Endoplasmic reticulum chaperone BiP

Overview
NameEndoplasmic reticulum chaperone BiP
Smed IDSMED30003482
Length (bp)2346
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endoplasmic reticulum chaperone BiP (SMED30003482) t-SNE clustered cells

Violin plots show distribution of expression levels for Endoplasmic reticulum chaperone BiP (SMED30003482) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endoplasmic reticulum chaperone BiP (SMED30003482) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endoplasmic reticulum chaperone BiP (SMED30003482) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003482

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003482SMESG000061528.1 dd_Smed_v4_2648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003482SMESG000061528.1 Contig38908newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003482SMESG000061528.1 Contig38908uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30003482SMESG000061528.1 dd_Smed_v6_2648_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30003482SMESG000061528.1 dd_Smed_v6_2648_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30003482SMESG000061528.1 dd_Smed_v6_2648_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA5 (heat shock protein family A (Hsp70) member 5 [Source:HGNC Symbol;Acc:HGNC:5238])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 454/632 (71.84%), Postives = 523/632 (82.75%), Query Frame = 2
Query:  182 ETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKT 2074
            E +DK  D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI   PFKV+    KP+I V+I G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDK+      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ A  ED+  +K ++E I+ PI+SKLY   G  G P T
Sbjct:   19 EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREG----EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY---GSAGPPPT 643          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 373/617 (60.45%), Postives = 472/617 (76.50%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D+ VQ D+ H+PF V+N   +P + V  KGE KSF PEE+S+MVL KMK IAE YLGK VT+AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+ ++ RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K+ I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K EDE  + ++ +++ LE Y ++MK  + D+ KL GKI+ +D +K  D   ++I+WLD N++A KE++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDE-KLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 373/617 (60.45%), Postives = 472/617 (76.50%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D+ VQ D+ H+PF V+N   +P + V  KGE KSF PEE+S+MVL KMK IAE YLGK VT+AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+ ++ RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K+ I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K EDE  + ++ +++ LE Y ++MK  + D+ KL GKI+ +D +K  D   ++I+WLD N++A KE++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDE-KLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 373/617 (60.45%), Postives = 472/617 (76.50%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D+ VQ D+ H+PF V+N   +P + V  KGE KSF PEE+S+MVL KMK IAE YLGK VT+AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+ ++ RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K+ I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K EDE  + ++ +++ LE Y ++MK  + D+ KL GKI+ +D +K  D   ++I+WLD N++A KE++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDE-KLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 374/614 (60.91%), Postives = 466/614 (75.90%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G  IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NTIFD KRLIGR++ D++VQ D+ H+PF+V++   KP + V  KGE K+F PEEIS+MVL KMK IAE YLG KV  AV+TVPAYFND+QRQATK+AG I GL VLRIINEPTAAAIAYGLDKK      E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++ + +  +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K  I EIVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +L GD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ++V   VYEGER + KDN+ LG+FDLTGIPPAPRGVPQIEVTF+IDANGIL V+A DK TG +  I ITNDK RL  +DID+M+++AE++K EDE+ + R+ A++ LE Y Y++K  + D+ KL GKIS  D  K  D   +VI+WLD N+ A K++Y  ++ ++E + NPI+SKLY+
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKG-CAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDE-KLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 440/625 (70.40%), Postives = 515/625 (82.40%), Query Frame = 2
Query:  206 YGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQD-GERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTP 2077
            YGT+IGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AF+ D G+RLIGD+AKNQLT NP NTIFD KRLIGR++ D +VQ DI H+PFKVI+  NKP + V +  + K F PEE+SAMVL KMK IAE YLGK+V +AVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVS+LTID GVFEV+ATNGDTHLGGEDFDQRV++YF  LYKKK  KDL+KD RA+QKLRREVEKAKRALS+   T++EIESL DGEDFSETLTRAKFEELN DLF++TL PV+KVL+D++LKK+D+ EIVLVGGSTRIPKVQ+L++ FFNGKEP++GINPDEAVAYGAAVQ GV+SG+  TG+++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  V+EGER + KDNH LG+FDLTG+PPAPRGVPQIEVTFEID NGIL V+AEDKGTGNK  I ITND+NRL PEDI++MI DAEKF E+D+ +K + EAR+ELE Y Y++KNQ+ DK KLGGK+  DD K   +AV + I WL  N  A+ E+  +QK D+ES + PIVSKLY KD   G  + P
Sbjct:   32 YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK----DGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY-KDAGAGGEEAP 651          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 440/625 (70.40%), Postives = 515/625 (82.40%), Query Frame = 2
Query:  206 YGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQD-GERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTP 2077
            YGT+IGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AF+ D G+RLIGD+AKNQLT NP NTIFD KRLIGR++ D +VQ DI H+PFKVI+  NKP + V +  + K F PEE+SAMVL KMK IAE YLGK+V +AVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVS+LTID GVFEV+ATNGDTHLGGEDFDQRV++YF  LYKKK  KDL+KD RA+QKLRREVEKAKRALS+   T++EIESL DGEDFSETLTRAKFEELN DLF++TL PV+KVL+D++LKK+D+ EIVLVGGSTRIPKVQ+L++ FFNGKEP++GINPDEAVAYGAAVQ GV+SG+  TG+++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  V+EGER + KDNH LG+FDLTG+PPAPRGVPQIEVTFEID NGIL V+AEDKGTGNK  I ITND+NRL PEDI++MI DAEKF E+D+ +K + EAR+ELE Y Y++KNQ+ DK KLGGK+  DD K   +AV + I WL  N  A+ E+  +QK D+ES + PIVSKLY KD   G  + P
Sbjct:   32 YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK----DGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY-KDAGAGGEEAP 651          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 440/625 (70.40%), Postives = 515/625 (82.40%), Query Frame = 2
Query:  206 YGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQD-GERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTP 2077
            YGT+IGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AF+ D G+RLIGD+AKNQLT NP NTIFD KRLIGR++ D +VQ DI H+PFKVI+  NKP + V +  + K F PEE+SAMVL KMK IAE YLGK+V +AVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVS+LTID GVFEV+ATNGDTHLGGEDFDQRV++YF  LYKKK  KDL+KD RA+QKLRREVEKAKRALS+   T++EIESL DGEDFSETLTRAKFEELN DLF++TL PV+KVL+D++LKK+D+ EIVLVGGSTRIPKVQ+L++ FFNGKEP++GINPDEAVAYGAAVQ GV+SG+  TG+++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  V+EGER + KDNH LG+FDLTG+PPAPRGVPQIEVTFEID NGIL V+AEDKGTGNK  I ITND+NRL PEDI++MI DAEKF E+D+ +K + EAR+ELE Y Y++KNQ+ DK KLGGK+  DD K   +AV + I WL  N  A+ E+  +QK D+ES + PIVSKLY KD   G  + P
Sbjct:   32 YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK----DGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY-KDAGAGGEEAP 651          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 440/625 (70.40%), Postives = 515/625 (82.40%), Query Frame = 2
Query:  206 YGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQD-GERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTP 2077
            YGT+IGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AF+ D G+RLIGD+AKNQLT NP NTIFD KRLIGR++ D +VQ DI H+PFKVI+  NKP + V +  + K F PEE+SAMVL KMK IAE YLGK+V +AVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVS+LTID GVFEV+ATNGDTHLGGEDFDQRV++YF  LYKKK  KDL+KD RA+QKLRREVEKAKRALS+   T++EIESL DGEDFSETLTRAKFEELN DLF++TL PV+KVL+D++LKK+D+ EIVLVGGSTRIPKVQ+L++ FFNGKEP++GINPDEAVAYGAAVQ GV+SG+  TG+++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  V+EGER + KDNH LG+FDLTG+PPAPRGVPQIEVTFEID NGIL V+AEDKGTGNK  I ITND+NRL PEDI++MI DAEKF E+D+ +K + EAR+ELE Y Y++KNQ+ DK KLGGK+  DD K   +AV + I WL  N  A+ E+  +QK D+ES + PIVSKLY KD   G  + P
Sbjct:   32 YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK----DGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY-KDAGAGGEEAP 651          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 440/625 (70.40%), Postives = 515/625 (82.40%), Query Frame = 2
Query:  206 YGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQD-GERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTP 2077
            YGT+IGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AF+ D G+RLIGD+AKNQLT NP NTIFD KRLIGR++ D +VQ DI H+PFKVI+  NKP + V +  + K F PEE+SAMVL KMK IAE YLGK+V +AVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVS+LTID GVFEV+ATNGDTHLGGEDFDQRV++YF  LYKKK  KDL+KD RA+QKLRREVEKAKRALS+   T++EIESL DGEDFSETLTRAKFEELN DLF++TL PV+KVL+D++LKK+D+ EIVLVGGSTRIPKVQ+L++ FFNGKEP++GINPDEAVAYGAAVQ GV+SG+  TG+++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  V+EGER + KDNH LG+FDLTG+PPAPRGVPQIEVTFEID NGIL V+AEDKGTGNK  I ITND+NRL PEDI++MI DAEKF E+D+ +K + EAR+ELE Y Y++KNQ+ DK KLGGK+  DD K   +AV + I WL  N  A+ E+  +QK D+ES + PIVSKLY KD   G  + P
Sbjct:   32 YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK----DGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLY-KDAGAGGEEAP 651          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073610)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 452/625 (72.32%), Postives = 523/625 (83.68%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+D++VQ DI  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +G+DFSETLTRAKFEELN DLF+STL PV+KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF +ED+ +K+R+E+R+ELE Y YS+KNQ+ DK KLG K+S D+  K   A+ + I WL+ N  A  E+Y KQK D+E+I+ P+++KLY     QGA   PPP
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLY-----QGAGGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0345166)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 452/625 (72.32%), Postives = 523/625 (83.68%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+D++VQ DI  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +G+DFSETLTRAKFEELN DLF+STL PV+KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF +ED+ +K+R+E+R+ELE Y YS+KNQ+ DK KLG K+S D+  K   A+ + I WL+ N  A  E+Y KQK D+E+I+ P+++KLY     QGA   PPP
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLY-----QGAGGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073609)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 452/625 (72.32%), Postives = 523/625 (83.68%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+D++VQ DI  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +G+DFSETLTRAKFEELN DLF+STL PV+KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF +ED+ +K+R+E+R+ELE Y YS+KNQ+ DK KLG K+S D+  K   A+ + I WL+ N  A  E+Y KQK D+E+I+ P+++KLY     QGA   PPP
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLY-----QGAGGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073611)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 452/625 (72.32%), Postives = 523/625 (83.68%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+D++VQ DI  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +G+DFSETLTRAKFEELN DLF+STL PV+KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF +ED+ +K+R+E+R+ELE Y YS+KNQ+ DK KLG K+S D+  K   A+ + I WL+ N  A  E+Y KQK D+E+I+ P+++KLY     QGA   PPP
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLY-----QGAGGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073608)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 452/625 (72.32%), Postives = 523/625 (83.68%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+D++VQ DI  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +G+DFSETLTRAKFEELN DLF+STL PV+KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF +ED+ +K+R+E+R+ELE Y YS+KNQ+ DK KLG K+S D+  K   A+ + I WL+ N  A  E+Y KQK D+E+I+ P+++KLY     QGA   PPP
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLY-----QGAGGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 454/654 (69.42%), Postives = 537/654 (82.11%), Query Frame = 2
Query:  125 FLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNI-KGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
              L L  AG + ++++++KE+       GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W DSSVQ+DI ++PFKVI   NKPHI ++I  G+ K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDK+      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALS+    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSG+  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PEDI++M+ +AE+F +ED+ +K+RI++R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ A  E++  +K ++E ++ PIVSKLY      G+   PPP
Sbjct:    4 LCLFLLVAGSVFAEEDDKKES------VGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTTEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWGDSSVQQDIKYFPFKVIEKKNKPHIQLDIGSGQMKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR----DGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKPDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEETGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNEAERFADEDKKLKERIDSRNELESYAYSLKNQIGDKEKLGGKLSSEDKEAIEKAVEEKIEWLEAHQDADLEEFQAKKKELEEVVQPIVSKLY------GSAGGPPP 641          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 374/614 (60.91%), Postives = 469/614 (76.38%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G  IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NTIFD KRLIGR++ D  VQ D+  +PFKVI+ D KP + V  KGE K+F PEEIS+MVL KM+ IAE YLG +V +AV+TVPAYFND+QRQATK+AG+IAGL VLRIINEPTAAAIAYGLDK  K    E  +L+FDLGGGTFDVS+LTI+ G+FEV AT GDTHLGGEDFD R++ +F   +K+K  KD+ ++ RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNA+LF+ TL PVEK L+DA + K+ I +IVLVGGSTRIPK+Q+L++ FFNG++ NK INPDEAVAYGAAVQA +L GD++     LL +     +LG+E  GGVM  LI RNT IPT +  +F+T  DNQ  V   V+EGER + KDN+ LG+FDLTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M++DAEK+K EDE  +++I A++ LE Y +SMKN + D+  L GKIS  D KK  D   +V+ WL+ N+ A KE+Y   + ++ES+ NPI+S+LY+
Sbjct:    4 GLSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFDDQVVQSDMKLWPFKVISEDGKPKVQVEYKGENKTFYPEEISSMVLVKMREIAEAYLGHRVNNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGRKG---ERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVKHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSITRARFEELNAELFRGTLDPVEKALRDAKMDKSQIQDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFSTYSDNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKENKITITNDKGRLSKEDIERMVQDAEKYKAEDEVQREKIAAKNALESYAFSMKNTVEDEN-LRGKISEQDKKKIIDKCTEVVSWLENNQLAEKEEYEHHQKELESVCNPIISRLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 370/617 (59.97%), Postives = 471/617 (76.34%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D  VQ D+ H+PF VIN +++P + V  KGE KSF PEEIS+MVL KMK IAE YLGK V++AV+TVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA + K  I +IVLVGGSTRIPK+Q+L++ +FNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGI+ VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K ED+  + ++ A++ LE Y ++MK+ + D+ KL GKIS +D +K  D   +VI WLD N++A +E++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDE-KLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 370/617 (59.97%), Postives = 471/617 (76.34%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D  VQ D+ H+PF VIN +++P + V  KGE KSF PEEIS+MVL KMK IAE YLGK V++AV+TVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA + K  I +IVLVGGSTRIPK+Q+L++ +FNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGI+ VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K ED+  + ++ A++ LE Y ++MK+ + D+ KL GKIS +D +K  D   +VI WLD N++A +E++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDE-KLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 370/617 (59.97%), Postives = 471/617 (76.34%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D  VQ D+ H+PF VIN +++P + V  KGE KSF PEEIS+MVL KMK IAE YLGK V++AV+TVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA + K  I +IVLVGGSTRIPK+Q+L++ +FNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGI+ VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K ED+  + ++ A++ LE Y ++MK+ + D+ KL GKIS +D +K  D   +VI WLD N++A +E++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDE-KLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 460/660 (69.70%), Postives = 535/660 (81.06%), Query Frame = 2
Query:  107 MYCSTSF-LLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            M+  T F L+LL +A    +D ++++E      D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI + PFKVI    KP+I V+I  + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS   +RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL DA+LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ +  E++  +K ++E I+ PIV KLY      G    PPP
Sbjct:    1 MFFPTLFALVLLVSASVFAADDDDKRE------DVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLY------GGAGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 457/652 (70.09%), Postives = 531/652 (81.44%), Query Frame = 2
Query:  128 LLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            L+LL +A    +D ++++E      D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI + PFKVI    KP+I V+I  + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS   +RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL DA+LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ +  E++  +K ++E I+ PIV KLY      G    PPP
Sbjct:    9 LVLLVSASVFAADDDDKRE------DVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLY------GGAGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 457/652 (70.09%), Postives = 531/652 (81.44%), Query Frame = 2
Query:  128 LLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            L+LL +A    +D ++++E      D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI + PFKVI    KP+I V+I  + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS   +RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL DA+LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ +  E++  +K ++E I+ PIV KLY      G    PPP
Sbjct:   10 LVLLVSASVFAADDDDKRE------DVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLY------GGAGAPPP 645          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 453/631 (71.79%), Postives = 520/631 (82.41%), Query Frame = 2
Query:  191 DKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            DK  D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI + PFKVI    KP+I V+I  + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS   +RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL DA+LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ +  E++  +K ++E I+ PIV KLY      G    PPP
Sbjct:   24 DKREDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLY------GGAGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 438/593 (73.86%), Postives = 499/593 (84.15%), Query Frame = 2
Query:  128 LLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDD 1906
            L+LL +A    +D ++++E      D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI + PFKVI    KP+I V+I  + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS   +RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL DA+LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D
Sbjct:    9 LVLLVSASVFAADDDDKRE------DVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSED 591          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 454/635 (71.50%), Postives = 523/635 (82.36%), Query Frame = 2
Query:  182 ETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            E +DK  D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI   PFKV+    KP+I V+I G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDK+      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ A  ED+  +K ++E I+ PI+SKLY   G       PPP
Sbjct:   20 EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREG----EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGG-------PPP 643          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 454/635 (71.50%), Postives = 523/635 (82.36%), Query Frame = 2
Query:  182 ETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            E +DK  D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI   PFKV+    KP+I V+I G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDK+      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ A  ED+  +K ++E I+ PI+SKLY   G       PPP
Sbjct:   20 EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREG----EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGG-------PPP 643          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 373/617 (60.45%), Postives = 471/617 (76.34%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D+ VQ D+ H+PF V+N   +P + V  KGE KSF PEE+S+MVL KMK IAE YLGK VT+AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+ ++ RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K+ I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K EDE  + ++ +++ LE Y ++MK  + D+ KL GKI+ +D +K  D   ++I WLD N++A KE++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDE-KLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 373/614 (60.75%), Postives = 466/614 (75.90%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G  IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NTIFD KRLIGR++ D++VQ D+ H+PF+V++   KP + V  KGE K+F PEEIS+MVL KMK IAE YLG KV  AV+TVPAYFND+QRQATK+AG I GL VLRIINEPTAAAIAYGLDKK      E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++ + +  +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K  I EIVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +L GD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ++V   VYEGER + KDN+ LG+FDLTGIPPAPRGVPQIEVTF+IDANGIL V+A DK TG +  I ITNDK RL  +DID+M+++AE++K EDE+ + R+ A++ +E Y Y++K  + D+ KL GKIS  D  K  D   +VI+WLD N+ A K++Y  ++ ++E + NPI+SKLY+
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKG-CAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDE-KLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 373/614 (60.75%), Postives = 466/614 (75.90%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G  IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NTIFD KRLIGR++ D++VQ D+ H+PF+V++   KP + V  KGE K+F PEEIS+MVL KMK IAE YLG KV  AV+TVPAYFND+QRQATK+AG I GL VLRIINEPTAAAIAYGLDKK      E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++ + +  +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K  I EIVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +L GD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ++V   VYEGER + KDN+ LG+FDLTGIPPAPRGVPQIEVTF+IDANGIL V+A DK TG +  I ITNDK RL  +DID+M+++AE++K EDE+ + R+ A++ +E Y Y++K  + D+ KL GKIS  D  K  D   +VI+WLD N+ A K++Y  ++ ++E + NPI+SKLY+
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKG-CAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDE-KLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|P29844|BIP_DROME (Endoplasmic reticulum chaperone BiP OS=Drosophila melanogaster OX=7227 GN=Hsc70-3 PE=1 SV=2)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 452/625 (72.32%), Postives = 523/625 (83.68%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+D++VQ DI  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +G+DFSETLTRAKFEELN DLF+STL PV+KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  VF+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF +ED+ +K+R+E+R+ELE Y YS+KNQ+ DK KLG K+S D+  K   A+ + I WL+ N  A  E+Y KQK D+E+I+ P+++KLY     QGA   PPP
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLY-----QGAGGAPPP 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q16956|BIP_APLCA (Endoplasmic reticulum chaperone BiP OS=Aplysia californica OX=6500 PE=1 SV=1)

HSP 1 Score: 802.357 bits (2071), Expect = 0.000e+0
Identity = 452/652 (69.33%), Postives = 535/652 (82.06%), Query Frame = 2
Query:  125 FLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPP 2080
             ++L  +   + +D + E E   K  + GTVIGIDLGTTYSCVG+FK GRV+II NDQGNRITPSY+AFT DGERLIGD+AKNQLT+NP NTIFDVKRLIGR + D SVQ DI  YPFKV N +NKPHI       ++SF PEEISAMVL KM+ IAEEYLGKK+T+AVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVV+TNGDTHLGGEDFDQRV+++F  LYKKKK KD++KD RA+QKLRREVEKAKRALSS    R+EIES  DGEDFSE+LTRAKFEELN DLF+ST+ PV++VL+DA+LK +DI EIVLVGGSTRIPKVQ+LV+ +FNGKEP++GINPDEAVAYGAAVQAGVLSG+  TGDL+LLDV PLT+G+E  GGVM KLI RNT IPT K  +F+T  DNQ TVT  VYEGER + KDNH LG+FDLTGIPPAPRGVPQIEVTFEID NGILKV+AEDKGTG+K  IVI ND+NRL PEDI++MI DAEK+ +ED+ +K++++A++ELE Y YS+KNQ+ DK KLG K+S +D +K  +AV + I WL+ N  A  E + ++K+++E I+ PI++KLYE+ G  GAP  PP
Sbjct:   10 LVILFSSNLLVRADGDEEDEGDKKKSEVGTVIGIDLGTTYSCVGVFKNGRVDIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTSNPENTIFDVKRLIGRTFDDKSVQHDIKFYPFKVTNANNKPHIQAATGEGDRSFAPEEISAMVLSKMRDIAEEYLGKKITNAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVSTNGDTHLGGEDFDQRVMEHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSSAHQVRLEIESFFDGEDFSESLTRAKFEELNMDLFRSTMKPVKQVLEDADLKTDDIDEIVLVGGSTRIPKVQQLVKEYFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDLVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERSMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILKVTAEDKGTGSKNQIVIQNDQNRLSPEDIERMINDAEKYADEDKKVKEKVDAKNELESYAYSLKNQIGDKEKLGAKLSDEDKEKITEAVDEAIKWLESNAEAESEAFNEKKTELEGIVQPIMTKLYEQSG--GAP--PP 653          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q90593|BIP_CHICK (Endoplasmic reticulum chaperone BiP OS=Gallus gallus OX=9031 GN=HSPA5 PE=1 SV=1)

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 456/640 (71.25%), Postives = 527/640 (82.34%), Query Frame = 2
Query:  158 HSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKT 2074
             +D E +KE      D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI + PFKV+    KPHI V++ G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDK+      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+AR+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ A  ED+  +K ++E ++ PIVSKLY   G  G P T
Sbjct:   15 RADDEEKKE------DVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVVEKKAKPHIQVDVGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREG----EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDARNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDADIEDFKSKKKELEEVVQPIVSKLY---GSAGPPPT 641          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|P07823|BIP_MESAU (Endoplasmic reticulum chaperone BiP OS=Mesocricetus auratus OX=10036 GN=HSPA5 PE=1 SV=1)

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 454/632 (71.84%), Postives = 523/632 (82.75%), Query Frame = 2
Query:  182 ETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKT 2074
            E +DK  D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI   PFKV+    KP+I V+I G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDK+      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ A  ED+  +K ++E I+ PI+SKLY   G  G P T
Sbjct:   19 EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREG----EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY---GSAGPPPT 643          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q3S4T7|BIP_ICTTR (Endoplasmic reticulum chaperone BiP OS=Ictidomys tridecemlineatus OX=43179 GN=HSPA5 PE=2 SV=1)

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 453/632 (71.68%), Postives = 522/632 (82.59%), Query Frame = 2
Query:  182 ETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKT 2074
            E +DK  D GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W D SVQ+DI   PFKV+    KP+I V+I G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDK+      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK+DI EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSGD  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  + +T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PE+I++M+ DAEKF EED+ +K+RI+ R+ELE Y YS+KNQ+ DK KLGGK+SS+D +    AV + I+WL+ ++ A  ED+  +K ++E I+ PI+SKLY   G  G P T
Sbjct:   19 EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREG----EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQISSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKRLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLY---GSAGPPPT 643          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A1I8IVM0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 480/627 (76.56%), Postives = 539/627 (85.96%), Query Frame = 2
Query:  203 DYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY--EKDGRQGAPKTP 2077
            D G VIGIDLGTTYSCVGIFK GRVEI+PNDQGNRITPSY+AFTQDGERL+GD+AKNQLTTNP NT+FD KR+IGR WTDSS+Q DI ++PFKV   D KP I V + GE K F PEEISAMVLGKM+ IAE YLG+KV +AV+TVPAYFNDAQRQATKNAG IAGL VLRIINEPTAAAIAYGLDKK   E  E  ILVFDLGGGTFDVSLLTID GVFEV+ATNGDTHLGGEDFDQRVI YF  LYKKK  KDL KD RAIQKLRREVEKAKRALSS  T R+E+ESLIDGEDFSE+LTRAKFEELNADLFKST++PV KVL+DANLKK DI E+VLVGGSTRIPKVQ+LV+ +FNGK P+ GINPDEA+AYGAAVQAGVL+GD +TG+ LLLDVCPLTLGME+EGGVMAKLINRNTPIPT K+D+FTTV DNQ+TV  AVYEGER +  DNHFLG+FDLTGIPPAPRGVPQ+EVTFEIDANGILKV+AEDKGTGNKQ I I ND++RLKPE+IDKM+KDAEKF E+D+ I++++EARS+LE YVYSM+ QL DK+KLGGK+S  D K + DAV K +DWLD NK A+K D+  QK  +E  L+PIVSK+Y  EKD RQ  P  P
Sbjct:  238 DIGPVIGIDLGTTYSCVGIFKNGRVEILPNDQGNRITPSYVAFTQDGERLVGDAAKNQLTTNPENTVFDAKRIIGRVWTDSSIQHDIKYFPFKVTEKDGKPFIGVKVGGENKEFAPEEISAMVLGKMRDIAESYLGRKVENAVITVPAYFNDAQRQATKNAGTIAGLNVLRIINEPTAAAIAYGLDKK---EGGERHILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVIRYFVDLYKKKTGKDLSKDQRAIQKLRREVEKAKRALSSAHTARVEVESLIDGEDFSESLTRAKFEELNADLFKSTIVPVSKVLKDANLKKEDITEVVLVGGSTRIPKVQQLVKDYFNGKAPHTGINPDEAIAYGAAVQAGVLAGDDSTGEFLLLDVCPLTLGMEIEGGVMAKLINRNTPIPTKKRDIFTTVDDNQDTVMVAVYEGERAMASDNHFLGRFDLTGIPPAPRGVPQVEVTFEIDANGILKVTAEDKGTGNKQQITIKNDQSRLKPEEIDKMVKDAEKFAEQDKQIREKVEARSDLESYVYSMRQQLKDKSKLGGKLSDADRKAAEDAVSKTLDWLDKNKEASKADFDTQKRQLEDALSPIVSKIYETEKDQRQPPPHGP 861          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A1I8GNA8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001106g1 PE=3 SV=1)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 480/627 (76.56%), Postives = 539/627 (85.96%), Query Frame = 2
Query:  203 DYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY--EKDGRQGAPKTP 2077
            D G VIGIDLGTTYSCVGIFK GRVEI+PNDQGNRITPSY+AFTQDGERL+GD+AKNQLTTNP NT+FD KR+IGR WTDSS+Q DI ++PFKV   D KP I V + GE K F PEEISAMVLGKM+ IAE YLG+KV +AV+TVPAYFNDAQRQATKNAG IAGL VLRIINEPTAAAIAYGLDKK   E  E  ILVFDLGGGTFDVSLLTID GVFEV+ATNGDTHLGGEDFDQRVI YF  LYKKK  KDL KD RAIQKLRREVEKAKRALSS  T R+E+ESLIDGEDFSE+LTRAKFEELNADLFKST++PV KVL+DANLKK DI E+VLVGGSTRIPKVQ+LV+ +FNGK P+ GINPDEA+AYGAAVQAGVL+GD +TG+ LLLDVCPLTLGME+EGGVMAKLINRNTPIPT K+D+FTTV DNQ+TV  AVYEGER +  DNHFLG+FDLTGIPPAPRGVPQ+EVTFEIDANGILKV+AEDKGTGNKQ I I ND++RLKPE+IDKM+KDAEKF E+D+ I++++EARS+LE YVYSM+ QL DK+KLGGK+S  D K + DAV K +DWLD NK A+K D+  QK  +E  L+PIVSK+Y  EKD RQ  P  P
Sbjct:   43 DIGPVIGIDLGTTYSCVGIFKNGRVEILPNDQGNRITPSYVAFTQDGERLVGDAAKNQLTTNPENTVFDAKRIIGRVWTDSSIQHDIKYFPFKVTEKDGKPFIGVKVGGENKEFAPEEISAMVLGKMRDIAESYLGRKVENAVITVPAYFNDAQRQATKNAGTIAGLNVLRIINEPTAAAIAYGLDKK---EGGERHILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVIRYFVDLYKKKTGKDLSKDQRAIQKLRREVEKAKRALSSAHTARVEVESLIDGEDFSESLTRAKFEELNADLFKSTIVPVSKVLKDANLKKEDITEVVLVGGSTRIPKVQQLVKDYFNGKAPHTGINPDEAIAYGAAVQAGVLAGDDSTGEFLLLDVCPLTLGMEIEGGVMAKLINRNTPIPTKKRDIFTTVDDNQDTVMVAVYEGERAMASDNHFLGRFDLTGIPPAPRGVPQVEVTFEIDANGILKVTAEDKGTGNKQQITIKNDQSRLKPEEIDKMVKDAEKFAEQDKQIREKVEARSDLESYVYSMRQQLKDKSKLGGKLSDADRKAAEDAVSKTLDWLDKNKEASKADFDTQKRQLEDALSPIVSKIYETEKDQRQPPPHGP 666          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A0K8U1R7 (Heat shock protein cognate 3 OS=Bactrocera latifrons OX=174628 GN=Hsc70-3_0 PE=3 SV=1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 460/649 (70.88%), Postives = 536/649 (82.59%), Query Frame = 2
Query:  128 LLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKT 2074
            LLLL    F+   +  EK+ KDK  D GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+DS+VQ D+  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEV+ATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +GEDFSETLTRAKFEELN DLF+STL PV KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF+GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  +F+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF ++D+ +K+++E R+ELE Y YS+KNQ+ DK KLGGK+S D+  K   A+   I W++ N  A  E+Y KQK D+E+I+ PI++KLY+  G  GAP T
Sbjct:    5 LLLLAVVAFVSLSQGEEKKEKDK--DIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDSNVQHDVKFFPFKVVEKNSKPHISVSTAQGNKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTLKPVTKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFSGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADDDKKLKEKVETRNELESYAYSLKNQIGDKDKLGGKLSDDEKAKMESAIDDTIKWMEQNADADPEEYKKQKKDLEAIVQPIIAKLYQ--GAGGAPPT 645          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A034VDA3 (Heat shock 70 kDa protein cognate 3 OS=Bactrocera dorsalis OX=27457 GN=HSP7C PE=3 SV=1)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 460/649 (70.88%), Postives = 535/649 (82.43%), Query Frame = 2
Query:  128 LLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKT 2074
            LLLL    F+      EK+ KDK  D GTVIGIDLGTTYSCVG++K GRVEII NDQGNRITPSY+AFT DGERLIGD+AKNQLTTNP NT+FD KRLIGREW+DS+VQ D+  +PFKV+  ++KPHISV+     K F PEEISAMVLGKMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  +LVFDLGGGTFDVSLLTID GVFEV+ATNGDTHLGGEDFDQRV+D+F  LYKKKK KD++KD RA+QKLRREVEKAKRALS     RIEIES  +GEDFSETLTRAKFEELN DLF+STL PV KVL+DA++ K D+ EIVLVGGSTRIPKVQ+LV+ FF+GKEP++GINPDEAVAYGAAVQAGVLSG+  T  ++LLDV PLT+G+E  GGVM KLI RNT IPT K  +F+T  DNQ+TVT  VYEGER + KDNH LG+FDLTGIPPAPRG+PQIEV+FEIDANGIL+VSAEDKGTGNK+ IVITND+NRL PEDID+MI+DAEKF ++D+ +K+++E R+ELE Y YS+KNQ+ DK KLGGK+S D+  K   A+   I W++ N  A  E+Y KQK D+E+I+ PI++KLY+  G  GAP T
Sbjct:    5 LLLLAVVAFVSLSHGEEKKEKDK--DIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDSNVQHDVKFFPFKVVEKNSKPHISVSTAQGNKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKE----GEKNVLVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTLKPVTKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFSGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADDDKKLKEKVETRNELESYAYSLKNQIGDKDKLGGKLSDDEKTKMESAIDDTIKWMEQNADADPEEYKKQKKDLEAIVQPIIAKLYQ--GAGGAPPT 645          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A267GFX2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032526g2 PE=3 SV=1)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 464/647 (71.72%), Postives = 532/647 (82.23%), Query Frame = 2
Query:  101 TQMYCSTSFLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY 2041
            T+M     +L +L   G   +D + EK  + K  D GTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLTTNP NTIFDVKR+IGR + D  VQKDI   P+ V+N ++KP I V +  E K+F PEEISAMVLGKMK IAE YLGKKVTHAVVTVPAYFNDAQRQATK+AG+IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV++YF  LYKKKK KDL+ D RA+QKLRREVEKAKRALSS  T R+EIESL DGEDFSETLTRA+FEELN DLF+ST+ PV+KVL+DA+LKK DIAEIVLVGGSTRIPKVQ+LV+ FF+GKEPN+GINPDEAVAYGAAVQAGVL G   TGD++LLDVCPLTLG+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  VYEGER + KDNHFLG+FDLTGIP APRGVPQIEVTFEIDANGIL+VSAEDKGTGNK  IVI  D+NRL P++I+KMIKDA+ F ++D+ +K+R+EA++ELE Y YSMK QL DK KLGGK+S+D+  K   A+   IDWL+ N+ A  E   +QK ++E+++ PIVSKLY
Sbjct:    8 TKMNKQLFYLAMLVCIGLALADSDKEKTDQKKKEDVGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTTNPENTIFDVKRIIGRNYADDVVQKDIKLLPYTVVNKNSKPAIQVQVGSEAKTFAPEEISAMVLGKMKEIAESYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKK----EGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEYFIKLYKKKKGKDLRTDNRAVQKLRREVEKAKRALSSAHTARVEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVQKVLEDADLKKEDIAEIVLVGGSTRIPKVQQLVKEFFSGKEPNRGINPDEAVAYGAAVQAGVLGGAEDTGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPNAPRGVPQIEVTFEIDANGILQVSAEDKGTGNKNKIVINKDQNRLSPDEIEKMIKDADTFADQDKKVKERVEAKNELESYAYSMKTQLADKEKLGGKVSADEKAKMEKAIQAAIDWLEKNQQADTEALKEQKKELEAVVQPIVSKLY 650          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:103030781])

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 447/640 (69.84%), Postives = 531/640 (82.97%), Query Frame = 2
Query:  125 FLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNI-KGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY 2041
              L +   G +++D +++KE      + GTV+GIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W DSSVQ+D+ ++PFKV+   +KPHI V+I  G+ K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALSS    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK++I EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSG+  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PEDI++M+ DAE+F +ED+ +K+RI++R+ELE Y YS+KNQ+ DK KLGGK+S +D +    AV + I+WL+ ++ A  E++  +K ++E ++ PI+SKLY
Sbjct:    4 LCLFMLVVGCVYADDDDKKE------NVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWGDSSVQQDVKYFPFKVLEKKSKPHIQVDIGAGQLKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKK----DGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEINEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKKLKERIDSRNELESYAYSLKNQVGDKEKLGGKLSDEDKEAIEKAVEEKIEWLESHQDADLEEFQAKKKELEEVVQPIISKLY 633          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 375/614 (61.07%), Postives = 469/614 (76.38%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            GT +GIDLGTTYSCVGIF+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NTIFD KRLIGR + D+ VQ D+ H+PFKVI+   +P + V  KGE K+F PEEIS+MVL KMK IAE YLGK + +AV+TVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  S   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K  I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K ED+  + ++ +++ LE Y ++MK+ + D  KL GKIS +D +K  D   ++I WLD N++A KE+Y  Q+ ++E + NPI++KLY+
Sbjct:    4 GTAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDTVVQSDMKHWPFKVISDGGRPKVEVEYKGETKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGS---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDD-KLQGKISDEDKQKILDKCNEIISWLDKNQTAEKEEYEHQQQELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 372/617 (60.29%), Postives = 470/617 (76.18%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NTIFD KRLIGR + D  VQ D+ H+PF VIN   +P + V+ KGE KSF PEEIS+MVL KMK IAE YLGK VT+AV+TVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  S   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA + K  I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGI+ VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K ED+  + ++ +++ LE Y ++MK+ + D+ KL GKIS +D +K  D   +VI WLD N++A ++++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGS---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDE-KLKGKISDEDKQKIMDKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 373/614 (60.75%), Postives = 470/614 (76.55%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D+ VQ D+ H+PF VIN   +P + V  KGE K+F PEEIS+MVL KMK IAE YLGK VT+AVVTVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  S   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA L K+ I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +L+GD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGI+ VSA DK TG +  I ITNDK RL  E+I++M++DAEK+K ED+  + ++ A++ LE Y ++MK+ + D+ KL GKIS +D +K  D   +VI WLD N++A K+++  Q+ ++E + NPI++KLY+
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGETKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGS---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTVEDE-KLKGKISDEDKQKILDKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 366/614 (59.61%), Postives = 471/614 (76.71%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G  IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR++ D  VQ D+ H+PF+V++   KP + V  KGE+K+F PEEIS+MVL KMK IAE YLG+KVT+AV+TVPAYFND+QRQATK+AG+IAGL VLRIINEPTAAAIAYGLDK  K    E  +L+FDLGGGTFDVS+LTI+ G+FEV AT GDTHLGGEDFD R++++F   +K+K  KD+ ++ RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEE+ +DLF+ TL PVEK L+DA + K+ I EIVLVGGSTRIPK+Q+L++ FFNG++ NK INPDEAVAYGAAVQA +L GD++     LL +     +LG+E  GGVMA LI RNT IPT +   F+T  DNQ  V   V+EGER + KDN+ LG+FDLTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  E+I++M+++A+++K ED+  +++I A++ LE + ++MKN + D+  L GKIS DD KK  +   + I WL+ N+ A KE++  Q  ++E + NPI++KLY+
Sbjct:    6 GVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDGGKPKVQVEYKGEQKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKKG---ERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLHEGVDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMATLIKRNTTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVQEADQYKAEDDLQREKIAAKNSLESFAFNMKNSVEDEN-LKGKISEDDKKKVIEKCNQAISWLENNQLADKEEFEHQLKELEKVCNPIITKLYQ 614          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 440/614 (71.66%), Postives = 510/614 (83.06%), Query Frame = 2
Query:  203 DYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVN-IKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY 2041
            + GTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR WTD +VQ DI  +PF V+    KPHI V  I GE K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKR LS+    RI+IES  DG+DFSETLTRAKFEELN DLF+ST+ PV+KV++D++LKK DI EIVLVGGSTRIPK+Q+LV+  FNGKEP++GINPDEAVAYGAAVQAGVLSG+  TGDL+LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  V+EGER + KDNH LG+FDLTGIPPAPRGVPQIEVTFEID NGIL+VSAEDKGTGNK  I ITND+NRL PE+I++M+ DAE+F ++D+ +K+R+EAR+ELE Y YS+KNQ+ DK KLGGK+S +D +    AV   I WL+ ++ A  +D+  QK ++E ++ PIVSKLY
Sbjct:   31 NMGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEG----EKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 480.715 bits (1236), Expect = 1.123e-160
Identity = 294/616 (47.73%), Postives = 398/616 (64.61%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESL-IDG---EDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G VIGIDLGTT SCV + +  + +++ N +G R TPS +AFT DGERL+G  AK Q  TNP NT +  KRLIGR + DS VQKD+ +  +K++   N       ++   K + P +I A VL KMK  AE ++G  V +AV+TVPAYFND+QRQATK+AG I+GL VLR+INEPTAAA+AYGLDK       +  I V+DLGGGTFD+S+L I +GVFEV +TNGDT LGGEDFD  ++ Y    +K++   DL KD  A+Q++R   EKAK  LSS L T I +  L +D    +  +  LTR++FE +  DL + T+ P +K LQD  + K+DI +++LVGG TR+PKVQ+ V+  F G+ P+K +NPDE  A                 D+LLLDV PL+LG+E  GGV  KLINRNT IPT K  VF+T  D Q  V   V++GER++  DN  LGQF L G+PPAPRGVPQIEVTF+IDANGI+ VSA+DKGTG +Q IVI +    L  ++I+ M+K+AEK+ EED   K R+EA ++ E  V+ +++++ +      ++ +D+  K  + + KV + L    + T E  IKQ +   S L     KL+E
Sbjct:   53 GAVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRASNG---DAWVEAHGKMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK-----ADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVF-GRAPSKAVNPDE--AVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGG-LSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEE---FKDQLPADECTKLKEEIAKVRELLTRKDTETGE-AIKQAA---STLQQSSLKLFE 649          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 234.572 bits (597), Expect = 3.315e-69
Identity = 144/410 (35.12%), Postives = 213/410 (51.95%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEG--RVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKP-HISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIE-SLIDGED-----------------------------------------FSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPD 1309
            ++GIDLGTTY  +G++  G   VE++ +  G R  PS +A   DG  L G  A  Q   NP  T++D KR IGR ++   ++++   Y F V  V  +   +     G E++  PE + A +L +++ +AEE LG  V +AV+ VPA F++ QR +T  A  +AGL VLR++NEPTAAA+AYGL +    E     +LV DLGGGT DVSLLT   G+F   A  G+ HLGG+DF QR++++ +     +            Q LR   E AK  L+     R+ +  SL+   D                                           ET+TR +FE LN DLF+  + P+ +VL+   L    +  +VLVGGSTRIP+V+ ++  +F G EP+  ++P+
Sbjct:   33 IVGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAEQTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHE----EESVSSVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYF-GSEPDTSVDPE 437          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 233.032 bits (593), Expect = 2.780e-68
Identity = 130/365 (35.62%), Postives = 212/365 (58.08%), Query Frame = 2
Query:  218 IGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDE 1312
            +G+ LG+T +CV I+K+GR ++I ND G+R+TP+ +AF +D E+++G +AK     N   T+  VKR++G  + D  VQK I+     VI  D  P  S+N    +K     E++ ++L KMK  A   +G     AV+T P  F   Q    + A   AG  VLRI++EP AA +A+G+ ++  S   + ++LV+ LGG     + + ++ G++ V+ +  D  +GGE+F + + +Y +  ++K   +DL+ + RA+ KL    E AK  LS++  +   ++SL DG DF   +TRA+F+ L + LF+ +L P+  +L   NL  +D  ++VL GGS RIPK+Q+L++  F G E    I  DE
Sbjct:    4 VGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAF-RDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQE--SSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDE 365          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003663.1 (pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:ENSPMAG00000003351.1 transcript:ENSPMAT00000003663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 9.382e-7
Identity = 23/52 (44.23%), Postives = 37/52 (71.15%), Query Frame = 2
Query: 1106 RAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELV 1261
            R +FE+ +A LF   + PV +VL+ ANL  +++ +I L+GG  RIPK+QE++
Sbjct:    1 REEFEDASAHLFDRAITPVYEVLKRANLSIDEVDQIELLGGGIRIPKIQEML 52          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 402/618 (65.05%), Postives = 488/618 (78.96%), Query Frame = 2
Query:  191 DKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLN-KSATKEDYIKQKSDIESILNPIVSKLY 2041
            D + +YGTVIGIDLGTTYSCV + K G+ EI+ N+QGNRITPSY+AFT D ERLIGD+AKNQ+  NP NTIFD+KRLIG ++ D SVQKDI H PF V+N D KP + V++KGE+K F PEEIS M+LGKMK IAE+YLG KVTHAVVTVPAYFNDAQRQATK+AG IAGL VLRI+NEPTAAAIAYGLDK      KEHQI+V+DLGGGTFDVSLL+I+ GVFEV AT+GDTHLGGEDFD +++      +KKK   D+  + +A+ KL+RE EKAKRALSS ++TRIEI+S +DG D SETLTRAKFEELN DLFK TL PVEKVLQD+ L+K D+ +IVLVGGSTRIPKVQ+L+  +F+GK+ +KGINPDEAVAYGAAVQAGVLSG+    D++LLDV  LTLG+E  GGVM  LI RNT IPT K  +F+T VDNQ TV   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF +DANGILKVSA DKGTG  + I ITNDK RL  E+ID+M+++AEKF  ED SIK ++E+R++LE Y +S+KNQ+N    LG K+  +D +   DA   V++WLD N ++A  ED+ ++   +  +  PI SKLY
Sbjct:   44 DDVENYGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDD-ERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKS----DKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNG--DLGEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLY 654          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 372/611 (60.88%), Postives = 463/611 (75.78%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY 2041
             +GIDLGTTYSCV  F   RVEII NDQGNR TPSY+AFT D ERLIGD+AKNQ   NP NT+FD KRLIGR++ D  V  D  HYPFKVI+   KP + V  KGE K+F PEEIS+M+L KMK  AE +LG +V  AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK++   KEH +L+FDLGGGTFDVSLL+ID+GVFEV AT GDTHLGGEDFD R++++ +  +K+K  KDL  + R++++LR   E+AKR LSS   T IEI+SL +G DF  ++TRA+FEEL ADLF+STL PVEKVL D+ L K+ I EIVLVGGSTRIPKVQ+LV  FFNGKEPN+ INPDEAVAYGAAVQA +L+GD ++    LL +     +LG+E  GG+M KLI RN+ IPT K +VF+T  DNQ  V   V+EGER   KDN+ LG+F+L+GIPPAPRGVPQIEVTF+IDANGIL VSA +KGTG    I ITNDK RL  EDIDKM+ +AEKFK EDE   QR++A+++LE Y +++KN +++      K+  +D +K   A    I+WLD +++A+ E+Y +++ ++E + NPI+SK Y
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQ---KEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSE-NNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIMSKFY 609          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 367/611 (60.07%), Postives = 464/611 (75.94%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY 2041
             +GIDLGTTYSCV  F   RVEII NDQGNR TPSY+AFT D ERLIGD+AKNQ   NP NT+FD KRLIGR++ D  V  D  H+PFKVI+ D KP + V  KGE K+F PEEIS+MVL KMK  AE YLG  V  AVVTVPAYFND+QRQATK+AG IAG+ VLRIINEPTAAAIAYGLDKK ++E   H +L+FDLGGGTFDVSLL+ID+GVFEV AT GDTHLGGEDFD R++++ +  +K+K  KD+  + R++++LR   E+AKRALSS   T IEI+SL +G DF  +LTRA+FEEL ADLF+STL PVEKVL+D+ L K+ I EIVLVGGSTRIPK+Q+LV  FFNGKEPN+ INPDEAVAYGAAVQA +L+GD +T    LL +     +LG+E  GG+M KLI RN+ IPT K + F+T  DNQ  V   V+EGER   KDN+ LG+F+L+GIPPAPRGVPQI+VTF+IDANGIL VSA +KGTG    I ITNDK RL  +DID+M+ +AEK++ +DE   +R++A+++LE Y +++KN +N+ +    K+  DD K+   A  + IDWLD +++A+ ++Y  ++ ++E I NPI++K Y
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAE---HNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEAS-FKEKVGEDDAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIMTKFY 609          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 374/615 (60.81%), Postives = 460/615 (74.80%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDG 2053
             +GIDLGTTYSCV  F   RV+II NDQGNR TPS++ FT D ERLIGD+AKNQ   NP NT+FD KRLIGR + D  VQ D+ H+PFK+I+VD KP I V  KGE K+F PE+IS+MVLGKMK  AE YLG KV  AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK     KE  +L+FDLGGGTFDVSLL+I+ G+FEV AT GDTHLGGEDFD R++++F   +K+K  KDL  + RA+++LR   E+AKR LSS   T +EI+SL +G DF  ++TRA+FEEL ADLF+STL PVEKVL+DA L K+ + EIVLVGGSTRIPKVQ+LV  +FNGKEPN+ INPDEAVAYGAAVQA +L+GD ++    LL +     +LG+E  GGVM KLI RN+ IPT K +VF+T  DNQ  V   V+EGER   KDN+ LG+F+L+GIPPAPRGVPQIEVTF++D+NGIL VSA +KGTG    I ITNDK RL  EDI+KM+ +AEKFKEEDE   QRI ++++LE   YS+KN +++    G K+   D         + I WLD N +ATKE++  Q  +++ + NPI+SKLY+  G
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFT-DTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKG----KEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA---GDKLEQADKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQAGG 610          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 372/612 (60.78%), Postives = 460/612 (75.16%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
             +GIDLGTTYSCV  F   RV+II NDQGNR TPS++AFT D ERLIGD+AKNQ   NP NT+FD KRLIGR + D  VQ D+ H+PFK+I+VD KP I V  KGE K+F PE+IS+MVLGKMK  AE YLG KV  AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK     KE  +L+FDLGGGTFDVSLL+I+ G+FEV AT GDTHLGGEDFD R++++F   +K+K  KDL  + RA+++LR   E+AKR LSS   T +EI+SL +G DF  ++TRA+FEEL ADLF+STL PVEKVL+DA L K+ + EIVLVGGSTRIPKVQ+LV  +FNGKEPN+ INPDEAVAYGAAVQA +L+GD ++    LL +     +LG+E  GGVM KLI RN+ IPT K ++F+T  DNQ  V   V+EGER   KDN+ LG+F+L+GIPPAPRGVPQIEVTF++D+NGIL VSA +KGTG    I ITNDK RL  EDI+KM+ +AEKFKEEDE   QRI ++++LE   YS+KN +++    G K+   D         + I WLD N +A+KE++  +  +++ I NPI+SKLY+
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFT-DTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKG----KEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA---GDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQ 607          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 452/646 (69.97%), Postives = 532/646 (82.35%), Query Frame = 2
Query:  107 MYCSTSFLLLLCTAGFIHSDKENE-KETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLY 2041
            M C  +   L   +  + +DK+ E KE ++K+   GTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT++GERLIGD AKNQLTTNP NT+FD KRLIGR W D+SVQ D+  +PFKV++ + KPH+ V +K E K+F  EEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYG+DKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQ V+++F  LYKKKK K+++KD RA+QKLRREVEKAKRALS+    R+EIES  +GEDFSE LTRA+FEELNA LFKSTL PV+KVL+DA+LKK++I EIVLVGGSTRIPKVQ+LV+ FF GKEP++GINPDEAVAYGAAVQAGVL G+  TG+++LLDV PLTLG+E  GGVM KLI+RNT IPT K  VF+T  DNQNTVT  V+EGER + KDNH LG+FDL GIPPAPRGVPQIEVTFEID NGIL+VSAEDKGTGNK+ I ITND+NRL PEDI++M+ DAEKF +ED+  K+++EAR+ELE Y YS+KNQ+ DK KLGGK+S DD K   +AV K I W+D N+ A+ ED+ K+K ++E ++ PIVSKLY
Sbjct:    1 MKCIYTICTLALASSLVFADKKEERKEQREKV---GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKK----EGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGEEDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIVSKLY 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 361/613 (58.89%), Postives = 461/613 (75.20%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLK-KNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
             IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERL+GD+AKNQ+  NP NTIFD KRLIGR + D  V+ D+ H+ F+V+N   +P + V  KGE K+F  EEIS+MVL KMK  AE YLG KVT AVVTVPAYFND+QRQATK+AG+I+GL VLRIINEPTAAAIAYGLDKK     +E  +L+FDLGGGTFDVS+L+I+ G+FEV +T+GDTHLGGEDFD  ++D+F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL DG DF  ++TRA+FEE+NA LFK TL PVEK ++D+ L+ K  I EIV+VGGSTRIPK+Q L++ FFNGKE NK INPDEAVAYGAAVQA +L GD +     LL +     TLG+E  GGVM   I RNT IPT +   FTT  DNQ +V   VYEGER L KDN+ LG+F+L+GIPPAPRGVPQI+VTF++D+NGIL VSA DK TG +  I ITNDK RL  EDI++M+K+AEKFK  DE++++RI++++ LE Y +SMK+ + D+ K+  K+S D+ +K        +DWL+ N+SA KE+    + ++E + NPI++KLY+
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKV---GQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDE-KVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 613          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 365/615 (59.35%), Postives = 461/615 (74.96%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLK--KNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEK 2047
             +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AF+ D ERLIGD+AKNQ+  NP NT+FD KRLIGR++ D  V +D+TH+PF VI    +P I V  KGE+KSF PEEIS+MVL KMK  AE YLG KVT AVVTVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK      E  +L++DLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD +++D+F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELN DLFK T  PVE+ ++D+ +   K  I +IVLVGGSTRIPK+Q++++  F GKE NK INPDEAVAYGAAVQA +L    D T  DLLLLDV PL++G+E  GGVM+ LI RN+ IPT +   FTT  DNQ  V   V+EGER +   N+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M+ +A K+KEEDE  + RI+ ++ LE Y YSMK+ + D  K+  KIS +D K   D   +V+ WLD N++A K+++   + ++E + NPI++KLY++
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFS-DTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGV---ERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDD-KVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 358/621 (57.65%), Postives = 460/621 (74.07%), Query Frame = 2
Query:  215 VIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQG-VFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAP 2068
             IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+ FT D ERL+GD+AKNQ+  NP NTIFD KRLIGR + D++VQ D+  +PFK+I+ +NKP I V  KGE K+F  EEIS+MVLGKMK  AE YLG+KVT AV+TVPAYFND+QRQATK+AG IAGL VLR+INEPTAAA+AYGLD   KS   E  +L+FDLGGGTFDVS+LTID G +FEV +T GDTHLGGEDFD R++++F   +K+K  KD+ K+ RA+++LR   E+AKR LSS     IE++SL +G DF   ++RA+FE+L +DLF S L PV K L DA   K+DI E+VLVGGSTR+PK+Q+++  +F+GK  NK INPDEAVAYGAAVQA +LSGD +     +L V     +LG+E  G VM KLI RN  IPT     FTT  DNQ  VT  V+EGER L K N+ LG+FDL+GIPPAPRGVPQIEVTF+IDANGIL VSA+DK TG    I ITNDK RL  E+ID+MI DAEK+K EDE+ +++I AR+ LE Y + +K+ +++ + L GK+S  D     + V +V++WL+ N  A KE++ +Q+ +++ + +PI++K++   G    P
Sbjct:    6 AIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFT-DTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLD---KSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPS-LEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVHGGSGGTQMP 621          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 456.447 bits (1173), Expect = 1.778e-151
Identity = 283/599 (47.25%), Postives = 385/599 (64.27%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESL-IDG---EDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQ 1993
            G V GIDLGTT SCV +      ++I N +G+R TPS +AFT +GERL+G  A+ Q  TNP NT++  KR IGR +    ++KD+ +  +K++   N       + G  K + P ++ A VL KMK  AE YLG  V +AVVTVPAYFND+QRQATK+AG IAGL VLR+INEPTAAA+AYG+DK      ++  I V+DLGGGTFD+S+L I +GVFEV ATNGDT+LGGEDFD  ++ +    +KK+   DL KD  A+Q+LR   EKAK  LSS + T I +  + +D    +  +  L+R+KFE L ADL   T+ P +K LQDA + K +I +++LVGG TR+PKVQ+ V+  F G+ P+K +NPDE  A                 D+LLLDV PL+LG+E  GGV  KLI RNT IPT K  VF+T  D Q  V   V++GER++  DN  LGQF L GIPPAPRGVPQ+EVTF+IDANGI+ VSA DKGTG +Q IVI +    L  + I+ MIK+AEK+ E D+  K+  EA ++ E  ++  + ++ +      ++ S++++K  + + KV + L  NK     + I+Q
Sbjct:   12 GAVCGIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNG-DAWFEVAG--KVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK-----TEDKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLPYITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF-GRVPSKAVNPDE--AVAIGAAIQGGVLAGDVKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEE---FKDQLPSEEVEKLKEEIAKVREVL-ANKDNETGETIRQ 594          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:101157378])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 450/654 (68.81%), Postives = 537/654 (82.11%), Query Frame = 2
Query:  125 FLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
              +++   G + +++E++K++       GTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W DSSVQ+DI ++PFKVI   +KPHI ++I G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALS+    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK++I EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSG+  TGD++LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PEDI++M+ DAE+F +ED+ +K+RI+AR+ELE Y YS+KNQ+ DK KLGGK+S DD +    AV + I+W++ ++ A  ED+  +K ++E ++ PI++KLY      G+   PPP
Sbjct:    4 LWVVMLVVGAVIAEEEDKKDS------VGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWGDSSVQQDIKYFPFKVIEKKSKPHIQIDIGGGQMKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKK----DGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDVVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKRLKERIDARNELESYAYSLKNQIGDKEKLGGKLSDDDKETIEKAVEEKIEWMESHQDAETEDFQAKKKELEEVVQPIITKLY------GSAGGPPP 641          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:101157378])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 450/654 (68.81%), Postives = 537/654 (82.11%), Query Frame = 2
Query:  125 FLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKG-EEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
              +++   G + +++E++K++       GTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLT+NP NT+FD KRLIGR W DSSVQ+DI ++PFKVI   +KPHI ++I G + K+F PEEISAMVL KMK  AE YLGKKVTHAVVTVPAYFNDAQRQATK+AG IAGL V+RIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+++F  LYKKK  KD++KD RA+QKLRREVEKAKRALS+    RIEIES  +GEDFSETLTRAKFEELN DLF+ST+ PV+KVL+D++LKK++I EIVLVGGSTRIPK+Q+LV+ FFNGKEP++GINPDEAVAYGAAVQAGVLSG+  TGD++LLDVCPLTLG+E  GGVM KLI RNT +PT K  +F+T  DNQ TVT  VYEGER L KDNH LG FDLTGIPPAPRGVPQIEVTFEID NGIL+V+AEDKGTGNK  I ITND+NRL PEDI++M+ DAE+F +ED+ +K+RI+AR+ELE Y YS+KNQ+ DK KLGGK+S DD +    AV + I+W++ ++ A  ED+  +K ++E ++ PI++KLY      G+   PPP
Sbjct:    4 LWVVMLVVGAVIAEEEDKKDS------VGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWGDSSVQQDIKYFPFKVIEKKSKPHIQIDIGGGQMKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKK----DGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDVVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKRLKERIDARNELESYAYSLKNQIGDKEKLGGKLSDDDKETIEKAVEEKIEWMESHQDAETEDFQAKKKELEEVVQPIITKLY------GSAGGPPP 641          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 374/617 (60.62%), Postives = 470/617 (76.18%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + DS VQ D+ H+PF VIN + +P + V  KGE K+F PEEIS+MVL KMK IAE YLGK VT+AVVTVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA + K  I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +L GD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   V+EGER + KDN+ LG+FDLTGIPPAPRGVPQIEVTF+IDANGI+ VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K ED+  ++++ A++ LE Y ++MK+ + ++ KL  KIS DD KK  D   +VI WLD N+SA KE++  Q+ ++E + NPI++KLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKNGLESYAFNMKSTVEEE-KLKDKISEDDRKKILDKCNEVISWLDRNQSAEKEEFEHQQKELEKVCNPIMTKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 376/617 (60.94%), Postives = 474/617 (76.82%), Query Frame = 2
Query:  200 LDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            +  G  +GIDLGTTYSCVGIF+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR++ D+ VQ D+ H+PFKV+N  +KP + V  KGE K+F PEEIS+MVL KMK I+E YLGK VT+AV+TVPAYFND+QRQATK+AG IAGL VLRIINEPTAAAIAYGLDKK      E  +L+FDLGGGTFDVS+LTI+ G+FEV AT GDTHLGGEDFD R++++F   +K+K  K++  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ T+ PVEK L+DA + K+ I ++VLVGGSTRIPK+Q+L++  FNG++ NK INPDEAVAYGAAVQA +L+        DLLLLDV PL+LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGIL VSA DK TG +  I ITNDK RL  EDI++M+++AE+FK EDES + +I A++ LE   ++MK+ ++D+ KL  KISS+D K   D   ++I WLD N+ A K++Y  Q+ ++E + NPI+SKLY+
Sbjct:    1 MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGG---ERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDE-KLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 372/611 (60.88%), Postives = 467/611 (76.43%), Query Frame = 2
Query:  218 IGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR + D  VQ D+ H+PF VIN + +P + V  KGE KSF PEEIS+MVL KMK IAE YLGK V +AV+TVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  S   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     IEI+SL +G DF  ++TRA+FEELNADLF+ TL PVEK L+DA + K  I +IVLVGGSTRIPK+Q+L++ FFNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +   FTT  DNQ  V   VYEGER + KDN+ LG+F+LTGIPPAPRGVPQIEVTF+IDANGI+ VSA DK TG +  I ITNDK RL  EDI++M+++AEK+K ED+  + ++ A++ LE Y ++MK+ + D+ KL GKIS +D +K  D   +VI WLD N++A +++Y  Q+ ++E + NPI++KLY+
Sbjct:    4 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGS---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDE-KLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 609          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000061528.1 (SMESG000061528.1)

HSP 1 Score: 1186.79 bits (3069), Expect = 0.000e+0
Identity = 658/659 (99.85%), Postives = 658/659 (99.85%), Query Frame = 2
Query:  107 MYCSTSFLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            MY STSFLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSLLYKKKKNKDLKKDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEAVAYGAAVQAGVLSGDSTTGDLLLLDVCPLTLGMELEGGVMAKLINRNTPIPTIKKDVFTTVVDNQNTVTTAVYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP
Sbjct:    1 MYYSTSFLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSLLYKKKKNKDLKKDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEAVAYGAAVQAGVLSGDSTTGDLLLLDVCPLTLGMELEGGVMAKLINRNTPIPTIKKDVFTTVVDNQNTVTTAVYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 659          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 456/658 (69.30%), Postives = 538/658 (81.76%), Query Frame = 2
Query:  107 MYCSTSFL-LLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTP 2077
            M  + +F+ ++LC    I    EN+K+++    DYGTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFTQ+ ERLIGD+AKNQLT+NP NTIFDVKR IGR + D +V++DI +YPF VIN +NKPH+ V +  E + F PEEISAMVLGKMK IAE YLGK+VTHAVVTVPAYFNDAQRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+DYF  LY+KK  KD++KD RA+QKLRREVEKAKR+LS+  + RI+IES  DG+DFSETLTRA+FEELN DLFK+T+ PVEKVLQD++LKK D++EIVLVGGSTRIPK+Q+LV+  F+GKEP++GINPDEAVA+GAAVQAGV+ G   TGDL+LLDVCPLTLG+E  G VM KLI RNT IPT K  +F+T  DNQ TVT  VYEGER + KDNHFLG+FDLTGIP APRGVPQIEVTFEID NGILKVSAEDKGTGNK  IVI  D+NRL PE+I+KMI DAEKF E D+ +K ++EA++ELE Y YS+K Q+NDKTKLGGK+S+D+ K   DA  + I WL+ N  A  E++ K+K  +E I  PIVSK Y+++G+  A +TP
Sbjct:    1 MMLNKNFICIILCINVVISYATENKKDSESPKDDYGTVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPFLVINKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRKKHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETLTRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLDVCPLTLGIETVGAVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIVINKDQNRLSPENIEKMINDAEKFAESDKKLKDKVEAKNELEGYAYSLKTQVNDKTKLGGKLSADEQKIILDAAQETISWLEKNPQAEVEEFKKEKKKLEDIAQPIVSKFYQQEGK--ASETP 652          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 455/657 (69.25%), Postives = 534/657 (81.28%), Query Frame = 2
Query:  107 MYCSTSFLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTP 2077
            M       ++LC    I    EN+K+++    DYGTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFTQ+ ERLIGD+AKNQLT+NP NTIFDVKR IGR + D +V++DI +YPF VIN +NKPH+ V +  E + F PEEISAMVLGKMK IAE YLGK+VTHAVVTVPAYFNDAQRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEVVATNGDTHLGGEDFDQRV+DYF  LY+KK  KD++KD RA+QKLRREVEKAKR+LS+  + RI+IES  DG+DFSETLTRA+FEELN DLFK+T+ PVEKVLQD++LKK D++EIVLVGGSTRIPK+Q+LV+  F+GKEP++GINPDEAVA+GAAVQAGV+ G   TGDL+LLDVCPLTLG+E  G VM KLI RNT IPT K  +F+T  DNQ TVT  VYEGER + KDNHFLG+FDLTGIP APRGVPQIEVTFEID NGILKVSAEDKGTGNK  IVI  D+NRL PE+I+KMI DAEKF E D+ +K ++EA++ELE Y YS+K Q+NDKTKLGGK+S+D+ K   DA  + I WL+ N  A  E++ K+K  +E I  PIVSK Y+++G+  A +TP
Sbjct:    1 MLNKNFICIILCINVVISYATENKKDSESPKDDYGTVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPFLVINKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKE----GEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRKKHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETLTRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLDVCPLTLGIETVGAVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIVINKDQNRLSPENIEKMINDAEKFAESDKKLKDKVEAKNELEGYAYSLKTQVNDKTKLGGKLSADEQKIILDAAQETISWLEKNPQAEVEEFKKEKKKLEDIAQPIVSKFYQQEGK--ASETP 651          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000062699.1 (SMESG000062699.1)

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 451/626 (72.04%), Postives = 516/626 (82.43%), Query Frame = 2
Query:  206 YGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGRQGAPKTPPP 2083
            YGTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLTTNP NT+FDVKR+IGR + D +VQ D+ H+PFKVIN +NKP + V +  E KSF PEEISAMVLGKMK IAE YLGKKVTHAVVTVPAYFNDAQRQAT +AGIIAGL VLRIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEV+ATNGDTHLGGEDFDQRV+ YF  LYKKKK KD+  D RA+QKLRREVEKAKRALS+  + RIEIESL DGEDFSETLTRA+FEELN DLF+ST+ PVEKVLQDA +KK DI EIVLVGGSTRIPKVQ+LV+ FFNGKEP++GINPDEAVA+GAAVQAGV+ G   TGD++LLDVCPLTLG+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  VYEGER + KDNHFLG+FDLTGIP APRGVPQIEVTFEID NGILKVSAEDKGTGNK  I+I  D+NRL  EDI+KMIKDAE + ++D+ +K+++EA+++LE Y YS+K Q+NDK KLG K+S  D +    AV + I WL+ N+ A  E++  QK  +E I+ PI++KLY++ G       PPP
Sbjct:   32 YGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKG----GEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIKLYKKKKGKDITDDKRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEAVAFGAAVQAGVIGGVEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG------APPP 647          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 374/614 (60.91%), Postives = 463/614 (75.41%), Query Frame = 2
Query:  209 GTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSXXXXXXXXXXXXXDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXGMELEGGVMAKLINRNTPIPTIKKXXXXXXXXXXXXXXXXXYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYE 2044
            G  IGIDLGTTYSCVG+F+ G+VEII NDQGNR TPSY+AFT D ERLIGD+AKNQ+  NP NT+FD KRLIGR++ +SSVQ D+ H+ F VIN   +P I V  KGE K+F PEEIS+MVL KMK IAE YLGK V  AVVTVPAYFND+QRQATK+AG I+GL VLRIINEPTAAAIAYGLDKK  +   E  +L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++++F   +K+K  KD+  + RA+++LR   E+AKR LSS     +EI+SL +G DF  ++TRA+FEELNADLF+STL PVEK L+DA L KN I +IVLVGGSTRIPK+Q+L++  FNGKE NK INPDEAVAYGAAVQA +LSGD +     LL +     +LG+E  GGVM  LI RNT IPT +  +FTT  DNQ  V   VYEGER + KDN+ LG+F+L GIPPAPRGVPQIEVTF+IDANGIL VSA +KGTG +  I ITNDK RL  +DI++M+ +AEK+K+EDE  K RI  ++ LE Y Y MK+ + D+ KL  KIS  D K   D   + I+WL+ N+ ATKE++     ++E + NPI++K+Y+
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGA---ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDE-KLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
The following BLAST results are available for this feature:
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA50.000e+071.84heat shock protein family A (Hsp70) member 5 [Sour... [more]
HSPA80.000e+060.45heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+060.45heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+060.45heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA20.000e+060.91heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-30.000e+070.40Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+070.40Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+070.40Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+070.40Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+070.40Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-30.000e+072.32gene:FBgn0001218 transcript:FBtr0073610[more]
Hsc70-30.000e+072.32gene:FBgn0001218 transcript:FBtr0345166[more]
Hsc70-30.000e+072.32gene:FBgn0001218 transcript:FBtr0073609[more]
Hsc70-30.000e+072.32gene:FBgn0001218 transcript:FBtr0073611[more]
Hsc70-30.000e+072.32gene:FBgn0001218 transcript:FBtr0073608[more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+069.42heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa1b0.000e+060.91heat shock protein family A (Hsp70) member 1B [Sou... [more]
hspa80.000e+059.97heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+059.97heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+059.97heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsg10.000e+069.70neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+070.09neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+070.09neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+071.79neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+073.86neuronal vesicle trafficking associated 1 [Source:... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa50.000e+071.50heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa50.000e+071.50heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa80.000e+060.45heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa20.000e+060.75heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa20.000e+060.75heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29844|BIP_DROME0.000e+072.32Endoplasmic reticulum chaperone BiP OS=Drosophila ... [more]
sp|Q16956|BIP_APLCA0.000e+069.33Endoplasmic reticulum chaperone BiP OS=Aplysia cal... [more]
sp|Q90593|BIP_CHICK0.000e+071.25Endoplasmic reticulum chaperone BiP OS=Gallus gall... [more]
sp|P07823|BIP_MESAU0.000e+071.84Endoplasmic reticulum chaperone BiP OS=Mesocricetu... [more]
sp|Q3S4T7|BIP_ICTTR0.000e+071.68Endoplasmic reticulum chaperone BiP OS=Ictidomys t... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IVM00.000e+076.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GNA80.000e+076.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0K8U1R70.000e+070.88Heat shock protein cognate 3 OS=Bactrocera latifro... [more]
A0A034VDA30.000e+070.88Heat shock 70 kDa protein cognate 3 OS=Bactrocera ... [more]
A0A267GFX20.000e+071.72Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+069.84heat shock protein family A (Hsp70) member 5 [Sour... [more]
ENSAMXT00000004733.20.000e+061.07pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
hspa80.000e+060.29heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
hspa8b0.000e+060.75heat shock cognate 70 kDa protein-like [Source:NCB... [more]
ENSAMXT00000037064.10.000e+059.61heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+071.66heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa91.123e-16047.73heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa133.315e-6935.12heat shock protein 70 family, member 13 [Source:ZF... [more]
hspa142.780e-6835.62heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
ENSPMAT00000003663.19.382e-744.23pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR20.000e+065.05ATPase involved in protein import into the ER; als... [more]
SSA40.000e+060.88Heat shock protein that is highly induced upon str... [more]
SSA30.000e+060.07ATPase involved in protein folding and the respons... [more]
SSA20.000e+060.81HSP70 family ATP-binding protein; involved in prot... [more]
SSA10.000e+060.78ATPase involved in protein folding and NLS-directe... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332960.000e+069.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303230.000e+058.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372800.000e+059.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445300.000e+057.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477231.778e-15147.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+068.81heat shock protein family A (Hsp70) member 5 [Sour... [more]
hspa50.000e+068.81heat shock protein family A (Hsp70) member 5 [Sour... [more]
hspa8b0.000e+060.62heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsp70-30.000e+060.94heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsc700.000e+060.88heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061528.10.000e+099.85SMESG000061528.1[more]
SMESG000068215.10.000e+069.30SMESG000068215.1[more]
SMESG000068215.10.000e+069.25SMESG000068215.1[more]
SMESG000062699.10.000e+072.04SMESG000062699.1[more]
SMESG000051570.10.000e+060.91SMESG000051570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003482 ID=SMED30003482|Name=Endoplasmic reticulum chaperone BiP|organism=Schmidtea mediterranea sexual|type=transcript|length=2346bp
GTTTGATGACAGATGACCTTGTAAATTTCTTAAATTATATACACGAGTTG
GATATTGACGTATTTTATTTTTAACATAGAACTATTTGAACTGCGCACTA
ACACAAATGTACTGCTCGACATCATTTCTGCTGTTACTGTGTACTGCTGG
ATTCATTCATTCGGATAAGGAAAACGAGAAAGAAACCAAAGATAAAATTC
TAGATTATGGAACAGTAATAGGCATTGATTTAGGAACTACGTATTCCTGC
GTTGGTATATTTAAAGAAGGTCGAGTAGAAATCATACCAAATGACCAGGG
CAATCGAATTACTCCGTCTTACATTGCTTTCACGCAAGATGGGGAAAGAT
TAATTGGAGATTCAGCTAAAAATCAACTGACTACAAATCCAGTTAATACA
ATATTCGATGTTAAACGATTAATTGGCCGCGAGTGGACTGACAGCAGCGT
TCAGAAAGATATAACTCATTATCCGTTTAAAGTCATTAATGTTGACAACA
AACCTCATATTAGTGTTAACATTAAAGGAGAAGAAAAATCTTTTCAACCG
GAAGAGATATCAGCAATGGTCCTTGGAAAGATGAAAACAATAGCTGAAGA
GTATCTTGGTAAAAAAGTAACTCATGCAGTTGTCACGGTCCCGGCATATT
TTAATGATGCTCAACGACAGGCAACAAAAAATGCAGGAATAATTGCTGGA
CTAATCGTATTGAGAATAATCAACGAACCAACTGCGGCTGCAATTGCTTA
TGGATTGGATAAGAAAGCTAAATCCGAACCAAAGGAACATCAAATTCTTG
TGTTTGATCTTGGAGGAGGAACATTTGATGTCTCATTGTTGACCATAGAT
CAAGGTGTTTTTGAAGTTGTTGCTACAAATGGAGATACTCATTTGGGAGG
AGAAGATTTTGACCAAAGAGTTATAGATTATTTTAGCCTGCTTTACAAGA
AAAAGAAAAATAAAGATTTAAAGAAAGATATTAGAGCTATTCAAAAGTTA
CGCAGAGAAGTAGAAAAGGCGAAACGAGCATTAAGCAGTGTTCTAACCAC
AAGAATAGAGATTGAATCTTTAATCGATGGTGAAGATTTCTCTGAAACTT
TGACTCGTGCAAAATTTGAGGAATTGAATGCAGATTTGTTTAAATCCACT
CTAATTCCAGTAGAGAAAGTTCTCCAAGATGCTAATCTTAAAAAAAATGA
CATAGCAGAAATCGTTCTCGTTGGGGGTTCTACTCGTATTCCAAAAGTTC
AGGAATTAGTTAGAGGATTTTTTAATGGAAAAGAGCCAAATAAAGGAATT
AATCCTGATGAAGCTGTCGCTTATGGAGCAGCGGTTCAAGCTGGAGTTCT
GAGTGGAGATTCAACTACAGGAGATTTATTATTGTTAGACGTCTGTCCGT
TAACTTTGGGAATGGAACTCGAAGGTGGAGTAATGGCGAAACTTATAAAT
CGGAATACTCCTATTCCAACTATTAAGAAAGACGTTTTCACCACGGTAGT
CGATAATCAAAATACCGTTACAACTGCAGTTTATGAAGGAGAAAGACAGT
TAGTTAAAGATAATCATTTCTTAGGACAATTCGATCTAACTGGAATTCCA
CCTGCACCAAGAGGAGTACCACAAATAGAAGTGACTTTTGAAATTGACGC
AAATGGAATTTTAAAGGTCAGTGCCGAAGATAAAGGAACCGGTAACAAGC
AACACATAGTAATTACGAACGATAAAAATCGGTTGAAACCGGAAGACATC
GATAAAATGATCAAGGACGCCGAGAAATTTAAAGAAGAAGATGAGTCAAT
TAAACAGAGAATTGAAGCCCGATCTGAACTGGAACAATACGTATACAGTA
TGAAAAATCAGTTAAATGATAAAACAAAACTCGGTGGCAAAATTTCCTCT
GATGATTTGAAAAAATCCAACGATGCCGTTCTTAAGGTTATTGATTGGCT
AGATTTGAATAAAAGTGCTACAAAGGAAGACTATATCAAACAAAAATCTG
ACATCGAAAGTATTCTGAATCCGATCGTATCAAAACTGTATGAAAAAGAT
GGTCGACAGGGTGCTCCTAAAACTCCGCCTCCAAAATCTTCAGAGGATGA
GAAAAAGGAGGAATTGTAATATAAAGACGAATTGTCTTATTGATTTGAAA
GTGCAAGTTAAATGTTGGTGTGGTTTTTTCTGTTAGATCGATATTTCTAT
TTAATAATGCATAATTGTAAATGGAAAATTTTCAATCAAAATATTTTTAT
CCTTTTTATTGTGTACATGTCGCGTTTCTCTACGTGTTTCTATCAATTAT
TAATATAATCAAAATTGTTTGTTTTCAATAAATTATTGTTTTGAAA
back to top

protein sequence of SMED30003482-orf-1

>SMED30003482-orf-1 ID=SMED30003482-orf-1|Name=SMED30003482-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=671bp
MYCSTSFLLLLCTAGFIHSDKENEKETKDKILDYGTVIGIDLGTTYSCVG
IFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIF
DVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEE
ISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLI
VLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQG
VFEVVATNGDTHLGGEDFDQRVIDYFSLLYKKKKNKDLKKDIRAIQKLRR
EVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLI
PVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINP
DEAVAYGAAVQAGVLSGDSTTGDLLLLDVCPLTLGMELEGGVMAKLINRN
TPIPTIKKDVFTTVVDNQNTVTTAVYEGERQLVKDNHFLGQFDLTGIPPA
PRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDK
MIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDD
LKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDGR
QGAPKTPPPKSSEDEKKEEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0000166nucleotide binding
GO:0001664G-protein coupled receptor binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0019899enzyme binding
GO:0023026MHC class II protein complex binding
GO:0031072heat shock protein binding
GO:0031625ubiquitin protein ligase binding
GO:0051082unfolded protein binding
GO:0055131C3HC4-type RING finger domain binding
Vocabulary: biological process
TermDefinition
GO:0031333negative regulation of protein complex assembly
GO:1903895negative regulation of IRE1-mediated unfolded protein response
GO:0031647regulation of protein stability
GO:0042026protein refolding
GO:0045892negative regulation of transcription, DNA-templated
GO:0046034ATP metabolic process
GO:1902904negative regulation of supramolecular fiber organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR042050BIP_NBD
IPR043129ATPase_NBD
IPR019651Glutamate_DH_NAD-spec
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
IPR029048HSP70_C_sf
IPR018181Heat_shock_70_CS
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0000974Prp19 complex
GO:0005615extracellular space
GO:0005634nucleus
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
GO:0005829cytosol
GO:0005925focal adhesion
GO:0016020membrane
GO:0030529intracellular ribonucleoprotein complex
GO:0070062extracellular exosome
GO:0072562blood microparticle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 663..670
NoneNo IPR availableCOILSCoilCoilcoord: 281..315
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 64..76
score: 73.36
coord: 87..95
score: 65.96
coord: 36..49
score: 82.73
coord: 238..248
score: 79.97
coord: 366..382
score: 77.94
coord: 174..194
score: 87.47
coord: 423..442
score: 69.89
coord: 504..520
score: 79.79
coord: 398..418
score: 80.95
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 264..347
e-value: 1.9E-166
score: 555.3
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 216..398
e-value: 1.9E-166
score: 555.3
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 37..412
e-value: 1.9E-166
score: 555.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 644..670
NoneNo IPR availablePANTHERPTHR19375:SF380ENDOPLASMIC RETICULUM CHAPERONE BIPcoord: 26..653
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.706
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 37..646
e-value: 3.7E-248
score: 824.6
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 26..653
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 543..647
e-value: 1.3E-28
score: 101.2
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 570..652
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 416..542
e-value: 1.4E-55
score: 188.4
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 421..576
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 40..47
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 232..245
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 369..383
IPR042050Endoplasmic reticulum chaperone BIP, nucleotide-binding domainCDDcd10241HSPA5-like_NBDcoord: 35..413
e-value: 0.0
score: 741.434
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 225..417
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 35..219