVDCRAFGRYTLVGTHTVTSLRKFILRAPSKTKAANIRTIGDPNDP 345          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001770.1 (pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 gene:ENSPMAG00000001575.1 transcript:ENSPMAT00000001770.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 342.043 bits (876), Expect = 2.670e-97
Identity = 234/714 (32.77%), Postives = 365/714 (51.12%), Query Frame = 3
Query:  726 KTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDS--KPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTV-FNECIATHYIDLSQIMNEGD------------------------TGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFL------LIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFS-NAVEILHELHMNER-RGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVV-TVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQ 2759
            K  D+Q+ I VIEARQL G NI P+++V +  ++K T ++   N+P++++   F FH+S AELFD++I  + L   ++          IG F++DV TVY+ P H F  KW +L DP+D+ SGAKGY+KV L ++G G++       A       + EDIE NLL P     G   + A + ++ Y+AED+P+M+  ++ T+K     DS  K LVDP+++VSFAG T  TK+ +    PEWN+ I     FP++C R+R+++YDWD +  N+ + T ++ +SQI   G                         TGFLPTFGP ++NLYG+PR +T      P EELN G GEGVAYRGR+L+ + T L               V PI      + E +L      L   FY A+++     +  +PI FE+S+G  GN+ D          + S  Q +R  +   C S              ++L +   KP + + SY ED   R    NIL   +     N   +   L   E      +   +A+DT IE+   +L  I    +V+P   LD+E  +     L  +   A+ + ++ T+      L E    +++L EL   PQN +PD+ +W+++  +R+AFARIPA E+++S++      KN  +  T+ L+ P        G+ + GQ+++ +WL L  D K+F +
Sbjct:  207 KPRDFQVRIRVIEARQLPGNNIKPVVKVTVAGQSKRTRIRKG-NNPFFDETFFFNFHLSSAELFDELIYFKVLHSHSLRAD-----SEIGTFKLDVGTVYDEPRHTFQRKWLLLCDPEDLSSGAKGYLKVTLLVLGAGDEPPEDRSEAV-----EEREDIENNLLRP----AGVSLRGAFLTLRAYRAEDVPQMDDAVLDTVKQIFGFDSNKKNLVDPYLEVSFAGKTLCTKIIEKNANPEWNQAISLPIRFPSMCERLRITLYDWDRLTHNDAVGTAFLSMSQISCPGGDEPEAFITMRCLRLNLLRLIEDEGTGFLPTFGPCFINLYGSPREFT--GFPDPYEELNFGKGEGVAYRGRILVELTTKLEDHINN--------KVEPIPSDDLLRVEKYLRRRRYNLCATFYSATMLR----EVNEPIQFEVSIGNYGNKYDVTC-----PPLASTTQYSR-AVFDGCSS--------------YYLPWGNIKPVVTLTSYWEDVGHRLEALNILMHTQRRLEVNIGRVRATLQAREPVEAVAVSWLHAIDTLIEDCSQALPEITERPNVTP---LDREVWRARSATLALILRSAQRLREEATRVEET--LSELDDWLERLTELTREPQNSIPDVVVWMLRGDRRVAFARIPAHEVMHSSLGPHACGKNCGITQTIVLKYP----QDTHGFKIPGQVRVRIWLSLAADSKSFNE 862          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002265.1 (pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gene:ENSPMAG00000002063.1 transcript:ENSPMAT00000002265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.567 bits (719), Expect = 2.048e-84
Identity = 161/376 (42.82%), Postives = 231/376 (61.44%), Query Frame = 3
Query: 5388 GYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAF-YADAEIEE-DNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGI-QQGSLEMWIDMFPKELGAPPLPIDIAPRQPIS-YELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSV---STISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPS---PNRPDSSFLNFMNPLKSLKYLICNKFKWF 6485
            G N+WRD   P+M+L  + +   +  P YE   +++T+    +  +D E +   N       E LAL ++++         L+PEH+ETR L +S +PG+ QQG L MW+D+FPK +G P  P DI PR+    Y+LR IIWNT+DVIL D   +TGEK SDI+VKGW+ G     Q TDVHYRSL GEGNFNWR+IF F+Y+ AE+  V   K+  +++D+TE++ P K  +Q+WD D  + DD+LG L+L LS +P  AKS + C L  +          T S+F+ K  +GWWP     E+D K++ + GK++   ++L+ +E E  P GLGR EPN  P    PNRP++SFL F +PLK+ KY+I  ++KW 
Sbjct:    2 GQNQWRDQMTPSMILEGVARAKSWPQPIYEG--DRLTLKGRDYLMSDFEAKAPTNPHLGPVKERLALHLLRSMG-------LIPEHVETRTLEHSIQPGLEQQGKLMMWVDVFPKNMGPPGPPFDITPRKAKKRYQLRCIIWNTKDVIL-DETSITGEKMSDIYVKGWIDGRDDAKQKTDVHYRSLGGEGNFNWRYIFPFEYVPAENICVVSRKEHFWSLDKTELRLPPKFTIQIWDNDKFSPDDYLGYLDLNLSHMPVPAKSAEKCSLEMVETPTGKKKHKTTSLFEQKNVKGWWPCIA--EEDGKKI-IAGKVEMTLEILADKEAEERPAGLGREEPNMNPKLDPPNRPETSFLWFTSPLKTFKYIIWRRYKWI 364          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO47415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ1])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 481/1320 (36.44%), Postives = 722/1320 (54.70%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQ---DEFENPI-------TDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNE----------SIESGEDDESFAAT---NARTL-------------------------GVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDIL----SGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVL---RSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSE--------------ANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCV---RHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIR--LKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYS---NDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKS----PRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGK 3812
            MALVL LK   NL  + DRI ++ FR     T VV       + E F+WP+   LDP + +E+ +Y ++K   N+L+G   + LQ+L+++  +  +E+L+D N+++++ TVS EL Y +P+  I+ W     D  ++P        T R   + + I   S+G    ++     + G     N G+              S   G+  ES  A+     R +                         G  +++H     +  W I I + EARQLAG  I+P+  V +G + K+T ++  TN P+Y+++  F+F M    LFD+++  +     N+       G LIG F++DV TVY  PDH F  +WA+L DP++ L    +G KGY +VD+T++GKG+  K +P        DNDD DIE NLLLP  +    +R  A + +KIY+AE LP+MN+ +MA +K A TG+ + LV+P+V+V FAGH  RT VKKNTY P+WNE++VF+E+FP LC RI++ + D D+V +E I TH+IDLS+I N+G  GF+PTFGP W NLYG+ R+Y+   +     +LN GLGEGVA+RGRLLIA+        SESG      +V    PISD   GK E F L   FYEAS+ID ++G K   + FE+S+G  GN +D +              +N +  +     ++  R     + +S T P+ P TND++Y+H+ + + KPC ++    +DH+ R +  N+L K+     + +    E    +   T   +   L   I      LN IK +    HV  +T LDKER+KL +  +E +   A+ + +  TK +  ++  LK   A++++L  +   PQ+ +PD+FIW++   KR+A++RIP++ I+YS + EE+G  +  + TVFL+ PG+ G GP GW +Q +L + +WLGL +  K + +  P GY    N       PP  +IYTEK  F LRAH++ AR+LIGSD SGLSDAFAR++    V  T+V++ET SP WDQTLI   ++ +   + I  NPP +VVE+FD+D          G SEF+GR   +P V +  E Y+     P L W+++ RG+ NAGE+LAAFEL+QV                             S + F   E+   N         TP+  +T         PVP  IRP +  +R+E LFWGVREM+R+ L +VD+P++ I+     + S VI + K  PNF NP+ Y D+ LPEN  Y PPL I+  D R FGR  L+G HV++++ +Y+  G+
Sbjct:    1 MALVLLLKTCTNLHGKADRIARVTFRGVTYQTSVVEHSSEADWDEDFEWPLSSPLDPSEFIEIEVYTFNKIFQNRLVGVFRMVLQRLIQEGHLEVEESLVDMNNTVLKATVSLELQYNAPEGHISQWVNGMPDAMDSPPQVGYYPDTGRDFDNNESIMSGSYGRQPQQQK---ERRGSFMSLNSGKQAKSQSLVSLQSSGSNRRGDRKESMPASVGGGGRYISPGDGGGVAAPFDAMLEGKGIGSRRGSQISVHSDRSMSMKWYIQIRIHEARQLAGTQIDPVCTVSVGNQKKSTTIKEQTNCPFYDEFFVFDFKMPPMVLFDKIVMFQFYTGRNLVSQ----GALIGSFKLDVGTVYAQPDHRFCRRWAVLTDPEETLGASGAGVKGYARVDITVLGKGDPAKEQPGIK-----DNDD-DIEGNLLLPDGVPA--ERPKARVIIKIYRAEGLPKMNSGLMANVKKAFTGEVRDLVNPYVEVQFAGHRARTTVKKNTYEPKWNEQVVFSELFPPLCRRIKIQLKDSDSVTDEVIGTHFIDLSRISNDGANGFMPTFGPCWANLYGSTRDYS---LFDEHNDLNNGLGEGVAFRGRLLIAVHAEFGESASESG--IRQVEVEPTAPISDTAAGKDEQFQLFACFYEASMIDRKVGDKM--VSFEMSIGNWGNSIDGQPIDEVSHATHIQHTSNTQHTQSTMGGDEDRRDGDNPFLYSLTPPVKPVTNDRQYYHIPWEDSKPCTHIKFMWQDHRRRLYNSNVLLKICERLEDGLTDCIERVKMDLPNTFRWLSRVLSELINGCNQYLNLIKSMPTASHVG-RTKLDKERLKLCQYEVESVCTSAQEL-KTSTKDDTHMKDNLKAANALLQRLLNIAVEPQDTIPDVFIWMLCGGKRVAYSRIPSQHIMYSLVEEERGKDSGRMQTVFLRLPGKRGDGPKGWAIQAKLNIMIWLGLHKHKKDYLKDAPKGYQTPKNAHKLMAPPPNHLIYTEKQKFVLRAHVYQARSLIGSDASGLSDAFARVIFTHLVSDTRVIWETRSPTWDQTLIFQEVVLWGDVNEIAVNPPTIVVEIFDKD--------IGGDSEFIGRALARPIVKMACEPYEKPFFPPALEWFQVCRGEENAGEMLAAFELLQV----------------------------TSGTCFLPSEVEPVN---------TPDGPIT---------PVPVGIRPVMKKHRIEVLFWGVREMKRINLTTVDRPQVDIDLAGHVIQSTVITNAKKNPNFQNPVCYFDVELPENERYCPPLTIRVRDCRTFGRFTLVGTHVLNSLHRYLQTGE 1242          

HSP 2 Score: 582.793 bits (1501), Expect = 4.554e-173
Identity = 301/590 (51.02%), Postives = 414/590 (70.17%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
             K++   LE + +F GF  ++ +FPL +G++  +++  D+RIVG FKG+L ++K    E      +    L   LP+N+PV +LVR+YV++A +LHP+D NGK+DPYL++ LG   + +++NY+ KQLNP FG+CFE +   P +S L + + DWDLV  DD+IGETK+DLENR+YS+H+A CGL   +   G+NKWRD   PT +LAKLCKE G D P Y     +V V    F A  +I E++G  KQS+EP AL  +K +  +  G  LVPEH+ETR LFN EKPG++QG LEMW+DMFP ++ +P  P+DI PR+P SYELRVIIWNTEDV+L +  +LTGEK SDIF+KGW++GL  D Q TDVHYRSL+GEGNFNWRFIF F Y KAE++IV   K S F+ DE+E K P +L+LQVWDAD  +ADDF+G L L L+++PRGAK+ ++C L  L +DGSV  +S FK K  +G+WPF    E++  E+++ GK++AE +LL++EE E  P G  R +P AL  PNRPD +++  MNPL+ LK +I N ++  LIK L+I+ LLAL+ LF Y+ PGY  K++ GA
Sbjct: 1402 MKIFKLELECMHDFNGFNDWLHSFPLFRGKKTSEDDDDDHRIVGKFKGSLKVWKYPLPEHVEMDPIVGTFL--KLPSNEPVNVLVRVYVVKALNLHPSDVNGKADPYLVVNLGKHRVRDRDNYVSKQLNPTFGRCFEFEAIIPMDSMLTVGIYDWDLVGSDDLIGETKVDLENRFYSRHRATCGLQDQYATFGFNKWRDPLRPTQILAKLCKEEGLDGPHYS--TGRVRVDNKVFVAAPQILEESGHWKQSDEPSALRCLKQFQTLKRGFTLVPEHVETRALFNPEKPGVEQGKLEMWVDMFPMDMPSPGAPVDITPRKPTSYELRVIIWNTEDVLLEEANMLTGEKCSDIFIKGWLEGLKDDKQQTDVHYRSLTGEGNFNWRFIFPFQYQKAEERIVITRKASFFSWDESEEKVPARLHLQVWDADAFSADDFIGDLCLDLTRMPRGAKTSKSCTLDLLKQDGSVPQVSFFKMKHMKGFWPFFVNTEEE--EIELAGKVEAELELLTQEEAEKKPAGRAREDPQALEKPNRPDVAWMMMMNPLRGLKAMIWNNYRMCLIKMLVIALLLALMGLFFYSMPGYTVKKIFGA 1985          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO43088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG6])

HSP 1 Score: 410.994 bits (1055), Expect = 1.870e-116
Identity = 220/558 (39.43%), Postives = 337/558 (60.39%), Query Frame = 3
Query: 4833 LEEVKEFEGFAAFIQTFPLQKG----RQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQ-LNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALP---SPNRPDSSFLNFMNPLKSLKYLICNKFKW 6482
            LE+++EF G    I +F L +G    R DDDEE+   ++VG FKG   IY + + E           ++ +LP N+P+  +VR+Y++ A DL P DP G +DPY++++LG K ++ K+ Y P  LNPIFGK FELD   P   +L I +MD+DL++ DD+IGET IDLE R  ++++A CG+ + + + G N+WRD + P  +L + C+E   +   Y+   +      V  Y   +++E  G  +  NE L  +  +    V N    +PEH+ETR L +  +P I+QG +++W+D+FPK  G     +DI  R+P +YELRVI+WNT  VI+ D   +TGE+ SDI+VKGW++G+G D + TDVHYRSL G+GNFNWR +FNF Y+  E K+V + K+  +++D  E++   +L +Q+WD D  + DDFLG  +L L K+P+  ++ + CG  +   K+G    + +F+    +GWW    E  ++P      GK++   ++L+  E    P G GR+EPN  P    PNRP +SFL F +P K+LKY+I   +KW
Sbjct: 1285 LEKIEEFGGLEDMIASFSLYRGKAKKRDDDDEET--QKVVGEFKGTFRIYPLPEAEGVDPDLPE--TVFTNLPPNEPIDCVVRVYILSAIDLQPQDPGGLADPYVVVQLGKKKLDNKDQYKPNTLNPIFGKMFELDAVIPVHKDLKITLMDYDLLTRDDMIGETVIDLEQRLLTRYRAKCGIPKTYCDSGPNQWRDHKRPMELLREWCEETEKNFKFYKGTKDGTPDRIVVGYRVYQLDE-FGAFRNPNEHLGAKHQRLALHVLNQLEFIPEHVETRGLRSPMQPNIEQGKVQLWVDIFPKNEGVLKPSVDITAREPTNYELRVIVWNTSGVIM-DETSITGEQMSDIYVKGWLEGMGDDKEKTDVHYRSLDGDGNFNWRMVFNFLYLPIEKKMVIREKEHFWSLDAKEVRLAPRLNMQIWDNDTFSYDDFLGSCQLDLIKLPKPCQTAKRCGTSRDPGKNGEY--VDLFQQHSIQGWWACYQEGIEEP-----TGKIEMTIEVLNSNEAAVKPAGKGRDEPNQNPHLDEPNRPATSFLWFTSPFKTLKYIIWRNYKW 1829          

HSP 2 Score: 280.026 bits (715), Expect = 1.171e-75
Identity = 206/699 (29.47%), Postives = 340/699 (48.64%), Query Frame = 3
Query:  726 KTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLA-----MGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKM---AITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFN-ECIATHYIDLSQIMNEGDTG-------------FLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRS----ESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNAL--------DTFIENIESSLNSI--KCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDC--------------TKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFG 2672
            K +D+QI + ++E RQL+G NI+P++ V +  + + T++  STN P YN+   F FH S+AELFD +      A      G     +L  G                P   ++  +A L    +++   +GY+KV   ++G G++    P  A   PK+ D++DIE+N L+P     G  RQ A   ++I++AED+P+M++ +  +IK     I G +K LVDP+V+V+F G    T +K     PE+ E++    MFP++C RI++ +YDWD V N +CI T ++ LS I  +GD G             F PTFGP +VN YG+PR ++  ++    + LN+G+GEGVAYRGR+LI ++T L S    +         +  V P       ++E + L   FYEA++I    G    P+ FE+S+G  GN++D            SV   N           T P  P  +   Y +L +  +KP + + S+ ED   R    N++ +L ++    V+               R+++AL        D F+  + S L  +   C+ HV    +L K     +   L +  +       D                + N+   + E    +++L ++   PQN +PD+ +W+I  ++R+A+ RIPA+E+L+S  P+  G    + V + L+ PG+ G
Sbjct:    7 KVQDFQIRVKILEGRQLSGNNIHPVVRVAMSNQKRETKIVRSTNKPVYNESFTFNFHTSEAELFDDLFSPAVSAHSYWRWGIRPKKQLFQG-------------LPRPKCAYISSFAFL----NVVFLFQGYLKVTAMVLGPGDE---PPIKAKLPPKEEDEDDIESNCLMPM----GVARQPALFNLRIFQAEDIPQMDSGMGRSIKKFFKGIFGGAKGLVDPYVKVNFCGKKIETSIKYQDDNPEFKEQVKIPLMFPSMCERIKIQLYDWDRVGNDDCIGTAFLSLSSISGQGDEGNELLVILHPSLLCFPPTFGPCFVNFYGSPREFS--ELPDQDDALNKGIGEGVAYRGRVLIELETTLGSNEIEQEVSQIETEDIVRVQPFL-----RREKYKLFACFYEATMIKDVDG----PVEFEVSIGNYGNKMDE-----------SVAPAN-----------TAPSNPLFDGCHYNYLPWGNEKPVVVVESFWEDIAFRLEPLNLISRLCDKLEVNVK---------------RVRSALDAPTPPKEDAFVPMVTSILEVLISDCIPHVG---VLSKSSKHCSYDILGRKVLPLNHRDHDLNLTTELKSALDFPGAEINMEQTVGELNGYLQRLRDVAIEPQNCIPDVIVWMISGSERIAYYRIPAQEVLFSTTPDACGKICGKTVELRLKYPGKKG 630          

HSP 3 Score: 167.933 bits (424), Expect = 2.051e-41
Identity = 121/373 (32.44%), Postives = 179/373 (47.99%), Query Frame = 3
Query: 2796 FRRPPMEI----IYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVT-PNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIM-LPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKV-ITNTSSPNQQNNLETPE 3893
            FR P + I    I      FQ+ A+++ AR+L+  DESG++D + R+   +    T+V  +TL P WDQTLI  H+  + S + I  NPP +V+E+FD+DQ+        GK +FLGR   KP   +   E  + +L W+ I  G  + GE+LAA EL  V                          S       ++ E  L N     +G V  P+      AEG  ++PV   IRP L    VE L WGVR M++ QL S+  P +  E G   + SD++   K  PNF  P+    I+ LP   +Y PP+ I+  D R FGR   +  H I ++T++  +   PT  PA ++ +   ++P Q      PE
Sbjct:  913 FRTPSLSISKSVISCTPHKFQMWAYVYQARDLLAKDESGMNDPYVRVAFANQSQMTEVKQKTLCPTWDQTLIF-HVDLFDSLENIQRNPPTVVMELFDKDQV--------GKDDFLGRTEFKPYPRIHGNEGPACKLLWYPISHGDEDGGEILAACELFLV--------------------------SFIFFQCTTKLETGLLNFHLQDDGVVNIPHPPTPRDAEGE-ILPVRDRIRPVLQKTVVEVLCWGVRNMKKYQLASIKSPSVQFEIGGEIIQSDILTDAKKFPNFGRPILPRKIINLPVEEMYTPPMNIRIHDNRTFGRKPTVAVHSIKSLTRF--RCAAPT--PAGQIQVEGPAAPGQPAEGVVPE 1245          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO36863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC0])

HSP 1 Score: 332.413 bits (851), Expect = 9.388e-94
Identity = 212/696 (30.46%), Postives = 365/696 (52.44%), Query Frame = 3
Query:  711 HPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIK--MAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTV-FNECIATHYIDLSQIMNEGDTG---------FLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVL----RSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVP--SVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFS-NAVEILHELHMNERRG-THLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKV-CLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGW-TLQGQLKMYLWLGL 2732
            H   +K +D+Q+ + +IE RQL+G NI+P+  V +  +T+ T+V++STN P+Y++   F F+MS  ELFD++I             +L    +IG F+ D+   Y  P H  + KW +L DP D ++G KGY+KV + ++G G++   K          +D++DIE NLL P    +G   + A   +K+Y+AED+P+M++  +  IK  + +  + K LVDP++  SFAG   RT++  N+  PE+N+E+     FP++C R+++ ++DWD +  ++CI T ++ +S I  +G+ G         FLP FGP ++N+YG+ R Y+   +    ++LN G GEGVAYRGR+L+ ++T L    +S +  L +  ++ SV P       ++  + L   F EAS++    G    P+ FE+S+G  GN+LD           P  +V  G        C+              Y+ L + + KPC+ + S+ ED   R    NIL ++      N  ++   L  N +   T   + + LD  I ++   L  I    + +P   ++   +KL +V  +EK+ +  + +    +  ++   L E    +++L +L   PQN +PD+ IW++  TKR+A+ RIPA ++LY    E  G    +V  +F++ PG+       +  +   ++M +WLGL
Sbjct:    8 HKLSNKPQDFQVRVRIIEGRQLSGQNISPVARVTVANQTRQTKVKISTNKPFYDETFFFNFNMSPMELFDEIISFEVFNS-----RKLRANAMIGYFKCDIGFFYEEPGHAAIRKWVLLTDPDDKMAGVKGYLKVTVMVLGPGDEAPVKSAQ-------DDNDDIETNLLQP----SGVMLRPATFSLKVYRAEDIPQMDSGFIEGIKRVLRVGEEQKELVDPYLLFSFAGMKARTRIHYNSDHPEFNQELNVQFKFPSMCERLKLQMFDWDRLTADDCIGTAHLPMSAISGQGEDGESWVERNISFLPMFGPCFINVYGSTREYS--DLPDEYDDLNLGNGEGVAYRGRVLVELETKLGVTPQSPTDDLQS-HEIISVQPYL-----RRRKYKLFACFLEASMVSCSDG----PVEFEVSIGNYGNKLDLSVPPSSSTTPPTNAVYDG--------CY--------------YYFLPWGDTKPCVCVESHWEDIGFRLGTKNILTRMCERLEVNMDKVNLSLEANAQPAETATLLISLLDQLINDVRKPLPKID---NNTPG--VNDLDLKLQEVRLMEKLSISEEAIKLRESATDVREALGEIEGFLQRLRDLTVEPQNSMPDVIIWMLSGTKRIAYYRIPAFDVLYEPYSEACGENCGQVQNIFMKYPGKKQQNIEDYPEVPAHVRMMIWLGL 648          

HSP 2 Score: 196.823 bits (499), Expect = 1.465e-50
Identity = 112/331 (33.84%), Postives = 169/331 (51.06%), Query Frame = 3
Query: 2805 PPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKY 3797
            P M I Y +   +QLRA++F AR+L+ SD  G+SD +AR++       T+ +  TL P WDQTLI D +  Y S + +  NPP +++E++D+D +        GK EF+GRC  KP V L  +   +PRL W+++ RG    GE+LAAFEL  V           I +++                         A+  G+  G   P        +G+  + VP  IRP +    +E L WGVR M++ QL SV  P I  E G   + S +I + +  PNF  PL + D+ LP+  LY PP+ I+  D R FGR  ++G H + ++ ++
Sbjct:  901 PRMFITYEKPHRYQLRAYLFQARDLLASDPDGVSDPYARVVFGTRSSVTETLARTLCPTWDQTLIFDEVNIYGSIEQVAENPPAVIIELYDKDPV--------GKDEFMGRCVVKPLVKLNGQGPPAPRLLWYDVERGDEYGGEILAAFELFLV----------SITKVQN------------------------ASKRGNDEGTDLP---FAPPMKGNLFL-VPNGIRPVMQRTAIEVLCWGVRNMKKFQLASVSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRKPMVGLHALKSLQRF 1185          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO36865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC3])

HSP 1 Score: 304.679 bits (779), Expect = 5.150e-93
Identity = 162/328 (49.39%), Postives = 211/328 (64.33%), Query Frame = 3
Query: 5217 FELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEP---LALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQL 6191
            FE++   P   +L I +MD+DLVS DD+IGET +DLENR+ ++++A CGL Q +   G N+WRD Q P  +L   C+  G   P+Y  L N   V +   Y   E EE          P   LAL V+       N   +VPEH+ETR L+NS +P I+QG L+MW+D+FPK LG P  P +I+PR+P  YELRVIIWNT DVIL +  + TGEK SDI+VKGW+ G   D Q TDVHYRSL GEGNFNWRFIF F Y+ AE  +V K K   +++DETE + P +L +Q+WD D  + DDFLG LEL L+++P+ AKS + C L QL
Sbjct:    2 FEMNATIPIIKDLKISLMDYDLVSRDDLIGETVVDLENRFLTRYRACCGLPQTYCTSGINQWRDSQTPRQILDLFCESQGKGRPQY--LGNMKLVLDNRVYTLQEFEEGMIHHPHLGAPEQRLALHVL-------NSMPVVPEHVETRSLYNSLQPNIEQGKLQMWVDIFPKHLGTPGAPFNISPRKPAEYELRVIIWNTSDVILEETSI-TGEKMSDIYVKGWLAGAD-DPQKTDVHYRSLDGEGNFNWRFIFPFMYLPAEKIMVVKKKVHFWSLDETEERVPLRLIIQIWDNDQFSPDDFLGQLELTLNRMPKPAKSARKCNLGQL 318          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO34141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ91])

HSP 1 Score: 314.309 bits (804), Expect = 1.551e-89
Identity = 193/548 (35.22%), Postives = 303/548 (55.29%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNND---PVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNK---VTVAEVAFYAD--AEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQV-TDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLH-----QLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPD 6413
              ++P  LE++  +E    F+ +FPL++G+   ++E  D  +VG  K +  +Y ++++    +V      L+ S        P++ +VR+Y+I   DL   D +G  DPYL++ +G K  + +++Y  K LNP+FG+ FE     P   +L I VMD+D +S DD+IGET IDLE R  S + A CGL + +   G   WRD + P  +L ++C + G + P +    ++   V V E  F  +   + + ++ E   S + L+L  +       +   +VPEH+ETRPL++  +P I+QG L++W+D+FP   G+   PI+I PR+P  + LRVIIW+T DV L +  + TGEK SDI++KGW++   ID+++ TDVHYRSLSG+GNFNWR  F F ++  E K+    K      +  E+K   KL +Q+W+ D  + DDFLG   L L ++P+   + + CG       + N D     +        RGWW     +    K     GK+D   ++L+ EE +A PVGLGR+EPN  P    P+
Sbjct:  407 LTIFPKELEKMG-YEELQDFVSSFPLKRGKAKHEDEE-DEGVVGELKASFRVYPLEEDTRPDDVPR----LHGSHQETHRKWPLKCIVRVYIICGMDLQSQDTDGFGDPYLVVSIGKKEFSTRKDYKKKTLNPVFGEMFEFHASIPSSKDLKITVMDYDRLSRDDLIGETTIDLEQRLLSGYHATCGLPKTYFKSGPYAWRDSKTPKEILREVCLDRGLNRPDFYHKGDQAVTVVVGEDQFNIEDLDDYQLESNELGSSEQRLSLHAL-------HAMGMVPEHVETRPLYSPLQPRIEQGKLQLWVDIFPCTEGSIKPPIEIEPRKPKDFVLRVIIWDTTDVELQETSI-TGEKMSDIYLKGWLE--EIDEKLKTDVHYRSLSGDGNFNWRMEFPFSFLTIEKKLHLSKKKLWGKCE--EVKVDAKLKIQIWENDKFSPDDFLGTRSLPLHRLPKPCSNSRWCGTKYDPGVRQNPDDDFVDLFTLHTHSIRGWWACWQHDSPSGKP---KGKVDMSLEILTAEEAKARPVGLGRSEPNQHPYLPEPE 933          

HSP 2 Score: 177.948 bits (450), Expect = 5.441e-45
Identity = 104/284 (36.62%), Postives = 160/284 (56.34%), Query Frame = 3
Query:  726 KTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISR-LLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVF-NECIATHYIDLSQI 1571
            K + +Q+ + + E RQ+ G NI+PL+ V +G K ++T V+ STNSP YNQ L F FH S+AELFD+++ L          SR  L   L+G F  D+ T+Y  PDH FL KW +L       S  +GY+KV   ++G G++       A      N+     +NLLLP     G +RQ A   +++Y AEDLP+  + I+  +K A   + K  VDP++  SF G   +TK + +   P +N+ +    M P++C  I++ ++DWD+   ++CIAT Y+ LS+I
Sbjct:   17 KPQHYQVRVKIHEGRQIPGTNIHPLVRVSVGNKKQSTSVKRSTNSPTYNQTLFFNFHASEAELFDELMTLEVFN------SRTFLSDSLLGFFESDIGTLYELPDHAFLRKWVLLTGAGVQESEDEGYLKVTAMVLGPGDEPPLSVFVAIV----NNYNFFGSNLLLP----AGVRRQQAVFQLRVYFAEDLPQ-KSAILFFLKSA--EERKKSVDPYLTFSFCGKQIQTKTQHHENNPVFNQMLQLPVMLPSMCENIKLQLWDWDSFSKHDCIATAYLPLSEI 283          
BLAST of Otoferlin vs. Ensembl Medaka
Match: otofa (otoferlin [Source:NCBI gene;Acc:101155482])

HSP 1 Score: 862.448 bits (2227), Expect = 0.000e+0
Identity = 501/1359 (36.87%), Postives = 750/1359 (55.19%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRG-KDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADD----ISIDSHGMGS--DKRTLIDPQTGE--IGEFNYGQTDNESIESGEDDE-------------------------SFAATNARTLGVP-------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGA--KVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLD----------------------------SEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHV---------SPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGY-------SNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEE---PAKKVITNTSSPNQQNNLET 3887
            MALV++LK V +L  + DRI K++FR     ++V     D  +F E F+WP+  +LD  + LE++++ YSK  +N+L+G+  + LQK+ E+  +   + LID N++ I+ +V+ E+ Y + D     W   EF     DR    A +    +S  SHG  S   ++ L   + G+        G+  N   +    DE                         S A+  A T  V        + + P   +  D+QISITV+EARQL G N++P++ V +G+  K T ++ STN PYYN+Y  F+FH+    LFD++I+L  +   N+    L  G L+G F+MDV TVY  P+H F HKWA+L DP DI +G KGYVK D+ ++GKG+ +K   K+      + D++DIE NLLLP+ I    +RQ A   VKIY+AE LP+MNT IMA +K A  G+++ LVDP+VQV FAG  G+T V+K++Y P WNE+IVFTE+FP LC RI+V + D D V +  I TH+IDL +I N+GD GFLPT GP+WVN+YG+ R YT   +M   ++LN G+GEGV++R RLL+++   +L + S  + + +  +V  V  IS+   GK E F L G+F EA+++D +IG K  PI FE+++G  GN++D                            SE   EEE ++ SV             STT  M P   D+ YFHL + EKKPC+Y+ S+ +D + R +  NI++K+ ++    +  + E+   E+     R++  L+           S+ C R V         + +T LD+ER+K     L+ M  +AK +     K  +  RLK  ++ +++L  L   PQ+ +PD+FIW++ + KR+A+ARIP+++ILYS + EE G    +V   FL+ PG+   GP+GWT+Q +L++YLWLG+ R  K F  GLP G+           F    PP+ ++Y+ K  FQLRAHM+ AR+L  +D SGLSD FAR+  + H   T+V+ ETL P WDQ L+ D +  +     +  +PP++VVE++D+D +        GK+EF+GR F KPT+ + +E Y  PR    L +++IYRG   AGELLAAFEL+Q+   +G +                                           D+ P EG T +  G  ++PVP  IRP L  YR+E LFWG+R+++R+ L  VD+PR+ IE     + S +I + K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR IL+G H +S++ +++      T      A  VI N  +  Q   ++T
Sbjct:    1 MALVVHLKKVSHLRGKGDRIAKVSFRGLPLCSRVAENCGDVAHFNETFRWPIASRLDENEMLEIQVFNYSKVFSNRLVGTFCMVLQKVAEEGHLELTDTLIDENNTSIKTSVTIEIRYQAMDGSTGTWIDGEFLEVPDDRDGVFAFETDSLLSGQSHGRCSRPGEKGLWRHKAGKGVFSAMKLGKIKNSKDDHKRADEPAVLDMEDLDRKAKRLAGTLEPDTISLASVTAVTTNVSNKRSKPDIKMEPGSGRPVDYQISITVVEARQLIGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVLFDKIIKLSVIHSKNL----LRSGTLVGTFKMDVGTVYFQPEHQFYHKWAILSDPDDITAGCKGYVKCDIAVVGKGDNIKTPHKAN-----ETDEDDIEGNLLLPEGIPA--ERQWARFYVKIYRAEGLPKMNTTIMANVKKAFIGENRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIVFTELFPPLCKRIKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRQYT---LMDEHQDLNEGIGEGVSFRARLLVSVAVEILDTTSPEIISSSDVQVEGVSNISESATGKMEEFFLFGSFLEATMVDRKIGDK--PITFEITIGNYGNQIDGVSKSPAAKKKKKDGENEEDENELILNSSEDEAEEEGDLVSV-------------STTPLMKPVITDRNYFHLPYFEKKPCVYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAFPERRLRGVLEEL---------SVGCSRFVALANKDVNLAGRTKLDRERLKSCMRELDSMGQQAKQLRTQVKKNTVKDRLKLAQSFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPSKDILYSTVEEETGKDCGKVKAAFLKLPGKKSFGPAGWTVQAKLELYLWLGVNRQRKDFLSGLPNGFEEVKAVEGGPGF-LSLPPLSLVYSMKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDDVELFGEASELREDPPIIVVEIYDQDTV--------GKAEFIGRTFAKPTIKMCDEHYGPPRFPPQLEYFQIYRGNCTAGELLAAFELLQI--GQGGK------------------------------------------ADLPPIEGSTDSERGP-ILPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQVDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGTHAVSSLRRFIYSPPDKTSNNWASAGDVIVNLDTEPQIRKMDT 1267          

HSP 2 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 315/583 (54.03%), Postives = 418/583 (71.70%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGRQDDDEESSDN--RIVGNFKGNLNIYKXXXXXXXXXXXXH--KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            EF  F  ++ TF L +G+  DD+E + +  RIVG FKG+L +YK+   E       +   + +++S+P+NDP+ +LVRIYV+RA DLHPAD NGK+DPY+++RLG   + +KENYI KQLNP+FGK F+++  FP ES L + V DWDLV  DD+IGETKIDLENR+YSK +A CG+   +  HGYN WRD   PT +L +LCKE   D P Y     KV VA   F    EIE++NG KKQ+ E LAL V+ +W ++P  GC LVPEH+ETRPL N +KPGI+QG +EMW+DMFP ++ AP   +DI+PR+P  YELRVIIWNT++VIL D    TGEKSSDIFV+GW+KG   D Q TDVHY SL+GEGNFNWRF+F F+Y+ AE+KIV   K+S F+ DETE K P +L LQVWDAD  +ADDFLG +EL L++ PRGAK+ + C L  +  +  + TISIFK KR +GWWPF   +E+D  E+++ GK++AE  L++ EE E  PVGLGRNEP+ L  PNRPD+S + F+ PLKS++Y I + ++W ++KAL +  LL +L LF+Y+ PGYL K++LGA
Sbjct: 1378 EFGNFEDWLHTFNLYRGKAGDDDEHALDDDRIVGRFKGSLCMYKLPLSEEITREAGYDPNMGMFQSIPHNDPINVLVRIYVVRATDLHPADINGKADPYIVIRLGKTEVKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRFYSKFRATCGISSSYSVHGYNIWRDPMKPTQILTRLCKEGKIDGPHY-GPGGKVKVANRIFTGPTEIEDENGLKKQTEEHLALTVLNHWEEIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPSDMPAPGPALDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFEYLVAEEKIVISKKESMFSWDETEYKIPPRLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSLDMIRNEHELPTISIFKQKRVKGWWPFVARDEND--EMELTGKVEAELHLVTAEEAEKSPVGLGRNEPDPLEKPNRPDTSLMWFLGPLKSIRYFIWHNYRWLILKALGLILLLLMLGLFLYSIPGYLVKKLLGA 1957          
BLAST of Otoferlin vs. Ensembl Medaka
Match: otofb (otoferlin-like [Source:NCBI gene;Acc:101160130])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 421/1085 (38.80%), Postives = 641/1085 (59.08%), Query Frame = 3
Query:  654 DDESFAATNARTLGVP------LALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT-VLRSESGGLPAGAKVY--SVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDS--------EANEEEEKEVPSVNQGNRPKIPK----WCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKF-----RRPPMEIIYTE-KSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPR----LTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVE-FLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGK 3812
            D  S A+  A T  V       + + P+  +  D+Q+S+TVIEARQL G N++P++ V IGE  K T ++ STN PYYN+Y  F+FH+    +FD+++++  +   N+    L  G L+G F++DV T+Y+ P H F HKWA+L DP DI +G KGYVK D+ ++ KG+ +K   K+      ++D++DIE+NLLLP+ +    +RQ A   +KIYKAE LPRMNT IMA +K A  G++K LVDP+VQV FAG  G+T V+K+ Y P WNE+I FTEMFP LC R+++ + D D V +  I TH++DL  I N+GD  FLPT GP+WVN+YG+ R ++   ++   +ELN GLGEGV++R RLLI++   +L + S  +    +V    VP IS+   GK E F L G+F EA++ID +IG K  PI FE+++   GN +D         E  + +E+E   ++  +  ++         +TT PM P   D  YFHL + E+KPC+Y+ S  +D K R +  NI++ + ++  + +  ++E+   E+     R++  L+   +  +  L      ++ S +T LDKER+KL    +E + ++AK M     K+ +  +LK  +  + KL  L   PQ+ +PD+FIW+I + KR+A+ARIP+++ILYS+I EEKG    +V T+FL+ PG+ G GP+GWT+Q ++++YLWLGL R  K +  GLP G+  +           PP+ + Y   K  FQLR HM+ AR+L  +D +GLSD FAR+  +     T+V+ ETL P WDQ L+ +++  +     +  +PP++V+E++D+D +        GK++F+GR F KP V + +E Y  PR    L +++IYRG   AGE+LAAFEL+Q+ P       NG                                       D+ P +G T    G  ++PVP  IRP L  YR+E  LFWG+R+++RV L  VD+PR+ IE     + S +IP+ K  PNFS  +K+ ++ LPEN L  PPL I+  D R FGR  L+G++ +S++ K++ +G+
Sbjct:   23 DTISLASVTAVTTNVSNKSKPEIKMEPSSGRPVDYQVSVTVIEARQLVGLNMDPMVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNL----LRSGTLVGTFKLDVGTIYSQP-HQFYHKWALLSDPDDITAGGKGYVKCDIAVVAKGDTIKTPHKAN-----ESDEDDIESNLLLPEGVPA--ERQWARYYLKIYKAEGLPRMNTSIMANVKKAFIGENKDLVDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIAFTEMFPPLCRRMKIQLRDSDKVNDVAIGTHFLDLRNISNDGDK-FLPTLGPAWVNMYGSTRTFS---LLDEYQELNDGLGEGVSFRARLLISLGVEILDTSSPEISCSTEVQVEGVPNISESATGKVEEFFLFGSFLEATMIDRKIGDK--PINFEVTI-YYGNEIDGALQPKPKGEKGKGDEEETELIHNSSEEEMEDDGDLTSVATTPPMKPVITDN-YFHLPYFERKPCIYIKSLWQDQKRRLYNSNIIDNIADKLEDGLNDVNEIIKTEKAYPERRLRGVLEELSQGCQF-LALANKDQNQSGRTKLDKERLKLCLSEVEAIGLQAKAMRSQVKKSTVRDKLKLSQNFLSKLRFLADEPQHSVPDVFIWMISNGKRIAYARIPSKDILYSSIDEEKGKDCGKVKTIFLRIPGKKGFGPAGWTVQSKIEIYLWLGLTRQRKDYLNGLPNGFEENKLSKGPGLPSTPPISLTYMSVKQIFQLRVHMYQARSLFAADSTGLSDPFARVFFSTQSQVTEVLAETLCPTWDQLLVFENVELFGEAVELRDDPPIIVIEIYDQDTV--------GKADFMGRTFAKPVVKMADEHYGPPRFPPQLEYYQIYRGNCAAGEMLAAFELLQIGP-------NG-------------------------------------KADLPPIDGPTDMDRGP-ILPVPLGIRPVLSKYRIEQVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSALIPNFKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSNAVSSLRKFIYRGQ 1033          

HSP 2 Score: 555.444 bits (1430), Expect = 1.621e-165
Identity = 280/533 (52.53%), Postives = 375/533 (70.36%), Query Frame = 3
Query: 4815 KVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESS---DNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSP 6401
            +VYP  LE   EF+ F  ++ TF L +G+  DD++ +   ++RIVG FKG++ +YKV D+          + +++++PNNDPV +LVRIYV+RA DLHPAD NGK+DPY+ ++LG   I +KENYI KQLNP+FG  F+++  FP +S L + + DWDLV  DD+IGETKIDLENR+YSKH+A CG+     NHGYN WRD   PT +LAKLCK+   D P Y     +V V    F A  EIE++N  KK+++E LAL V+ +W ++P  GC LVPEH+ETRPL + +KPGI+QG +E+W+DMFPKE+ AP   +DI+PR+P  +ELRVIIWNT++V+L D  + TGEKSSDIFV+ W+KG   D Q TDVHY S++GEGNFNWRF++ FDY+ AE+KIV   K+S FA DETE K P +L LQVWDAD  +ADDFL  +EL L++ PRGAK+ + C +  +  +  +  +SIFK KR +GWWPF   NE+D  E ++ GK++AE  LL+ EE E  P G GRNEP  L  P
Sbjct: 1111 EVYPKELE--SEFDNFEDWLHTFYLFRGKAGDDDDQTVADEDRIVGKFKGSMCMYKVSDDAPRDMSFDSNMGMFQNIPNNDPVNVLVRIYVVRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPLFG-SFDVEATFPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGVA----NHGYNVWRDPMKPTHILAKLCKDGKLDGPHY-GPGGRVKVENRVFMAPTEIEDEN-LKKKTDEHLALCVLTHWEEIPRVGCKLVPEHVETRPLLHPDKPGIEQGRIELWVDMFPKEMTAPGPALDISPRKP-KFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVR-WLKGQQEDKQDTDVHYHSITGEGNFNWRFVYPFDYLMAEEKIVISKKESMFAWDETEYKIPPRLNLQVWDADHFSADDFL-AIELDLNRFPRGAKTAKQCTIEMVTNEAEMPMVSIFKQKRIKGWWPFVARNEED--EFELTGKVEAELHLLTGEEAEKSPAGEGRNEPEPLEKP 1629          
BLAST of Otoferlin vs. Ensembl Medaka
Match: ENSORLT00000022822.2 (pep primary_assembly:ASM223467v1:21:28315623:28320348:1 gene:ENSORLG00000018220.2 transcript:ENSORLT00000022822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 444.891 bits (1143), Expect = 1.460e-138
Identity = 252/577 (43.67%), Postives = 360/577 (62.39%), Query Frame = 3
Query: 4848 EFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPN-GCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRML 6575
            +F  F  ++ T+ L +G+ +++E SSD R VG FK    +YK+ +EE+G   D     + + +P N PVQ+L+R+YV+ A++LHPADP+GK+DPY++LRLG   I +++NYIPKQLNP+FG  FE+   FPQES L + + D+DLV GDD+IGET+IDLENR+YS+H+A CGL   + + GYN WRD   P+ +L+K+C+E G D P++     K++VA+  F+       +  +  +S E L+L+++  WS++P  GC LVPEH+ETR L+N  +PG+ QG ++MW+DMFP +L  P  P+DI+PR+P  YELR+IIWNTEDVIL D   LTG++SSDI+VK                                          +V + +D+ F++D+TE K P  L LQVWD + +++DDFLG LEL L   P GAK+ + C    L   G    ISIF+ KR RGWWPF+   E       + GK++AEF L++ EE E  PVG  R EP  LP P RPD+SF  FMNP K   +L+   +K ++I ALI+  L   L L  Y  PG ++++M+
Sbjct:    9 DFGQFDDWVNTYELFRGKANEEEGSSDERFVGKFKARFCLYKLAEEEWGEGSDPGFFRVSRGIPANSPVQVLIRVYVVSASNLHPADPDGKADPYIVLRLGKNEIKDRDNYIPKQLNPVFG-SFEMQATFPQESLLSVVIYDFDLVGGDDLIGETRIDLENRFYSRHRATCGLPTEY-SEGYNAWRDSLKPSELLSKMCRENGLDAPRFSP--GKISVADKVFHGKTLYMHE--QPVESYEHLSLKILHRWSEIPAVGCKLVPEHIETRVLYNKARPGMDQGQVQMWVDMFPMDLPHPGPPVDISPRKP-KYELRIIIWNTEDVILDDSNFLTGQQSSDIYVK-----------------------------------------VVVVRKRDNIFSLDKTEQKLPAILILQVWDFETLSSDDFLGTLELDLHGFPPGAKTAKACKAEMLT--GRTERISIFQQKRARGWWPFSKSGE-------LTGKVEAEFHLVTAEEAEKNPVGRARKEPEPLPKP-RPDTSFSWFMNPFKCFFHLVWRNYKKYIITALILFILALFLALLFYTLPGAISQKMI 527          
BLAST of Otoferlin vs. Ensembl Medaka
Match: myof (myoferlin [Source:NCBI gene;Acc:101172285])

HSP 1 Score: 332.028 bits (850), Expect = 8.251e-92
Identity = 223/700 (31.86%), Postives = 367/700 (52.43%), Query Frame = 3
Query:  711 HPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIK--MAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVF-NECIATHYIDLSQIMNEG----------DTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVE-----ILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKN-SEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTF 2753
            H    K +D+QI + V+EARQL G NI P+++V +  +T  T ++ S N+P++++   +  HM  ++LF+Q I  R     ++    L+     GEF++DV  VY+ P H  + KW +L DP D  SGAKGY+KV L ++G G++         K+  D+D +DIE+NLLLP     G   + A + +K+++AED+P+M+   + +IK       + K LVDPF++  FAG    T++ +    PEWN+ +     FP++C R++++V+DWD +  N+ + T Y+DL++I + G          + GFLP FGP ++NLYG+PR +T   +  P ++LN G GEGVAYRGR+L+ + T L  ++        +     IS      +  + L   F+ AS+I     +  +PI FE+S+G  GN+LD+                      K   STT+      +  +Y++L +   KP + + S+ ED   R    NI+  + +   + +E     IL ++  N+     L++   LD  IE++E        +   S  T LD +  K   + L  ++     M Q+ ++  +   L +    + KL +L   PQN +PD+ IW+++  KR+A++RIPA EIL+S   E+   KN  +  TVFL+ P        G  +  Q+++ +WLGL  D K F
Sbjct:  167 HRLATKPQDFQIRVRVVEARQLPGNNIKPVVKVHVCGQTHRTRIK-SGNNPFFDEMFFYNVHMLPSDLFEQSISFRVYNSYSLRADSLM-----GEFKLDVGYVYDEPAHCVMRKWLLLNDPDDSSSGAKGYLKVSLFVIGTGDE-----PLVEKRDCDDDQDDIESNLLLP----AGMTLRWATLSLKVFRAEDIPQMDDAFVQSIKEIFGAEENKKNLVDPFLEARFAGKKLCTQIIEKNANPEWNQVLHLQVKFPSMCERVKLTVFDWDRLTGNDAVGTTYLDLAKIASSGGEIEGNPVESEVGFLPVFGPCYINLYGSPREFT--GLPDPYDDLNFGKGEGVAYRGRILVELSTKLDEKAEKTIDNIHIKRTSIISI----LRRKYCLCAVFHSASMIQ----EPGEPIQFEVSIGNYGNKLDTTC--------------------KPLASTTQYSCAVFDGNQYYYLPWANTKPVVVLTSFWEDISHRLNAVNIILCITHRLQSNLEAFKVAILAKVPDNKLAEVWLQL---LDQLIEDLERF--PTPELEGCSNLTSLDIQLKKRRDITLNSIKEAVLRMRQEASE--IRDTLSDIETWVDKLKQLAEEPQNSMPDVVIWMLRGEKRVAYSRIPAHEILFSTYSEQACGKNCGKTQTVFLKYPMD---KAKGLKVPVQIRVSMWLGLSADEKKF 811          

HSP 2 Score: 156.377 bits (394), Expect = 1.893e-37
Identity = 105/362 (29.01%), Postives = 167/362 (46.13%), Query Frame = 3
Query: 2790 FKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAK--KVITNTSSPNQ 3869
            F    P +   +     + LR +++ ARNL+  D+   SD +A +       TT+ +  TL+P WDQTLI + +  Y     I   PP +V+E +DEDQ+        GK E LGR  C P V L  E  +SPRL W  I +    AGE+L A ELI                                          L +  GD +  + P     + AE  ++  VP+ IRP +    VE L WG+R M+  QL SV  P + +E G   + + +I + K  PNF   + ++ ++LP++ +Y PP++++  D R FGR  ++G   I+++  +     +   E A+  K+    +SP++
Sbjct: 1071 FGANTPTVSCTFDRSYMYHLRVYVYQARNLMSMDKDSFSDPYAHVSFLHVSKTTEKLKATLNPTWDQTLIFNSVEIYGDPQKIAHRPPDVVLEFYDEDQV--------GKDEMLGRSICTPLVKLSPEMDQSPRLFWHPIIQKGQRAGEVLVAAELI------------------------------------------LKDKSGDSDLPLLP----PMRAENLYM--VPQGIRPVVQLTAVEILAWGLRNMKPYQLASVSSPSLVVECGGQRVETAIIKNMKKSPNFPGNILFIKVLLPKDEMYTPPIVLKVIDHRPFGRKPVVGQCTIASLEDFRCDPYVIVSEGARSSKMALMMASPHK 1376          

HSP 3 Score: 70.8626 bits (172), Expect = 2.085e-11
Identity = 40/103 (38.83%), Postives = 56/103 (54.37%), Query Frame = 3
Query: 4812 FKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGK 5120
             KVY   LE V EF+G   F  TF LQ+G+ D+ +E  D  +VG FKG   +Y + D+             ++ LP + P + LVRIY++R  DL P D NG+
Sbjct: 1424 LKVYDNELENVPEFKGLTDFCNTFKLQRGKNDNGDE--DPTVVGEFKGAFKVYPLPDDPGIAPPPRQ----FRELPESGPQECLVRIYIVRGIDLQPKDNNGR 1520          
BLAST of Otoferlin vs. Ensembl Medaka
Match: myofl (myoferlin [Source:NCBI gene;Acc:101156429])

HSP 1 Score: 314.309 bits (804), Expect = 1.007e-85
Identity = 209/572 (36.54%), Postives = 302/572 (52.80%), Query Frame = 3
Query: 4806 ERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFK-GNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYE----ALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQL-NKDGSVST----ISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPS--PNRPDSSFLNFMNPLKSLKYLICNKFKWF 6485
            +  KVY C LE+V++F+G   F +T  L +G+  DD+E  D  +VG FK G+  IY + D+             +K LP + P + LVRIYV+R  ++   D NGK DPY+ + LG K +++++NY P  L+P FG  FEL    PQ+ +L I V D+D  S D+ +GET IDLE+R  S  +  CGL Q + + G N+WRD   P+ +L  + K  G  PP  E    +L+       +  +A+  I    G +K   E L+L V++N         LVPEH+ETR L +S K  + QG ++MW+D+FPK LG P  P +I+PR+   Y LRVIIWNT DVIL D  + T EK+SDI+VK                      E  +NW                          D+TE ++P KL +Q+WD D ++ DD+L  +EL L ++   AK+P+ C L  L    G+V++     S+F  K  RGWWP    N  +   +   GK++   +++ ++E E  P G GRNEPN  P   P RP +SF  F N    LK++   KF+W 
Sbjct: 1307 DTLKVYNCELEKVEQFQGLTDFCRTINLHQGKTVDDDE--DPSVVGQFKQGSFKIYPLSDDPSVPAPPCQ----FKELPESGPQECLVRIYVVRCIEVQSKDSNGKCDPYIKITLGKKTLDDRDNYKPNTLSPEFGM-FELSCTLPQDKDLKIAVYDFDKWSRDEEVGETVIDLEDRLLSYFRPCCGLPQTYCS-GVNQWRDQLKPSQILQNVAKMRGVPPPSIEEDGRSLLFSGKRYHLQDFANILIHSHLGPEK---ERLSLHVLRNLG-------LVPEHVETRTLSSSYKSNLSQGRIQMWVDIFPKRLGLPGPPCEISPRK-AKYFLRVIIWNTSDVILDDASI-TAEKTSDIYVK---------------------QEQFWNW--------------------------DKTEYRNPPKLIVQIWDNDRISLDDYL-SVELDLLRLVPPAKTPEKCTLKMLPGMKGTVASKAKPTSLFSRKSVRGWWPCA--NAQNGSCVLTQGKVEMTLEIVDEKEAEERPAGRGRNEPNMNPKLDPPRPATSFAWFTNVSSILKFMTRIKFRWI 1808          

HSP 2 Score: 252.677 bits (644), Expect = 8.155e-67
Identity = 197/698 (28.22%), Postives = 325/698 (46.56%), Query Frame = 3
Query:  714 PTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAI--TGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEG---DTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVP--PISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILH---ELHMNERRGTHLRMKNALDTFIENI-----ESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEK-GVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQ 2759
            P   + +D+QI + VIE R L G +I P++ V    KT  T V+   N+P++++   +  +MS ++L D+                                      H  + KW +L DP D   GA+GY+KV + IMG G++   + +         + +D+E+NLL+P     G   + A + +K+Y+AED+P+ +  +  T+K  +   GD K LVDP+++VSFAG    TK+ +    PEWN+ I                      V ++ I T +++LSQI + G   + GFLP FGP +VNLYG+PR Y    +    EELN G GEGVAYRGR+L+ + T L  +         V  +P   +      ++  + L   F+ A ++    G    PI FE+++G  GN+LDS                 +P +      +T P      D  Y++L + + KP + + SY ED   R    NIL    ++  + + +L         E R T + +K  LD  IE +     E  LN           T+LD ++  L +  +  +   A  M ++    ++   + +    + ++ +L   PQN +PD+ IW+ +  KR+A+AR+PA +ILYS+  ++  G    ++ T+F+Q P        G  +  +L+  +WLGL    K F +
Sbjct:  143 PLASEAQDFQIRVRVIEGRHLPGIDIKPVVRVLFDGKTHRTNVR-GGNNPFFDEMFFYNVNMSLSDLSDE--------------------------------------HAIMRKWLLLKDPDDSTMGARGYLKVSIIIMGTGDEAPIENRLFRA-----EQDDLESNLLVP----AGVSMRTATLSLKVYRAEDMPQDDATVQ-TLKQFLGGEGDKKNLVDPYLEVSFAGKKVCTKIIQKNANPEWNQLISLN-------------------VKDDVIGTTFLNLSQISHSGGNVEVGFLPAFGPCFVNLYGSPREY--GDLPDRFEELNFGNGEGVAYRGRVLVELSTHLDKK-----VEKNVDDIPRDDVLVAQFQRRRRYSLCSVFHSACMLQEPGG----PIRFEVTLGNYGNKLDSTC---------------KPLV------STTPNCFAVFDNHYYYLPWADTKPVVILTSYWEDISHRLDAINILLFTADQLESNLNLLKTAISAKEPESRLTEIWLK-LLDHIIEELVLPALEDRLNV----------TVLDLQKKNLREAAVYNIMQMACCMKEEAR--DIGSTVADIEDWLDRIKQLAEEPQNSMPDVIIWMFRGEKRVAYARVPANQILYSSFSKQACGKHCGKIQTIFMQYPMDKN---KGVKIPAELRFNMWLGLSVHEKEFSR 724          

HSP 3 Score: 72.7886 bits (177), Expect = 5.583e-12
Identity = 42/131 (32.06%), Postives = 65/131 (49.62%), Query Frame = 3
Query: 2841 FQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAG 3233
            + LR +++  RNL   D +  S  +A +       TT V+  TL+P WDQTLI + +  +     + S PP +V+E++D DQ+        GK E +G C   P + L+      P+L W  I +   NAG
Sbjct:  980 YHLRVYIYQGRNLCPMDHNSFS-PYAHVSFLHMSKTTHVIQNTLNPIWDQTLIFEDIEIHGDPQTVASCPPEVVLELYDSDQV--------GKDEPMGHCKYPPLINLQPNIGCRPKLQWLPITKKGHNAG 1101          

HSP 4 Score: 52.373 bits (124), Expect = 7.521e-6
Identity = 31/109 (28.44%), Postives = 59/109 (54.13%), Query Frame = 3
Query: 3474 VPKEIRPSLVPYRVE-FLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKY 3797
            VP+ I+P +    +E  L WG+R M+  QL  V  P + +E G   + + +I + K  PNF   +  +  +LP+  +Y PP++++  D + FG   ++G   I ++ ++
Sbjct: 1132 VPQGIKPVVQLTAIEQVLTWGLRNMEAFQLSPVSSPSLIVECGGETVKTAIIKNFKKNPNFPGSVLLL-KLLPKEEMYAPPIVLKVIDHKPFGWKPVVGQCTIRSLGEF 1239          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000037807.1 (SMESG000037807.1)

HSP 1 Score: 4113.53 bits (10667), Expect = 0.000e+0
Identity = 2156/2162 (99.72%), Postives = 2160/2162 (99.91%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIXXXXXXXXXXXXXXXXXGLGVVELKKKAKIPKDELQDIDWWSRYYVXXXXXXXXXXXXXXXXNLDVLKDIEVDVKSDDDQGGLAEIPEDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIFAKLPFGRVXXXXXXXXXXXXXXXXXXXNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            MALVLNLKYVDNLDNRCDRI+KINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIA+WRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNES+ESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGI RIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGD+TPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIPEIVPVKPKESVVEPIKGLGVVELKKKAKIPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDD EDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKVDDEEFGVEVDVHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYNAPGYLAKRMLGA
Sbjct:    1 MALVLNLKYVDNLDNRCDRIVKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIANWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESVESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIPRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDITPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIPEIVPVKPKESVVEPIKGLGVVELKKKAKIPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDDFEDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKVDDEEFGVEVDVHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYNAPGYLAKRMLGA 2162          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000037807.1 (SMESG000037807.1)

HSP 1 Score: 4091.58 bits (10610), Expect = 0.000e+0
Identity = 2148/2162 (99.35%), Postives = 2152/2162 (99.54%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIXXXXXXXXXXXXXXXXXGLGVVELKKKAKIPKDELQDIDWWSRYYVXXXXXXXXXXXXXXXXNLDVLKDIEVDVKSDDDQGGLAEIPEDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIFAKLPFGRVXXXXXXXXXXXXXXXXXXXNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            MALVLNLKYVDNLDNRCDRI+KINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIA+WRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNES+ESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQM        GKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGI RIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGD+TPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIPEIVPVKPKESVVEPIKGLGVVELKKKAKIPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDD EDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKVDDEEFGVEVDVHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYNAPGYLAKRMLGA
Sbjct:    1 MALVLNLKYVDNLDNRCDRIVKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIANWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESVESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQM--------GKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIPRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDITPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIPEIVPVKPKESVVEPIKGLGVVELKKKAKIPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDDFEDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKVDDEEFGVEVDVHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYNAPGYLAKRMLGA 2154          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000037807.1 (SMESG000037807.1)

HSP 1 Score: 4011.84 bits (10403), Expect = 0.000e+0
Identity = 2115/2162 (97.83%), Postives = 2119/2162 (98.01%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIXXXXXXXXXXXXXXXXXGLGVVELKKKAKIPKDELQDIDWWSRYYVXXXXXXXXXXXXXXXXNLDVLKDIEVDVKSDDDQGGLAEIPEDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIFAKLPFGRVXXXXXXXXXXXXXXXXXXXNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKXXXXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFXXXXXXXXXXXXXXXXXXXXXPGYLAKRMLGA 6581
            MALVLNLKYVDNLDNRCDRI+KINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIA+WRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNES+ESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGI RIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGD+TPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTE                                         DDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIPEIVPVKPKESVVEPIKGLGVVELKKKAKIPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDD EDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKVDDEEFGVEVDVHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYNAPGYLAKRMLGA
Sbjct:    1 MALVLNLKYVDNLDNRCDRIVKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIANWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESVESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIPRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDITPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTE-----------------------------------------DDETTAAGNLSSARKSSTNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSEKIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSETKFGVKILKSIPEIVPVKPKESVVEPIKGLGVVELKKKAKIPKDELQDIDWWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPEDEEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEEKDDDDFEDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDNRIVGNFKGNLNIYKVDDEEFGVEVDVHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYNAPGYLAKRMLGA 2121          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010367.1 (SMESG000010367.1)

HSP 1 Score: 918.687 bits (2373), Expect = 0.000e+0
Identity = 491/1327 (37.00%), Postives = 777/1327 (58.55%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESG--EDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAIS-RLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDE-DIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEG---DTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMG-PSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMS----------------VDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTN 4004
            M+L +NLKY+D      D+ +K+ FRD EK +  ++   +IYFG++F WP+ RK+D  D L L+ Y  ++   +KL+G + I+   L+ +  ++ +ENL+D    I  I V+FE+ Y+SP +   ++  D F  P+ + K          +    S K TL    + +  E  Y   D +  ++   +D    +    R   +P  + P   K ED+QIS+T++EAR L G NINP+ EV  G++ + TE++M TNSP+YN++  F+  MS+ E+ + +I++R L+  N  ++ R+  G ++GEF +D ++VY    H F  KWA L+DPK   SG KGYVKVD++++  G++             DN++  +IEANLL+P  + + T R+M E+ V IY+AEDLP MNT+I++ IK AI G+ K L D +V+VSFAG+TGRTKV    Y+P+WN++I+FTE FP    R+R++V D D V +E I+T +IDL +IM  G   + GFLPT+GPSW+NLYGTPR +TY Q+++  +  N+ L EGVAYRGRL+IAIKT  + +S  +  G  V    P+S+   GK+E +LL G  YE ++I+ ++GK  +P+ FE+S+G TGN LD  A    E +              + HS T+     T D +YFH+ +  KKPCL+MI+  EDH+ R FIPNI+EKLK E S  +     L + +       +K ++   I +IE  ++ +K  R  + KT+LD +  +L ++ LEKM+VK + +  +  ++N+  +++EC  ++K L + + +PQ GLPDIFI++IQ+  R+A+ARI AREI++S++  EKG+    + TV+L++     +   + + +Q QL++YLWLGLLRDM+ ++ GLP GY+ +CF  + PP  I Y ++S FQLR ++FMARN+IGSD+SGLSD FARI++ +HV  + +  +T SP WD+TLIID++IF Y+ D++ S+PP +VVE+FD D  T          EFLGR FC+P V ++ ++Y + +L WW IYRG + AGE+LAAF+L+++          G+  ++ + + +S I   R                    G++  N+           + +P+ IRP L  +R E L WGVR++QR++++                 V++P+ITI+     + SD I    ++PNF + L ++D+ LP +  +WPP+ I C +   FG   ++GN  I+N+  Y    ++       K   +  S    N      D        EG+ N  + +++ +A   L+  ++   N
Sbjct:    1 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLK----------TLKRTSKKVTLPSENSSDEDEEYYDSDDGDGRDNNIRDDISDISLLPDRDFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDK------PKRPDADDNEENPNIEANLLIPLCV-SNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKI--GVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKPTPENQ--------------YVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLRLEKNIQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIIGEHVAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDT--------DEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRF-------------------GEMDENK-----------LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPISINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDT-------EGILNEGFENEDGSAINELTDMKEEKPN 1249          

HSP 2 Score: 538.88 bits (1387), Expect = 1.860e-157
Identity = 278/607 (45.80%), Postives = 391/607 (64.42%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDN--RIVGNFKGNLNIYKXXXXXXXXX-------------------------------------XXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPK--------ELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKW 6482
            IER  +YPC LE VK+F GF    ++F L +G+Q++D+++ +N  R  G FKGN+ IY +D E+                                              L LYK+L + +PV  +VR+Y+I+A +LHP+D NGKSDPY+L++LG+K + ++ENYIPK LNP+FGKC EL+V FPQES LL+Q+ DWD ++ DD+IGET IDLENR+ S H+  CG+   + NHGY KW+D +LPT++L  LC+E+    P Y+ L ++V + + +F+A+  IE+D+G + +S EPLALEV+ +W ++  G  LVPE++ETRPL+  EKPGIQQG LEMW+DM+P    A P PIDI PR+ I YELR  +  TE V L +    T EK+ DIFVK WMK   ID Q TDVHY+SLSG+G FNWRF++NFDY+KAED IVY  K S + IDE E K+PC L +QV D+ ++ +D  +G  +  LSK P+ AK  ++C   QL++  + +  ++F+NK+ RGWWP       +PK          ++ G ++ E +L++ EE E+ PVGLGR EP  L +P RPD SFL+F+NP  ++KY I  + KW
Sbjct: 1390 IERITMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIDPEDAEDIDDEEEEDDFNDEDDEEEREEKERRREERELEKQEREDEKKKTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTVILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAG-TAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSE--ACAKFNLFRNKKVRGWWPLIY----NPKDEDSDEEDGEEIGGCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKW 1988          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010400.1 (SMESG000010400.1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 497/1342 (37.03%), Postives = 783/1342 (58.35%), Query Frame = 3
Query:   96 MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITD-----------RKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISR-LLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVXXXXXXXXXXXXDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDT---GFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAVEILHELHMNERRGTHLR-MKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMGP--SGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTGLRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMS----------------VDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDD-----ETTAAGNLSSARKSSTN 4004
            M+L++ L+ +  +    +  +K+ FRD +  T   + K S   G +F WP+ RKLD +D+L ++    +++  +KL G + I L  L+    I+  E  +D    I  I ++FE+ Y SP S   +  + +F  P  +           R  SD   +  DS    ++    ID + G+    NY +               +    R   +P  + P   K +D+QIS+T+ EAR L+G NINPL EV  G++ + TE++M TN+P+YN+Y  F+F +S+ EL +Q+IR++ L+  +  ++R + PG +IGEF +D +TVY+   H F +KWA+L+DPK   SG KG+VKVDL+++  G++          K    +D +IEAN+L+PQ I   T+R + E+ V +Y+AEDLP MNT IM+ IK AI GD K L DP+V+VSFAG+TG TKV   +Y+P+WN++I+FTE FP   +R+R++V D D + +E I+T +IDL +IMN  +    GFLPT+GPSW+NLYGTPR Y+Y +M++  +  N+ L EGVA+RGRLLIAIKT   S+   +  G  V S  P+S+   GK+E +LL  + +EA++I  EIGKK++P+ FELS+GTTG         +E   +P   +    +   + HS TEP    T D +YFH+ +  KKPCLYMI+  EDH+ R FIPNIL+KLK E    V  ++ L    ++   +R +K +++TF  +I+  L++IK  R  + KTLLD +  KL ++ LEKM++      +  +   + + +K+  + +K L++ + +PQ+GLPD+F+++IQD  R+A+ RI AR++++SAIP EKG     V TV+L+K   F + P  + + +Q QL++YLWLGLL+DM+ ++ GLP G+  DCF  + PP  I Y E+S FQLR +++M RNLIGSD+SGLSD F ++++ +H+  + V +ET SP WD+T+IID+++F Y+  ++ + PP +V+E+FD D  T          EF+GR FC+P+V +  +EY S +L WW +YRG M AG++L +F+LI++ P        G   +E ++  ++ +     NS   + E  L                            +P ++RP +  +R+E L WGVR++QR++++S                V++PRI IE G   + SD+I      PNF++ L  + + LP N  +WPP+ I C +   FG   ++GNHVI+++ +Y ++ KI           N    ++ ++L++   +  + A  +GV N A+ +      E T AG  S A+   TN
Sbjct:    1 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVKDGD----NYSE--------------LSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDK-----PKRPNKTDKEEDPNIEANILIPQ-ILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTT--SQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTG------ICPDEYSHLPKKEENFESQ---YVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKK-MNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTD--------EEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVN---DNSKGEKDEEKLR---------------------------IPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKI-----------NEDLDHESDHLQSLTAQFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTN 1257          

HSP 2 Score: 556.599 bits (1433), Expect = 1.245e-163
Identity = 283/598 (47.32%), Postives = 384/598 (64.21%), Query Frame = 3
Query: 4803 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSD--NRIVGNFKGNLNIYKXX----------------------------XXXXXXXXXXHKLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKE--------LDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKW 6482
            IER K+Y C LE +K++ GF    ++F L +G+Q+++++  +  +R  G FKGN+ IY V                               E  +  +   L LYK L +   V  +VR+YV++  +LHPAD NGK+DPY+L+R+GNK I ++ENYIPK LNPIFG+CFE++V FPQES LL+QV DWD ++ DD+IGET IDLENR+ S H+  CGL   + NHGY KW+D QLPT +L  LC++    PPKY+ + + V +    F +D+ IE+D+G + +S EPLAL V+ NW  +   C LV EH+ETRPL+  EKPGI+QG LEMW+DMFP     PP PIDI+PR+P SYELR++I  TE+V L+D    T EKS DI++K WMK   ID Q TD H+RSLSG+G FNWRF+F FDY+KAED IVYK K+  + IDE E K+PC L +QV D+DL+ +D  +G L+  LSK P+ AK  ++C   Q     + +  ++FKNK+ RGWWP       +PK+        L++ G ++ E  L+  EE E+ P GLGR EP  L  PNRPD SFLNF+NP  ++KY I  + KW
Sbjct: 1391 IERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNVQEDNIHEKDLFDEDHDESKLASFGEQDENKTEEELLNEKSNLKLYKFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPP-PIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNI-YEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQ--HSDACAKFNLFKNKKVRGWWPLVY----NPKDEDEEEENGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRLKW 1980          
The following BLAST results are available for this feature:
BLAST of Otoferlin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTOF0.000e+036.60otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
OTOF0.000e+036.60otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
FER1L61.480e-16335.52fer-1 like family member 6 [Source:HGNC Symbol;Acc... [more]
OTOF1.969e-10052.84otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
OTOF3.492e-10052.84otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
back to top
BLAST of Otoferlin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fer-11.753e-3730.40Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-11.753e-3730.40Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-12.152e-3730.40Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
ferl-15.189e-1420.25FER-1 Like [Source:UniProtKB/TrEMBL;Acc:O01596][more]
snt-54.767e-838.10SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700... [more]
back to top
BLAST of Otoferlin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfr1.772e-8635.29gene:FBgn0266757 transcript:FBtr0273291[more]
mfr5.938e-8235.29gene:FBgn0266757 transcript:FBtr0273287[more]
mfr1.224e-8135.29gene:FBgn0266757 transcript:FBtr0273290[more]
mfr3.560e-8135.29gene:FBgn0266757 transcript:FBtr0273289[more]
mfr5.473e-7734.95gene:FBgn0266757 transcript:FBtr0273285[more]
back to top
BLAST of Otoferlin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa0.000e+037.12otoferlin a [Source:NCBI gene;Acc:557476][more]
otofa0.000e+037.12otoferlin a [Source:NCBI gene;Acc:557476][more]
otofb0.000e+039.04otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
fer1l49.236e-13531.60fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GE... [more]
fer1l44.475e-13430.94fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Otoferlin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2v20.000e+036.73ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
ube2v20.000e+038.82ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
ube2v25.931e-17938.48ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
FER1L62.159e-16037.12fer-1-like family member 6 [Source:NCBI gene;Acc:1... [more]
FER1L64.484e-16136.26fer-1-like family member 6 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Otoferlin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otof0.000e+036.78otoferlin [Source:MGI Symbol;Acc:MGI:1891247][more]
Otof0.000e+036.44otoferlin [Source:MGI Symbol;Acc:MGI:1891247][more]
Fer1l64.532e-16036.50fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
Fer1l64.532e-16036.50fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
Fer1l41.914e-17528.70fer-1-like 4 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Otoferlin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SPC5|OTOF_DANRE0.000e+037.12Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1[more]
sp|Q9ERC5|OTOF_RAT0.000e+036.18Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE... [more]
sp|Q9HC10|OTOF_HUMAN0.000e+036.60Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=... [more]
sp|Q9ESF1|OTOF_MOUSE0.000e+036.78Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV... [more]
sp|Q2WGJ9|FR1L6_HUMAN7.107e-16335.52Fer-1-like protein 6 OS=Homo sapiens OX=9606 GN=FE... [more]
back to top
BLAST of Otoferlin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G0490.000e+054.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FUJ10.000e+051.34Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GRG10.000e+051.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H7D00.000e+058.71Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H3Y70.000e+055.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Otoferlin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa0.000e+037.41otoferlin a [Source:NCBI gene;Acc:557476][more]
otofb0.000e+038.75otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
fer1l63.632e-16035.08fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
fer1l41.652e-14631.00fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GE... [more]
myof6.704e-12440.94myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138][more]
back to top
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008905.10.000e+039.61pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 ge... [more]
ENSPMAT00000004363.10.000e+035.60pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 ge... [more]
ENSPMAT00000001654.12.007e-7154.75pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 ge... [more]
ENSPMAT00000001770.12.670e-9732.77pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 ge... [more]
ENSPMAT00000002265.12.048e-8442.82pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gen... [more]
back to top
BLAST of Otoferlin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otoferlin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474154.554e-17336.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430881.870e-11639.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368639.388e-9430.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368655.150e-9349.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341411.551e-8935.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Otoferlin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa0.000e+036.87otoferlin [Source:NCBI gene;Acc:101155482][more]
otofb1.621e-16538.80otoferlin-like [Source:NCBI gene;Acc:101160130][more]
ENSORLT00000022822.21.460e-13843.67pep primary_assembly:ASM223467v1:21:28315623:28320... [more]
myof8.251e-9231.86myoferlin [Source:NCBI gene;Acc:101172285][more]
myofl1.007e-8536.54myoferlin [Source:NCBI gene;Acc:101156429][more]
back to top
BLAST of Otoferlin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037807.10.000e+099.72SMESG000037807.1[more]
SMESG000037807.10.000e+099.35SMESG000037807.1[more]
SMESG000037807.10.000e+097.83SMESG000037807.1[more]
SMESG000010367.11.860e-15737.00SMESG000010367.1[more]
SMESG000010400.11.245e-16337.03SMESG000010400.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003490 ID=SMED30003490|Name=Otoferlin|organism=Schmidtea mediterranea sexual|type=transcript|length=6689bp
AATTAATCTATAAAATAAATTCCATTTCACGATGAGAATTTACAGAAATT
TCATGAATGCAATATATATGCTACAATAATCGATTTCTCAAATAAATGGC
CTTGGTGTTGAATTTAAAATACGTGGATAATTTGGATAATAGATGCGATC
GGATTATGAAAATCAACTTTCGAGATTTCGAGAAAACCACTAAAGTTGTT
CGTGGTAAAGACAGTATTTATTTCGGTGAACAATTTCAATGGCCAATGGG
AAGAAAACTCGATCCCATAGACACATTGGAACTGAGATTATATCAGTATA
GTAAATATCTCAATAATAAATTGATTGGGTCCATGACAATAAGCCTTCAA
AAACTACTGGAAGATTACAAAATTTCCTATAAAGAAAATCTTATTGACAG
CAACCATTCCATTATTAGAATAACTGTAAGCTTTGAGCTGACTTATTACT
CTCCAGATAGTCAAATAGCTGATTGGCGACAAGACGAATTCGAAAATCCA
ATCACTGACAGAAAGTTAAGCGATGCCGACGATATTTCAATAGATAGTCA
CGGTATGGGATCTGATAAAAGAACATTGATAGATCCCCAAACGGGCGAGA
TTGGAGAGTTTAATTATGGACAAACCGACAACGAATCCATAGAATCAGGT
GAAGATGACGAATCATTTGCAGCAACAAATGCTAGAACTCTTGGTGTGCC
TCTTGCACTTCATCCAACTCTCCACAAAACGGAAGATTGGCAAATTTCAA
TCACAGTCATCGAAGCCCGACAACTGGCAGGGGCCAATATCAATCCGTTA
ATAGAAGTGAGAATTGGAGAAAAAACTAAAACAACAGAAGTTCAGATGTC
AACCAATTCTCCTTATTACAATCAGTATCTGTGCTTTGAATTTCACATGT
CGAAGGCGGAATTATTCGATCAAGTAATCAGATTAAGATGTTTAGCAATG
GGGAATATGGCGATTTCCCGGCTATTGCCCGGTGACCTAATTGGAGAGTT
TAGAATGGATGTCAGAACAGTTTACAATGCTCCCGATCACATGTTTCTTC
ATAAATGGGCAATGCTTGTCGACCCGAAAGATATCCTCAGTGGAGCCAAA
GGCTATGTTAAAGTTGATTTGACTATCATGGGTAAAGGTGAACAAGTTAA
ACATAAACCAAAGAGTGCGACTAAAAAACCAAAAGACAACGATGACGAGG
ACATTGAAGCAAATCTTTTACTACCTCAAACCATTAAAACTGGAACAAAA
AGGCAAATGGCAGAAATTTGTGTGAAAATTTATAAAGCTGAAGATTTACC
TCGTATGAATACCGATATAATGGCAACGATAAAAATGGCGATAACCGGTG
ATAGTAAACCTCTAGTGGATCCGTTTGTACAAGTCTCCTTTGCAGGACAT
ACGGGACGAACTAAGGTTAAGAAGAATACTTATACACCTGAATGGAACGA
GGAAATAGTTTTTACTGAAATGTTTCCCACTTTATGCAATAGAATCAGAG
TGTCGGTTTATGATTGGGATACGGTTTTCAATGAGTGCATTGCAACACAT
TACATTGATCTATCACAAATAATGAATGAGGGCGACACAGGTTTCCTTCC
TACATTTGGTCCATCATGGGTGAATTTATATGGAACTCCAAGAAATTATA
CATATGATCAAATGATGAGGCCGAAAGAAGAATTAAACAGGGGTCTTGGT
GAAGGAGTCGCATATAGAGGAAGATTACTTATAGCTATTAAAACTGTACT
CCGATCAGAATCTGGTGGATTACCCGCCGGTGCAAAGGTTTATAGTGTTC
CTCCAATTTCCGATGGTACATGCGGAAAGAAAGAACCATTTTTATTAATT
GGTGCTTTTTATGAAGCTTCAGTGATCGACAGCGAAATTGGGAAAAAGAA
ACAGCCTATTTATTTTGAACTGAGTGTTGGAACAACTGGAAACCGACTAG
ATTCTGAAGCTAATGAAGAAGAAGAAAAAGAAGTGCCATCCGTGAATCAA
GGAAATCGACCGAAAATACCTAAATGGTGTCATAGTACAACTGAGCCAAT
GCTGCCTGATACGAACGATCAAGAATATTTCCATTTGAGTTTCAACGAAA
AGAAACCTTGCCTTTACATGATTTCATATCACGAAGACCATAAATCAAGA
GATTTTATCCCTAATATTCTCGAGAAACTAAAAAACGAATTTAGCAACGC
CGTGGAAATACTCCACGAACTTCACATGAATGAAAGACGCGGTACTCATT
TACGAATGAAAAATGCGTTGGATACGTTTATTGAAAATATTGAGTCCTCT
CTGAATAGTATAAAATGTGTCAGACATGTCTCCCCTAAAACATTACTTGA
TAAAGAGAGAATAAAATTGACAAAAGTCTGCTTAGAGAAAATGAGAGTAA
AAGCTAAAACAATGTATCAAGACTGTACCAAAGCAAATCTGGCAATTCGT
CTGAAAGAATGTCGAGCAATCATTAAAAAACTTAATGAGTTGATACCAAA
TCCTCAAAATGGTTTACCAGATATCTTTATTTGGCTAATACAAGACACTA
AAAGAATGGCATTTGCAAGAATTCCGGCGAGAGAAATCCTTTATTCGGCA
ATTCCAGAAGAAAAAGGAGTGAAAAACTCAGAAGTTGTCACGGTGTTTCT
ACAAAAACCTGGTCGTTTCGGAATGGGTCCCTCAGGATGGACTTTGCAAG
GTCAACTAAAAATGTATTTATGGCTTGGGCTTCTTCGAGATATGAAAACG
TTTCAACAAGGTTTACCATTAGGATACAGCAATGACTGTTTCAAATTCCG
AAGACCACCAATGGAAATCATTTATACAGAAAAAAGTTATTTCCAACTGA
GAGCACACATGTTTATGGCTCGAAATCTGATCGGTTCAGACGAATCTGGG
CTATCCGATGCTTTTGCGAGAATTTTAGTAAATGACCACGTGGTAACCAC
CAAAGTCGTTTATGAAACTCTCAGTCCAAAATGGGATCAAACATTAATTA
TAGATCACATGATCTTCTACTACAGTAAAGATCTGATCATGTCTAATCCC
CCAGTGCTAGTCGTGGAAATGTTCGATGAGGATCAAATGACAGGACTGAG
AAGTAATCAAAAGGGAAAATCGGAATTTCTCGGTAGATGTTTTTGTAAAC
CAACTGTTGCTTTGGAAGAAGAAGAGTATAAATCGCCTCGTTTAACATGG
TGGGAAATTTACAGAGGTCAAATGAATGCCGGTGAACTCTTAGCAGCATT
TGAATTAATTCAGGTATTTCCGGATGAAGGTTACCGATTAGCAAATGGAA
TTCAGAGAATCGAACAAATGATCCGATCAAGTTCCCCCATTGGAAGTTTA
AGATCAAATAGTGTTTTTAGTCAGAAAGAGCTTCTTCTAGCTAATATGGA
AGGAGATATAAATGGAGATGTTACTCCGAATGAGGGAGTAACTGTCACAG
CAGAAGGACACTTTGTGGTTCCGGTACCAAAAGAAATCAGACCTTCTTTA
GTTCCTTACAGAGTGGAGTTCTTGTTCTGGGGTGTACGAGAAATGCAAAG
AGTCCAATTGATGTCGGTGGATAAACCTAGAATAACCATTGAATTTGGCA
GCAGTCATTTAATTTCGGATGTCATCCCAAGTTGCAAAGTAAAACCAAAT
TTCTCCAACCCTTTAAAATATATGGATATCATGTTACCAGAAAACCTTCT
TTACTGGCCACCTCTGATGATTCAATGCGAAGACCTTCGGCAATTTGGAC
GAACGATTCTTATAGGAAACCACGTGATTTCCAATGTCACCAAATACGTT
ATAAAAGGCAAAATACCAACTGAAGAACCTGCGAAGAAAGTCATCACAAA
TACATCATCTCCAAATCAGCAAAACAATCTAGAAACTCCTGAGGATAAAA
TAGCGATTCCAGCAATTATTGAAGGAGTCGACAATCCAGCCTATATCGAC
GACGAAACAACTGCAGCTGGAAATCTGTCATCTGCTCGAAAATCATCAAC
AAATTTCAACTCAAATGTGCAAGCGTTATTAGATAATGCAAAAATGCTTC
AGGATGCGACTCAAAACTCAGCAGTTTCTCAAACTAATTTAAACAATTCA
AAAACAAATCTCTCCCAAGCAGGAATTTTAATGAACTCAAGTGAAAAAAT
AGGAAAGCTCGACTCACAAAGTATAAATGATACGAAATTAAAACAAATAA
GTCCCACTCCAAACACTCCGCCAGAAACTCCGATTCATCATCCAAATTAT
AAAGATGACAAAAGACCACTAGTAAATAGTGATACAAAATCGGAAACGAA
ATTCGGAGTTAAAATCTTGAAAAGTATTCCTGAAATAGTGCCAGTGAAAC
CTAAAGAATCAGTAGTTGAACCGATTAAAGGTCTTGGAGTCGTTGAACTA
AAGAAAAAAGCTAAAATTCCAAAAGACGAACTTCAAGACATCGACTGGTG
GAGCAGATATTACGTGTCGATTGAAGATCTAGACGATGATGGCCAGGAAG
ATTCTAGTGACAGTAACCTCGACGTATTAAAAGACATTGAAGTTGATGTG
AAAAGTGATGATGATCAAGGTGGTCTGGCTGAAATACCAGAAGACGAAGA
AGATTCTAGCAAAACGAAAAAGAAAAAGAAAAAGAGAAAGAAAAAGAAAA
AGTCAAAGAAAGATAAGAAGAAAGACGGTGACAAAGGAATATTTGCAAAA
TTGCCTTTTGGAAGAGTTGATGCGGCAAAGAAATATTTAGAAGAGAAGGA
CGATGATGATTTGGAAGATGAAGATAATGTTAAGCCAGACTATCATAATT
TGATAGAAAGATTTAAAGTTTATCCATGTCCTTTGGAAGAAGTGAAAGAG
TTTGAAGGCTTTGCGGCTTTTATACAAACATTTCCTCTCCAGAAAGGAAG
ACAAGACGATGACGAAGAATCATCAGATAATCGAATTGTTGGCAATTTTA
AGGGTAACCTGAACATTTATAAAGTGGACGATGAAGAATTTGGAGTGGAA
GTTGATGTTCATAAGTTAATGCTTTATAAAAGCTTGCCAAACAATGATCC
CGTACAAATACTGGTCCGAATTTACGTGATTAGAGCTAATGATCTACATC
CTGCTGATCCTAACGGCAAGTCAGATCCATATTTACTATTACGGCTGGGT
AACAAAGTGATCAACGAAAAAGAAAATTACATACCGAAGCAATTAAATCC
AATTTTTGGAAAGTGTTTTGAACTTGATGTGAAATTTCCTCAGGAGTCCA
ACCTGTTGATCCAAGTCATGGACTGGGACCTTGTCAGTGGGGATGACATT
ATTGGGGAGACTAAAATTGATCTTGAAAACCGATACTACAGCAAACATAA
GGCGCTTTGTGGTTTAGGTCAAATCTTTGAAAACCACGGATACAACAAAT
GGAGAGACATTCAGTTACCAACAATGATGTTGGCTAAGCTATGCAAAGAA
TATGGATTTGATCCACCAAAATATGAAGCATTAGTAAACAAAGTGACTGT
AGCAGAAGTTGCGTTTTATGCAGATGCTGAAATTGAAGAAGATAATGGTG
AGAAAAAGCAATCGAATGAACCGCTAGCTTTAGAAGTAATGAAAAATTGG
TCAAAAGTGCCAAATGGGTGTCTCTTGGTTCCAGAGCATATGGAAACGAG
ACCCTTGTTTAATTCAGAAAAACCAGGAATACAACAAGGCAGCTTAGAAA
TGTGGATTGACATGTTTCCGAAAGAATTAGGCGCCCCTCCTCTCCCAATA
GACATTGCACCTCGTCAACCGATCAGTTATGAATTAAGAGTAATCATTTG
GAATACTGAAGACGTAATATTGAGTGACGGCGGGGTTCTAACTGGTGAAA
AGAGTTCCGATATTTTTGTTAAGGGTTGGATGAAAGGTTTGGGAATAGAC
GACCAAGTTACAGATGTTCATTATAGATCTTTATCTGGTGAAGGAAACTT
CAATTGGAGATTCATTTTCAATTTTGATTACATCAAAGCAGAGGATAAAA
TAGTTTACAAAATCAAGGATTCTCCATTTGCAATAGATGAGACAGAAATC
AAGTCACCCTGTAAGCTCTACCTTCAGGTATGGGATGCTGATTTGGTCAC
TGCAGATGATTTCCTGGGTGGACTGGAGCTGATTTTAAGCAAAATTCCAA
GGGGAGCAAAAAGTCCCCAAACTTGTGGTCTACATCAATTAAACAAGGAC
GGATCAGTTTCTACAATAAGTATATTCAAAAATAAAAGATATAGAGGTTG
GTGGCCTTTTACCGGTGAAAATGAAGATGACCCAAAAGAGCTTGATGTTA
ATGGAAAATTAGATGCCGAATTTCAATTACTATCAAAGGAAGAGGGAGAA
GCGTGCCCCGTAGGACTCGGTAGAAACGAACCCAATGCATTACCCAGCCC
AAATCGGCCGGACAGCTCCTTTCTCAACTTCATGAACCCCCTTAAATCAT
TGAAATATTTAATATGCAACAAGTTCAAATGGTTCCTCATTAAAGCGTTG
ATAATCAGCGCCTTGCTAGCGTTGCTAGTTCTGTTTATCTACAACGCTCC
AGGATATTTAGCAAAACGGATGCTTGGTGCTTAACGTGATATTTTATTCG
AACATCTGAACAATAATTCATACTCGTTGTTATTGGTGATAGATTCAACT
ATTTTCTCTTGTATATTTATGTGATGTTTTGAAAATATA
back to top

protein sequence of SMED30003490-orf-1

>SMED30003490-orf-1 ID=SMED30003490-orf-1|Name=SMED30003490-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2163bp
MALVLNLKYVDNLDNRCDRIMKINFRDFEKTTKVVRGKDSIYFGEQFQWP
MGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLI
DSNHSIIRITVSFELTYYSPDSQIADWRQDEFENPITDRKLSDADDISID
SHGMGSDKRTLIDPQTGEIGEFNYGQTDNESIESGEDDESFAATNARTLG
VPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQ
MSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAISRLLPGDLIG
EFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQ
VKHKPKSATKKPKDNDDEDIEANLLLPQTIKTGTKRQMAEICVKIYKAED
LPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEW
NEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEGDTGF
LPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKT
VLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGK
KKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTE
PMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFS
NAVEILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTL
LDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELI
PNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTV
FLQKPGRFGMGPSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFK
FRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVV
TTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMTG
LRSNQKGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLA
AFELIQVFPDEGYRLANGIQRIEQMIRSSSPIGSLRSNSVFSQKELLLAN
MEGDINGDVTPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREM
QRVQLMSVDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPEN
LLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVI
TNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKS
STNFNSNVQALLDNAKMLQDATQNSAVSQTNLNNSKTNLSQAGILMNSSE
KIGKLDSQSINDTKLKQISPTPNTPPETPIHHPNYKDDKRPLVNSDTKSE
TKFGVKILKSIPEIVPVKPKESVVEPIKGLGVVELKKKAKIPKDELQDID
WWSRYYVSIEDLDDDGQEDSSDSNLDVLKDIEVDVKSDDDQGGLAEIPED
EEDSSKTKKKKKKRKKKKKSKKDKKKDGDKGIFAKLPFGRVDAAKKYLEE
KDDDDLEDEDNVKPDYHNLIERFKVYPCPLEEVKEFEGFAAFIQTFPLQK
GRQDDDEESSDNRIVGNFKGNLNIYKVDDEEFGVEVDVHKLMLYKSLPNN
DPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQL
NPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSK
HKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKV
TVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHME
TRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVI
IWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEG
NFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADL
VTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYR
GWWPFTGENEDDPKELDVNGKLDAEFQLLSKEEGEACPVGLGRNEPNALP
SPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYN
APGYLAKRMLGA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR037721Ferlin
IPR029996Otoferlin
IPR037723C2D_Ferlin
IPR037726C2A_Ferlin
IPR037724C2E_Ferlin
IPR037722C2C_Ferlin
IPR037720C2B_Ferlin
IPR037725C2F_Ferlin
IPR000008C2_dom
IPR012561Ferlin_B-domain
IPR012968FerIin_dom
IPR032362Ferlin_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0045202synapse
GO:0098793presynapse
Vocabulary: biological process
TermDefinition
GO:0016079synaptic vesicle exocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 692..712
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 617..636
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1508..1524
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1488..1527
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1488..1507
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1368..1389
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 619..633
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1650..1751
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 387..515
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 215..345
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1864..2029
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 6..115
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 914..1055
NoneNo IPR availableTMHMMTMhelixcoord: 2129..2151
IPR000008C2 domainSMARTSM00239C2_3ccoord: 1896..2026
e-value: 0.023
score: 23.8
coord: 390..501
e-value: 4.2E-17
score: 72.8
coord: 216..318
e-value: 6.8E-6
score: 35.6
coord: 2..96
e-value: 0.026
score: 23.7
coord: 917..1033
e-value: 4.1E-7
score: 39.6
coord: 1656..1755
e-value: 8.1E-11
score: 51.9
IPR000008C2 domainPFAMPF00168C2coord: 215..309
e-value: 4.1E-6
score: 27.0
coord: 14..93
e-value: 3.9E-4
score: 20.7
coord: 1657..1748
e-value: 5.0E-17
score: 62.1
coord: 917..1018
e-value: 3.1E-7
score: 30.6
coord: 391..495
e-value: 4.6E-17
score: 62.2
coord: 1986..2025
e-value: 0.45
score: 10.8
IPR000008C2 domainPROSITEPS50004C2coord: 1657..1740
score: 12.528
IPR000008C2 domainPROSITEPS50004C2coord: 216..303
score: 8.695
IPR000008C2 domainPROSITEPS50004C2coord: 390..493
score: 12.958
IPR000008C2 domainPROSITEPS50004C2coord: 903..1016
score: 10.782
IPR012968FerIin domainSMARTSM01202FerI_2coord: 304..380
e-value: 3.4E-32
score: 122.9
IPR012968FerIin domainPFAMPF08151FerIcoord: 326..379
e-value: 4.0E-16
score: 58.8
IPR012561Ferlin B-domainSMARTSM01201FerB_2coord: 803..879
e-value: 1.3E-30
score: 117.7
IPR012561Ferlin B-domainPFAMPF08150FerBcoord: 803..878
e-value: 1.8E-23
score: 82.9
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 379..517
e-value: 2.1E-20
score: 74.7
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1..123
e-value: 7.6E-27
score: 95.7
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1892..2045
e-value: 3.8E-13
score: 51.4
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 209..373
e-value: 1.5E-11
score: 46.5
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1639..1773
e-value: 1.8E-22
score: 81.7
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 907..1054
e-value: 5.6E-17
score: 63.8
IPR032362Ferlin, C-terminal domainPFAMPF16165Ferlin_Ccoord: 2069..2158
e-value: 2.9E-20
score: 72.8
IPR037721Ferlin familyPANTHERPTHR12546FER-1-LIKEcoord: 1442..2162
IPR037721Ferlin familyPANTHERPTHR12546FER-1-LIKEcoord: 9..150
IPR037721Ferlin familyPANTHERPTHR12546FER-1-LIKEcoord: 200..1238
IPR029996OtoferlinPANTHERPTHR12546:SF32OTOFERLINcoord: 200..1238
IPR029996OtoferlinPANTHERPTHR12546:SF32OTOFERLINcoord: 9..150
IPR029996OtoferlinPANTHERPTHR12546:SF32OTOFERLINcoord: 1442..2162
IPR037723Ferlin, fourth C2 domainCDDcd04017C2D_Ferlincoord: 916..1057
e-value: 4.43571E-57
score: 191.988
IPR037726Ferlin, first C2 domainCDDcd08373C2A_Ferlincoord: 3..127
e-value: 3.0843E-37
score: 135.074
IPR037724Ferlin, fifth C2 domainCDDcd04037C2E_Ferlincoord: 1656..1779
e-value: 1.01121E-61
score: 204.706
IPR037722Ferlin, third C2 domainCDDcd04018C2C_Ferlincoord: 392..542
e-value: 9.0843E-83
score: 266.421
IPR037720Ferlin, second C2 domainCDDcd04011C2B_Ferlincoord: 213..327
e-value: 9.55099E-43
score: 150.034
IPR037725Ferlin, sixth C2 domainCDDcd08374C2F_Ferlincoord: 1896..2029
e-value: 1.01108E-63
score: 210.983