Lactation elevated protein 1

Overview
NameLactation elevated protein 1
Smed IDSMED30003480
Length (bp)1535
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lactation elevated protein 1 (SMED30003480) t-SNE clustered cells

Violin plots show distribution of expression levels for Lactation elevated protein 1 (SMED30003480) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lactation elevated protein 1 (SMED30003480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lactation elevated protein 1 (SMED30003480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30003480SMESG000074214.1 SMESG000074209.1 dd_Smed_v4_4382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003480SMESG000074214.1 SMESG000074209.1 dd_Smed_v4_4382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003480SMESG000074214.1 SMESG000074209.1 dd_Smed_v6_4382_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003480SMESG000074214.1 SMESG000074209.1 dd_Smed_v4_4382_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lactation elevated protein 1 vs. Ensembl Human
Match: AFG1L (AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:16411])

HSP 1 Score: 367.851 bits (943), Expect = 3.644e-122
Identity = 197/415 (47.47%), Postives = 269/415 (64.82%), Query Frame = 2
Query:  176 HKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAK--TENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPT-NELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENER-RILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSS 1408
            H  LD Y+  + +  LKDD  QR ++  L  L++ +     E +G   K+F+R  S   +GLY+YG VG+GKTM+M++FY     + KKRVHFH FM++VHK++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+YC    LDS IDYRK  LP+A +  YLTS        ++L     +  NDL T   IL V GR++   K  G +   TF ELC++PL A+DYLE+SK F T+F+ +IPQ  ++ R + RRFIT+ID+FYD K+R ICSA+     LF+      + H+ +E E+ RILMDDLGL  +  S    S+FT EEE FA  RT+SRL EM+T QYW+  
Sbjct:   73 HGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSKLFSR--SKPPRGLYVYGDVGTGKTMVMDMFYAYVEMKRKKRVHFHGFMLDVHKRIHRLKQSLPKRKPGFMAKSYDPIAPIAEEISEEACLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDL-TRPRILKVQGRELRLNKACGTVADCTFEELCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFL------HQHHDSELEQSRILMDDLGL--SQDSAEGLSMFTGEEEIFAFQRTISRLTEMQTEQYWNEG 476          
BLAST of Lactation elevated protein 1 vs. Ensembl Human
Match: AFG1L (AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:16411])

HSP 1 Score: 330.487 bits (846), Expect = 2.467e-109
Identity = 173/347 (49.86%), Postives = 232/347 (66.86%), Query Frame = 2
Query:  374 GSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPT-NELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENER-RILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSS 1408
            G+GKTM+M++FY     + KKRVHFH FM++VHK++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+YC    LDS IDYRK  LP+A +  YLTS        ++L     +  NDL T   IL V GR++   K  G +   TF ELC++PL A+DYLE+SK F T+F+ +IPQ  ++ R + RRFIT+ID+FYD K+R ICSA+     LF+      + H+ +E E+ RILMDDLGL  +  S    S+FT EEE FA  RT+SRL EM+T QYW+  
Sbjct:    7 GTGKTMVMDMFYAYVEMKRKKRVHFHGFMLDVHKRIHRLKQSLPKRKPGFMAKSYDPIAPIAEEISEEACLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDL-TRPRILKVQGRELRLNKACGTVADCTFEELCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFL------HQHHDSELEQSRILMDDLGL--SQDSAEGLSMFTGEEEIFAFQRTISRLTEMQTEQYWNEG 344          
BLAST of Lactation elevated protein 1 vs. Ensembl Human
Match: AFG1L (AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:16411])

HSP 1 Score: 95.1301 bits (235), Expect = 2.510e-22
Identity = 47/112 (41.96%), Postives = 70/112 (62.50%), Query Frame = 2
Query:  176 HKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKP 505
            H  LD Y+  + +  LKDD  QR ++  L  L++ +     E +G   K+F+R  S   +GLY+YG VG+GKTM+M++FY     + KKRVHFH FM++VHK++H +K   P
Sbjct:   40 HGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSKLFSR--SKPPRGLYVYGDVGTGKTMVMDMFYAYVEMKRKKRVHFHGFMLDVHKRIHRLKQSLP 149          
BLAST of Lactation elevated protein 1 vs. Ensembl Human
Match: AFG1L (AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:16411])

HSP 1 Score: 81.6481 bits (200), Expect = 1.622e-18
Identity = 38/82 (46.34%), Postives = 57/82 (69.51%), Query Frame = 2
Query:  467 VHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDL 712
            +H+    +  +KP  + +S    +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+ +
Sbjct:    2 IHRLKQSLPKRKPGFMAKS----YDPIAPIAEEISEEACLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEGI 79          
BLAST of Lactation elevated protein 1 vs. Ensembl Celegans
Match: C30F12.2 (pep chromosome:WBcel235:I:6967672:6970190:-1 gene:WBGene00016261.1 transcript:C30F12.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C30F12.2)

HSP 1 Score: 318.546 bits (815), Expect = 7.945e-104
Identity = 180/433 (41.57%), Postives = 253/433 (58.43%), Query Frame = 2
Query:  146 KFQFLKLNSYHKFLDD-YESKVNSGALKDDCVQRSIVTALNSLNQSIAK---TENKGFLEKIFTR-----KNSTIN-------KGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQY 1396
            K Q+L++  +   L D Y  KVN G LK+D  QR ++     L + I     T      EK  +R     +NS ++       +G+Y+YGSVG GKTMLM+LF++ C    K+RVHF++FM  VHK+MHE+K +  +N  R K   FDP+PV+   +     LLCFDEFQVTDIADAMILKR F  +F  G+ ++ATSNR P +LYK GLQR  F+PFI +L+  C    LDS +DYR+        ++Y +S +S+   + +        ND   S+  L + GR+V  +K  G +    F ELC     A DYL  ++ FHTV V +IP +     N +RRFITMID+FYD K+R +  AA   ++LF   E    +H    + +R+LMDDLG+K +D      ++F+ +EE FA+ RTVSRL EM+T +Y
Sbjct:    8 KLQYLQVQRFLVTLSDAYSKKVNEGTLKEDDYQRKMIVDFERLRKEIESYQPTNKSNISEKSSSRFWKMFQNSKVDTPKIISPRGIYLYGSVGCGKTMLMDLFFENCPIDKKRRVHFNDFMQNVHKRMHELKMQ--SNKARGK---FDPVPVIVDEIMETTNLLCFDEFQVTDIADAMILKRFFSMLFDRGLVMVATSNRAPSELYKNGLQRHQFMPFITILEDKCASLALDSGMDYRRSAAGDGN-HVYFSSEDSNTQCDIVFKQSAANENDTVRSKT-LEILGRRVIVEKCCGGVADVDFKELCMTAKGAVDYLVYARVFHTVIVRNIPIMNQDMWNAMRRFITMIDTFYDQKVRVVIGAAAPLDELF-QFEGHNTSHDALSDSKRMLMDDLGIK-SDHEGMSANVFSGDEEAFAYSRTVSRLYEMQTEKY 431          
BLAST of Lactation elevated protein 1 vs. Ensembl Celegans
Match: C30F12.2 (pep chromosome:WBcel235:I:6967670:6970145:-1 gene:WBGene00016261.1 transcript:C30F12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C30F12.2)

HSP 1 Score: 318.546 bits (815), Expect = 7.945e-104
Identity = 180/433 (41.57%), Postives = 253/433 (58.43%), Query Frame = 2
Query:  146 KFQFLKLNSYHKFLDD-YESKVNSGALKDDCVQRSIVTALNSLNQSIAK---TENKGFLEKIFTR-----KNSTIN-------KGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQY 1396
            K Q+L++  +   L D Y  KVN G LK+D  QR ++     L + I     T      EK  +R     +NS ++       +G+Y+YGSVG GKTMLM+LF++ C    K+RVHF++FM  VHK+MHE+K +  +N  R K   FDP+PV+   +     LLCFDEFQVTDIADAMILKR F  +F  G+ ++ATSNR P +LYK GLQR  F+PFI +L+  C    LDS +DYR+        ++Y +S +S+   + +        ND   S+  L + GR+V  +K  G +    F ELC     A DYL  ++ FHTV V +IP +     N +RRFITMID+FYD K+R +  AA   ++LF   E    +H    + +R+LMDDLG+K +D      ++F+ +EE FA+ RTVSRL EM+T +Y
Sbjct:    8 KLQYLQVQRFLVTLSDAYSKKVNEGTLKEDDYQRKMIVDFERLRKEIESYQPTNKSNISEKSSSRFWKMFQNSKVDTPKIISPRGIYLYGSVGCGKTMLMDLFFENCPIDKKRRVHFNDFMQNVHKRMHELKMQ--SNKARGK---FDPVPVIVDEIMETTNLLCFDEFQVTDIADAMILKRFFSMLFDRGLVMVATSNRAPSELYKNGLQRHQFMPFITILEDKCASLALDSGMDYRRSAAGDGN-HVYFSSEDSNTQCDIVFKQSAANENDTVRSKT-LEILGRRVIVEKCCGGVADVDFKELCMTAKGAVDYLVYARVFHTVIVRNIPIMNQDMWNAMRRFITMIDTFYDQKVRVVIGAAAPLDELF-QFEGHNTSHDALSDSKRMLMDDLGIK-SDHEGMSANVFSGDEEAFAYSRTVSRLYEMQTEKY 431          
BLAST of Lactation elevated protein 1 vs. Ensembl Fly
Match: CG8520 (gene:FBgn0033734 transcript:FBtr0303222)

HSP 1 Score: 320.857 bits (821), Expect = 1.813e-104
Identity = 184/431 (42.69%), Postives = 263/431 (61.02%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSI--------AKTENKGFLEKIFTRKNSTIN-------------KGLYIYGSVGSGKTMLMNLFYDACAE-QSKKRVHFHEFMIEVHKKMHEVKSKK-PTN--IHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWD 1402
            L +YE +V+SG L  D  Q   +  L++L   I        A     GF   IF RK+ST +             +GLY+YGSVG GKT LM+LF+D C +   K+RVHF  FM  VH ++HE K ++ P +   +  K   FDP   VA ++     L+CFDEFQVTDIADAM+LKRLF  +F+ GI ++ATSNRHP+DLYK GLQR NFLPFI LL++ C+V  LDS IDYR++     T        ++    N +  +     ND+      LT FGR ++F +T G++L +TF ELC +PL+ +D+L+IS++FHTV + D+PQL +  + ++RRFIT+ID+ Y++++R + S+    E LF  +   K    ++++E R LMDDL +K++     + S FT EEE FA  RT+SRL EM+ R+YW+
Sbjct:   33 LKEYEKRVSSGQLMTDNRQLQTMKELDALYHKIQGYKPSYRAGGGGGGFFSSIFGRKSSTEDDDQDDPNAGSHAPQGLYLYGSVGVGKTTLMDLFFDCCTQIHRKQRVHFTSFMNTVHTRIHEAKQRQGPVDRAFNSEKPAPFDPTKPVADLIASESWLICFDEFQVTDIADAMVLKRLFTHLFRHGIVVVATSNRHPEDLYKNGLQRTNFLPFIALLQRRCKVSQLDS-IDYRRIAQSGDTNYFVKGQTDADGSMNRMFKILCAEENDIIRPRT-LTHFGRDLTFNRTCGQVLDSTFSELCDRPLAGSDFLQISQFFHTVLIRDVPQLTLDVKAQMRRFITLIDTLYNNRVRVVISSDVALENLFSFTGGSKT---LSDSE-RTLMDDLNIKES-----KASFFTGEEELFAFDRTLSRLYEMQKREYWE 452          
BLAST of Lactation elevated protein 1 vs. Ensembl Fly
Match: CG8520 (gene:FBgn0033734 transcript:FBtr0087926)

HSP 1 Score: 320.857 bits (821), Expect = 1.813e-104
Identity = 184/431 (42.69%), Postives = 263/431 (61.02%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSI--------AKTENKGFLEKIFTRKNSTIN-------------KGLYIYGSVGSGKTMLMNLFYDACAE-QSKKRVHFHEFMIEVHKKMHEVKSKK-PTN--IHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWD 1402
            L +YE +V+SG L  D  Q   +  L++L   I        A     GF   IF RK+ST +             +GLY+YGSVG GKT LM+LF+D C +   K+RVHF  FM  VH ++HE K ++ P +   +  K   FDP   VA ++     L+CFDEFQVTDIADAM+LKRLF  +F+ GI ++ATSNRHP+DLYK GLQR NFLPFI LL++ C+V  LDS IDYR++     T        ++    N +  +     ND+      LT FGR ++F +T G++L +TF ELC +PL+ +D+L+IS++FHTV + D+PQL +  + ++RRFIT+ID+ Y++++R + S+    E LF  +   K    ++++E R LMDDL +K++     + S FT EEE FA  RT+SRL EM+ R+YW+
Sbjct:   33 LKEYEKRVSSGQLMTDNRQLQTMKELDALYHKIQGYKPSYRAGGGGGGFFSSIFGRKSSTEDDDQDDPNAGSHAPQGLYLYGSVGVGKTTLMDLFFDCCTQIHRKQRVHFTSFMNTVHTRIHEAKQRQGPVDRAFNSEKPAPFDPTKPVADLIASESWLICFDEFQVTDIADAMVLKRLFTHLFRHGIVVVATSNRHPEDLYKNGLQRTNFLPFIALLQRRCKVSQLDS-IDYRRIAQSGDTNYFVKGQTDADGSMNRMFKILCAEENDIIRPRT-LTHFGRDLTFNRTCGQVLDSTFSELCDRPLAGSDFLQISQFFHTVLIRDVPQLTLDVKAQMRRFITLIDTLYNNRVRVVISSDVALENLFSFTGGSKT---LSDSE-RTLMDDLNIKES-----KASFFTGEEELFAFDRTLSRLYEMQKREYWE 452          
BLAST of Lactation elevated protein 1 vs. Ensembl Zebrafish
Match: afg1la (AFG1 like ATPase a [Source:ZFIN;Acc:ZDB-GENE-091006-2])

HSP 1 Score: 338.961 bits (868), Expect = 3.788e-111
Identity = 181/411 (44.04%), Postives = 262/411 (63.75%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTEN--KGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMT---NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGL-KDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            L+ Y S V  G L++D  QR++V  L+ + +++    N    F  K  +++     KG YI+G VG+GKTM+M++F++    + KKRVHFH FM++VHK++H +K   P       ++ +DPI  VA+ +     LLCFDEFQVTDIADAMILK+LFE +F +G+ ++ATSNR PDDLYK GLQR NF+PFI +LK+YC+   LDS IDYR+   P+A +  YL+S    + T  L  +F +M    ND+    + L V GR ++  K  G I   TF ELC +P+ A+DYLEIS  F TVF+ +IP L ++++ + RRFIT+ID+ Y+ K+R +  A    + LF+   ++ ++ +       +L+DDLG+ +DA SS    +IFT EEE FA  RTVSRL EM+T +YW
Sbjct:   65 LEHYNSLVRDGQLREDLQQRAVVEKLDQMQKNLRGYNNDHSTFFSKFISKRKPP--KGYYIFGDVGTGKTMVMDMFFNHVETEKKKRVHFHGFMLDVHKRIHRLKQSLPKRKVGRMAKAYDPIAPVAEEISEEACLLCFDEFQVTDIADAMILKQLFENLFLNGVVVVATSNRPPDDLYKNGLQRVNFVPFIAVLKEYCQTLRLDSGIDYRRRNRPAAGKLFYLSSEPDVDAT--LDKLFDEMAFKQNDITRPRS-LKVHGRILTLDKACGTIADCTFEELCDRPIGASDYLEISAVFDTVFIRNIPLLTLNKKTQARRFITLIDTLYEHKVRVVLKAETPLDDLFVHEHHDDHDPHETH----VLLDDLGISRDAGSS---LAIFTGEEEVFAFQRTVSRLTEMQTEEYW 463          
BLAST of Lactation elevated protein 1 vs. Ensembl Zebrafish
Match: afg1lb (AFG1 like ATPase b [Source:NCBI gene;Acc:555926])

HSP 1 Score: 315.849 bits (808), Expect = 9.618e-102
Identity = 177/455 (38.90%), Postives = 265/455 (58.24%), Query Frame = 2
Query:  173 YHKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTENKGFL-----------------EKIFTRKNSTI-----------------------NKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSN-NSSNPTNEL--QTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSS 1408
            Y + +  Y+S V+ G+L+ D  QR+ +  L  L + +    N   L                 +K+ +R+   I                        +G YIYG+VG+GKTMLM+LFY     + KKRVHF+ FM++VH+++H++K   P      K  ++DPI  VA  +     L+CFDEFQV DIADAMILK+LFE +F+ G+ ++ATSNR P++LYK GLQRA F+PFI +LK+YC +  LD+ ID+R   +  A R  Y++S  ++ N  N L  +  FR+  ND+ T   +L V GR+V+  +T G I   +F ELC+QPL A DYLEI++ F TV + ++P L++  +++ RRF T+ID+FYD K+R +  A    ++L      ++      E   R+++D+LGL   D + ++ ++FT +EE FA  RTVSRL EM+T QYW S 
Sbjct:   55 YGRLVTHYDSLVHFGSLRKDPQQRTALLQLEELTRVLTDYTNIPILLPQPKDCLQNQPTSELQDKVGSRETVNICRPDENVSNEKEDQQEESSKPHPPQGYYIYGNVGTGKTMLMDLFYSFVENRRKKRVHFNGFMLDVHRRIHKLKQSLPKR-RIGKMTMYDPIFPVAMEIAEETCLICFDEFQVVDIADAMILKQLFEGLFKCGVVVVATSNRPPEELYKNGLQRAAFVPFIGVLKEYCRIVSLDTGIDFRTREMKPAGRLYYISSEPDAENAVNALFEELAFRQ--NDV-TRPRVLNVQGREVTLSRTCGTIADCSFQELCEQPLGAGDYLEIARCFDTVIIRNVPYLQLGMKDQARRFTTLIDNFYDQKVRVVMLADAPLDRLL-----DQGQMTGEEARDRLMLDELGL--TDEASKRITLFTADEEIFAFQRTVSRLAEMQTEQYWISG 498          
BLAST of Lactation elevated protein 1 vs. Ensembl Zebrafish
Match: afg1la (AFG1 like ATPase a [Source:ZFIN;Acc:ZDB-GENE-091006-2])

HSP 1 Score: 258.84 bits (660), Expect = 1.838e-82
Identity = 140/295 (47.46%), Postives = 195/295 (66.10%), Query Frame = 2
Query:  527 SQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMT---NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGL-KDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            ++ +DPI  VA+ +     LLCFDEFQVTDIADAMILK+LFE +F +G+ ++ATSNR PDDLYK GLQR NF+PFI +LK+YC+   LDS IDYR+   P+A +  YL+S    + T  L  +F +M    ND+    + L V GR ++  K  G I   TF ELC +P+ A+DYLEIS  F TVF+ +IP L ++++ + RRFIT+ID+ Y+ K+R +  A    + LF+   ++ ++     +E  +L+DDLG+ +DA SS    +IFT EEE FA  RTVSRL EM+T +YW
Sbjct:    2 AKAYDPIAPVAEEISEEACLLCFDEFQVTDIADAMILKQLFENLFLNGVVVVATSNRPPDDLYKNGLQRVNFVPFIAVLKEYCQTLRLDSGIDYRRRNRPAAGKLFYLSSEPDVDAT--LDKLFDEMAFKQNDITRPRS-LKVHGRILTLDKACGTIADCTFEELCDRPIGASDYLEISAVFDTVFIRNIPLLTLNKKTQARRFITLIDTLYEHKVRVVLKAETPLDDLFVHEHHDDHDP----HETHVLLDDLGISRDAGSS---LAIFTGEEEVFAFQRTVSRLTEMQTEEYW 286          
BLAST of Lactation elevated protein 1 vs. Ensembl Zebrafish
Match: afg1lb (AFG1 like ATPase b [Source:NCBI gene;Acc:555926])

HSP 1 Score: 186.037 bits (471), Expect = 4.151e-54
Identity = 103/265 (38.87%), Postives = 149/265 (56.23%), Query Frame = 2
Query:  173 YHKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTENKGFL-----------------EKIFTRKNSTINK-----------------------GLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLY 847
            Y + +  Y+S V+ G+L+ D  QR+ +  L  L + +    N   L                 +K+ +R+   I +                       G YIYG+VG+GKTMLM+LFY     + KKRVHF+ FM++VH+++H++K   P      K  ++DPI  VA  +     L+CFDEFQV DIADAMILK+LFE +F+ G+ ++ATSNR P++LYK GLQRA F+PFI +LK+YC +  LD+ ID+R   +  A R  Y
Sbjct:   68 YGRLVTHYDSLVHFGSLRKDPQQRTALLQLEELTRVLTDYTNIPILLPQPKDCLQNQPTSELQDKVGSRETVNICRPDENVSNEKEDQQEESSKPHPPQGYYIYGNVGTGKTMLMDLFYSFVENRRKKRVHFNGFMLDVHRRIHKLKQSLPKR-RIGKMTMYDPIFPVAMEIAEETCLICFDEFQVVDIADAMILKQLFEGLFKCGVVVVATSNRPPEELYKNGLQRAAFVPFIGVLKEYCRIVSLDTGIDFRTREMKPAGRLYY 331          
BLAST of Lactation elevated protein 1 vs. Ensembl Xenopus
Match: lix1l (limb and CNS expressed 1 like [Source:Xenbase;Acc:XB-GENE-6040737])

HSP 1 Score: 355.14 bits (910), Expect = 7.673e-118
Identity = 188/421 (44.66%), Postives = 268/421 (63.66%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLA------TSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW-DSSSHPL 1420
            L  Y+  V   +L+ D  QR ++  L +L++++   + ++KG L K+F ++ +   KGLY++G VG+GKTM+M++F+D    + KKRVHFH FM++VH ++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F +G+ ++ATSNR P+DLYK GLQRANF+PFI +LK YC    LDS IDYRK +L +A +  +LTS        +++ +  K+ ++LA      T   IL + GR++   K  G I   TF ELC +PL A+DYLE+ K F TVF+  IP L ++QR++ RRFIT+ID+FYD K+R +CSA    + LF+    +       E E +IL+DDLGL +        SIFT EEE FA  RT+SRL EM+T QYW D    P+
Sbjct:   32 LHHYDYLVKEASLRKDDHQRRVMQHLQTLHENLKGYRKDSKGVLSKLFAKRKT--QKGLYVFGDVGTGKTMVMDMFFDHVEVEQKKRVHFHGFMLDVHARIHRLKRNLPKRKAGFMAKAYDPIAPIAEEISDEACLLCFDEFQVTDIADAMILKQLFENLFLNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKNYCSTVQLDSGIDYRKRVLSAADKVYFLTSE------ADVEAVMDKLFDELAQKQNDVTRPRILKLQGRELKLHKACGSIADCTFEELCDRPLGASDYLEMCKNFDTVFIRRIPHLDMTQRSQARRFITLIDAFYDHKVRVVCSADRPLQSLFLQKVPKV------EEESKILLDDLGLNELSGG---LSIFTGEEEVFAFQRTLSRLTEMQTEQYWRDGDRSPI 435          
BLAST of Lactation elevated protein 1 vs. Ensembl Xenopus
Match: lix1l (limb and CNS expressed 1 like [Source:Xenbase;Acc:XB-GENE-6040737])

HSP 1 Score: 355.14 bits (910), Expect = 4.088e-117
Identity = 189/421 (44.89%), Postives = 269/421 (63.90%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLA------TSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW-DSSSHPL 1420
            L  Y+  V   +L+ D  QR ++  L +L++++   + ++KG L K+F ++ +   KGLY++G VG+GKTM+M++F+D    + KKRVHFH FM++VH ++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F +G+ ++ATSNR P+DLYK GLQRANF+PFI +LK YC    LDS IDYRK +L +A +  +LTS        +++ +  K+ ++LA      T   IL + GR++   K  G I   TF ELC +PL A+DYLE+ K F TVF+  IP L ++QR++ RRFIT+ID+FYD K+R +CSA    + LF+    +       E E +IL+DDLGL +  S     SIFT EEE FA  RT+SRL EM+T QYW D    P+
Sbjct:   78 LHHYDYLVKEASLRKDDHQRRVMQHLQTLHENLKGYRKDSKGVLSKLFAKRKT--QKGLYVFGDVGTGKTMVMDMFFDHVEVEQKKRVHFHGFMLDVHARIHRLKRNLPKRKAGFMAKAYDPIAPIAEEISDEACLLCFDEFQVTDIADAMILKQLFENLFLNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKNYCSTVQLDSGIDYRKRVLSAADKVYFLTSE------ADVEAVMDKLFDELAQKQNDVTRPRILKLQGRELKLHKACGSIADCTFEELCDRPLGASDYLEMCKNFDTVFIRRIPHLDMTQRSQARRFITLIDAFYDHKVRVVCSADRPLQSLFLQKVPKV------EEESKILLDDLGLNEELSG--GLSIFTGEEEVFAFQRTLSRLTEMQTEQYWRDGDRSPI 482          
BLAST of Lactation elevated protein 1 vs. Ensembl Xenopus
Match: lix1l (limb and CNS expressed 1 like [Source:Xenbase;Acc:XB-GENE-6040737])

HSP 1 Score: 354.369 bits (908), Expect = 9.522e-117
Identity = 187/418 (44.74%), Postives = 267/418 (63.88%), Query Frame = 2
Query:  194 YESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLA------TSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW-DSSSHPL 1420
            Y+  V   +L+ D  QR ++  L +L++++   + ++KG L K+F ++ +   KGLY++G VG+GKTM+M++F+D    + KKRVHFH FM++VH ++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F +G+ ++ATSNR P+DLYK GLQRANF+PFI +LK YC    LDS IDYRK +L +A +  +LTS        +++ +  K+ ++LA      T   IL + GR++   K  G I   TF ELC +PL A+DYLE+ K F TVF+  IP L ++QR++ RRFIT+ID+FYD K+R +CSA    + LF+    +       E E +IL+DDLGL +        SIFT EEE FA  RT+SRL EM+T QYW D    P+
Sbjct:   87 YDYLVKEASLRKDDHQRRVMQHLQTLHENLKGYRKDSKGVLSKLFAKRKT--QKGLYVFGDVGTGKTMVMDMFFDHVEVEQKKRVHFHGFMLDVHARIHRLKRNLPKRKAGFMAKAYDPIAPIAEEISDEACLLCFDEFQVTDIADAMILKQLFENLFLNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKNYCSTVQLDSGIDYRKRVLSAADKVYFLTSE------ADVEAVMDKLFDELAQKQNDVTRPRILKLQGRELKLHKACGSIADCTFEELCDRPLGASDYLEMCKNFDTVFIRRIPHLDMTQRSQARRFITLIDAFYDHKVRVVCSADRPLQSLFLQKVPKV------EEESKILLDDLGLNELSGG---LSIFTGEEEVFAFQRTLSRLTEMQTEQYWRDGDRSPI 487          
BLAST of Lactation elevated protein 1 vs. Ensembl Mouse
Match: Afg1l (AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:2148801])

HSP 1 Score: 364.77 bits (935), Expect = 3.990e-121
Identity = 193/411 (46.96%), Postives = 264/411 (64.23%), Query Frame = 2
Query:  176 HKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSN-NSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            H  LD Y+  + S  L++D  QR +V  L  L + +     E  G   K+F+R      KGLY+YG VG+GKTM+M++FY     + KKRVHFH FM++VH+++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+YC+   LDS +DYRK  L  A +  YLTS  +     ++L     +  NDL TS  IL V GR++   K  G +   TF ELC++PL A+DYLE+SK F TV + +IPQ  +++R + RRFIT+ID+FYD K+R ICSA+     LF+    +  +     ++ RILMDDLGL   DS+    S+FT EEE FA  RT+SRL EM+T QYW
Sbjct:   73 HGPLDHYDFLIKSQELREDEHQRRVVQCLQKLQEDLKGYSIEEGGLFSKLFSRNKPP--KGLYVYGDVGTGKTMVMDMFYAYVETKRKKRVHFHGFMLDVHRRIHHLKQSLPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCDTLQLDSGVDYRKRELAPAGKLYYLTSEADVEAVVDKLFDELAQKQNDL-TSPRILKVQGRELRLNKACGSVADCTFEELCERPLGASDYLELSKNFDTVIIRNIPQFSLAKRTQARRFITLIDNFYDFKVRIICSASAPISSLFLHQHQDSES-----DQSRILMDDLGLSQ-DSAG--LSMFTGEEEIFAFQRTISRLTEMQTEQYW 472          
BLAST of Lactation elevated protein 1 vs. Ensembl Mouse
Match: Afg1l (AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:2148801])

HSP 1 Score: 327.405 bits (838), Expect = 2.130e-108
Identity = 169/343 (49.27%), Postives = 230/343 (67.06%), Query Frame = 2
Query:  374 GSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSN-NSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            G+GKTM+M++FY     + KKRVHFH FM++VH+++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+YC+   LDS +DYRK  L  A +  YLTS  +     ++L     +  NDL TS  IL V GR++   K  G +   TF ELC++PL A+DYLE+SK F TV + +IPQ  +++R + RRFIT+ID+FYD K+R ICSA+     LF+    +  +     ++ RILMDDLGL   DS+    S+FT EEE FA  RT+SRL EM+T QYW
Sbjct:    7 GTGKTMVMDMFYAYVETKRKKRVHFHGFMLDVHRRIHHLKQSLPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCDTLQLDSGVDYRKRELAPAGKLYYLTSEADVEAVVDKLFDELAQKQNDL-TSPRILKVQGRELRLNKACGSVADCTFEELCERPLGASDYLELSKNFDTVIIRNIPQFSLAKRTQARRFITLIDNFYDFKVRIICSASAPISSLFLHQHQDSES-----DQSRILMDDLGLSQ-DSAG--LSMFTGEEEIFAFQRTISRLTEMQTEQYW 340          
BLAST of Lactation elevated protein 1 vs. Ensembl Mouse
Match: Afg1l (AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:2148801])

HSP 1 Score: 198.364 bits (503), Expect = 2.560e-59
Identity = 96/200 (48.00%), Postives = 134/200 (67.00%), Query Frame = 2
Query:  176 HKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKK 769
            H  LD Y+  + S  L++D  QR +V  L  L + +     E  G   K+F+R      KGLY+YG VG+GKTM+M++FY     + KKRVHFH FM++VH+++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+
Sbjct:   73 HGPLDHYDFLIKSQELREDEHQRRVVQCLQKLQEDLKGYSIEEGGLFSKLFSRNKPP--KGLYVYGDVGTGKTMVMDMFYAYVETKRKKRVHFHGFMLDVHRRIHHLKQSLPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKE 270          
BLAST of Lactation elevated protein 1 vs. Ensembl Mouse
Match: Afg1l (AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:2148801])

HSP 1 Score: 81.6481 bits (200), Expect = 1.170e-18
Identity = 37/78 (47.44%), Postives = 54/78 (69.23%), Query Frame = 2
Query:  479 MHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDL 712
            +H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+ +
Sbjct:    2 IHHLKQSLPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEGI 79          
BLAST of Lactation elevated protein 1 vs. UniProt/SwissProt
Match: sp|Q8WV93|AFG1L_HUMAN (AFG1-like ATPase OS=Homo sapiens OX=9606 GN=AFG1L PE=1 SV=2)

HSP 1 Score: 367.851 bits (943), Expect = 1.750e-121
Identity = 197/415 (47.47%), Postives = 269/415 (64.82%), Query Frame = 2
Query:  176 HKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAK--TENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPT-NELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENER-RILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSS 1408
            H  LD Y+  + +  LKDD  QR ++  L  L++ +     E +G   K+F+R  S   +GLY+YG VG+GKTM+M++FY     + KKRVHFH FM++VHK++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+YC    LDS IDYRK  LP+A +  YLTS        ++L     +  NDL T   IL V GR++   K  G +   TF ELC++PL A+DYLE+SK F T+F+ +IPQ  ++ R + RRFIT+ID+FYD K+R ICSA+     LF+      + H+ +E E+ RILMDDLGL  +  S    S+FT EEE FA  RT+SRL EM+T QYW+  
Sbjct:   73 HGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSKLFSR--SKPPRGLYVYGDVGTGKTMVMDMFYAYVEMKRKKRVHFHGFMLDVHKRIHRLKQSLPKRKPGFMAKSYDPIAPIAEEISEEACLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDL-TRPRILKVQGRELRLNKACGTVADCTFEELCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFL------HQHHDSELEQSRILMDDLGL--SQDSAEGLSMFTGEEEIFAFQRTISRLTEMQTEQYWNEG 476          
BLAST of Lactation elevated protein 1 vs. UniProt/SwissProt
Match: sp|Q3V384|AFG1L_MOUSE (AFG1-like ATPase OS=Mus musculus OX=10090 GN=Afg1l PE=1 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.791e-120
Identity = 193/411 (46.96%), Postives = 264/411 (64.23%), Query Frame = 2
Query:  176 HKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSN-NSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            H  LD Y+  + S  L++D  QR +V  L  L + +     E  G   K+F+R      KGLY+YG VG+GKTM+M++FY     + KKRVHFH FM++VH+++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+YC+   LDS +DYRK  L  A +  YLTS  +     ++L     +  NDL TS  IL V GR++   K  G +   TF ELC++PL A+DYLE+SK F TV + +IPQ  +++R + RRFIT+ID+FYD K+R ICSA+     LF+    +  +     ++ RILMDDLGL   DS+    S+FT EEE FA  RT+SRL EM+T QYW
Sbjct:   73 HGPLDHYDFLIKSQELREDEHQRRVVQCLQKLQEDLKGYSIEEGGLFSKLFSRNKPP--KGLYVYGDVGTGKTMVMDMFYAYVETKRKKRVHFHGFMLDVHRRIHHLKQSLPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCDTLQLDSGVDYRKRELAPAGKLYYLTSEADVEAVVDKLFDELAQKQNDL-TSPRILKVQGRELRLNKACGSVADCTFEELCERPLGASDYLELSKNFDTVIIRNIPQFSLAKRTQARRFITLIDNFYDFKVRIICSASAPISSLFLHQHQDSES-----DQSRILMDDLGLSQ-DSAG--LSMFTGEEEIFAFQRTISRLTEMQTEQYW 472          
BLAST of Lactation elevated protein 1 vs. UniProt/SwissProt
Match: sp|Q32PX9|AFG1L_RAT (AFG1-like ATPase OS=Rattus norvegicus OX=10116 GN=Afg1l PE=2 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 6.349e-119
Identity = 191/416 (45.91%), Postives = 267/416 (64.18%), Query Frame = 2
Query:  176 HKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAK--TENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLA------TSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            H  L  Y+  + +  LK+D  QR +V  L  L + +     E  G   K+F+R      KGLY+YG VG+GKTM+M++FY+    +SK+RVHFH FM++VHK++H +K   P       ++ +DPI  +A+ +     LLCFDEFQVTDIADAMILK+LFE +F++G+ ++ATSNR P+DLYK GLQRANF+PFI +LK+YC    LDS +DYRK  L  A +  YLTS        ++ T+  K+ ++LA      TS  IL V GR++   K  G +   TF ELC++PL A+DYLE+SK F TV + +IPQ  +++R ++RRFIT+ID+FYD K+R ICSA+     LF+    +  +     ++ R+LMDDLGL   DS+    S+FT EEE F+  RT+SRL EM+T QYW
Sbjct:   73 HGPLAHYDFLIKAQELKNDEHQRRVVQCLQKLQEDLKGYNIEEGGLFSKLFSRNKPP--KGLYVYGDVGTGKTMVMDMFYEYVEVKSKRRVHFHGFMLDVHKRIHRLKQSLPKRKVGFMAKSYDPIAPIAEEISQEASLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSGVDYRKRELTPAGKLYYLTSE------ADVGTVMDKLFDELAQKQNDLTSPRILKVQGRELRLNKACGTVADCTFEELCERPLGASDYLELSKNFDTVIIRNIPQFSLAKRTQVRRFITLIDNFYDFKVRIICSASVPISSLFVYQHQDSES-----DQSRVLMDDLGLSQ-DSAG--LSMFTGEEEIFSFQRTLSRLTEMQTEQYW 472          
BLAST of Lactation elevated protein 1 vs. UniProt/SwissProt
Match: sp|P46441|N2B_HAEIR (Putative ATPase N2B OS=Haematobia irritans OX=7368 PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 3.771e-109
Identity = 181/429 (42.19%), Postives = 265/429 (61.77%), Query Frame = 2
Query:  194 YESKVNSGALKDDCVQRSIVTALNSLNQSIAKTENK----------GFLEKIFTRK---------NSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKK-RVHFHEFMIEVHKKMHEVKSKKPTN---IHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMT---NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWD 1402
            YE ++ S  L  D VQ+     L  L  ++   + K          GF  +   ++         N+T  KG+YIYGSVG GKT LM++FY  C +  KK RVHF+ FM +VH  +H+VK ++       +  K   FDP   VA+M+ +   L+CFDEFQVTDIADAMILK LF  +F  GI  IATSNRHP+DLYK GLQR+NF+PFI +L   C V  +DS +DYR+ I  S   N ++T+   +   ++++ MF+ +    ND+     I T FGR ++F++T G++L + F ELC +PL  +DY++I ++FHTV + D+PQL +  ++++RRFIT+ID+ YD+++R + SA    +QLF  ++  K+      +E+R+LMDDL L D D+S    S+FT EEE FA  RT+SRL EM+ ++YW+
Sbjct:   41 YEQRIESKELLPDKVQKKTTQELEDLYNTLKNYQPKPVRVETSSGGGFFGRFMKKEQSAPKIELLNTTAPKGMYIYGSVGGGKTTLMDMFYSCCDDIPKKQRVHFNSFMSKVHGLIHKVKQERGPQDRAFNSEKPLPFDPTLPVAEMIANESWLICFDEFQVTDIADAMILKSLFTHLFNEGIVCIATSNRHPNDLYKNGLQRSNFIPFIGVLLNRCNVAAMDSGVDYRR-IAQSGDTNYFVTTQTDAK--SQMERMFKILCSQENDIIRPRTI-THFGRDLTFQRTCGQVLDSNFEELCNRPLGGSDYIQIGQFFHTVLIHDVPQLTLLLKSQMRRFITLIDTLYDNRVRVVISAEVPLDQLFSFTDKPKD----LADEQRMLMDDLKLGDTDTS---ASVFTGEEEMFAFDRTISRLYEMQKKEYWE 458          
BLAST of Lactation elevated protein 1 vs. UniProt/SwissProt
Match: sp|Q5TYS0|LCE1B_DANRE (Lactation elevated protein 1 homolog B OS=Danio rerio OX=7955 GN=lace1b PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 7.260e-101
Identity = 177/455 (38.90%), Postives = 265/455 (58.24%), Query Frame = 2
Query:  173 YHKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTENKGFL-----------------EKIFTRKNSTI-----------------------NKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSN-NSSNPTNEL--QTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSS 1408
            Y + +  Y+S V+ G+L+ D  QR+ +  L  L + +    N   L                 +K+ +R+   I                        +G YIYG+VG+GKTMLM+LFY     + KKRVHF+ FM++VH+++H++K   P      K  ++DPI  VA  +     L+CFDEFQV DIADAMILK+LFE +F+ G+ ++ATSNR P++LYK GLQRA F+PFI +LK+YC +  LD+ ID+R   +  A R  Y++S  ++ N  N L  +  FR+  ND+ T   +L V GR+V+  +T G I   +F ELC+QPL A DYLEI++ F TV + ++P L++  +++ RRF T+ID+FYD K+R +  A    ++L      ++      E   R+++D+LGL   D + ++ ++FT +EE FA  RTVSRL EM+T QYW S 
Sbjct:   55 YGRLVTHYDSLVHFGSLRKDPQQRTALLQLEELTRVLTDYTNIPILLPQPKDCLQNQPTSELQDKVGSRETVNICRPDENVSNEKEDQQEESSKPHPPQGYYIYGNVGTGKTMLMDLFYSFVENRRKKRVHFNGFMLDVHRRIHKLKQSLPKR-RIGKMTMYDPIFPVAMEIAEETCLICFDEFQVVDIADAMILKQLFEGLFKCGVVVVATSNRPPEELYKNGLQRAAFVPFIGVLKEYCRIVSLDTGIDFRTREMKPAGRLYYISSEPDAENAVNALFEELAFRQ--NDV-TRPRVLNVQGREVTLSRTCGTIADCSFQELCEQPLGAGDYLEIARCFDTVIIRNVPYLQLGMKDQARRFTTLIDNFYDQKVRVVMLADAPLDRLL-----DQGQMTGEEARDRLMLDELGL--TDEASKRITLFTADEEIFAFQRTVSRLAEMQTEQYWISG 498          
BLAST of Lactation elevated protein 1 vs. TrEMBL
Match: A0A1S3JT02 (AFG1-like ATPase OS=Lingula unguis OX=7574 GN=LOC106175895 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 5.954e-127
Identity = 199/407 (48.89%), Postives = 269/407 (66.09%), Query Frame = 2
Query:  194 YESKVNSGALKDDCVQRSIVTALNSLNQSIAKTE--NKGFLEKIFTRKNST-INKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPT--NELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            Y+ +V  G L +D  QR IV  L SL   +   +    GF  K+F +++     KGLY++GSVG GKTMLM+LF+  C  + KKRVHFH FM++VHK++H  KS  P +  R+  +L+DPI  VAK +     LLCFDEFQVTDIADAMIL+RLF  +F+SG+ ++ATSNRHPDDLYK GLQR NF+PFI  LKK+C V CLDS +DYR+  +P+  +  +LTS+  +     N  QT+  +  +D+    ++L VFGR++   +  G ++  TF ELC++PL A DYLE+SK F TVFV++IP L +S +   RRFITMID+FYD+K+R +CSA   P++LF ++E       I +N  R LMDDLG+        + SIFT EEE FA  RT+SRL EM+T  YW
Sbjct:   67 YDHRVQQGKLNEDSYQRKIVKELQSLYTRLQGYQPVEPGFFSKLFGKEHKVDAPKGLYLHGSVGCGKTMLMDLFHAECELEKKKRVHFHSFMLDVHKRIHAFKSSMPKD--RNHKELYDPILPVAKEISSEAWLLCFDEFQVTDIADAMILRRLFTVMFESGVVVVATSNRHPDDLYKNGLQRGNFVPFIGELKKHCSVLCLDSGLDYRQQAMPAEGKVYFLTSDKDTEEQIDNIFQTLIGE-EDDVLRPRSLL-VFGRQLVLPRACGAVVDCTFEELCERPLGAVDYLEMSKEFDTVFVKNIPILSLSNKTAARRFITMIDTFYDNKVRLVCSAEAPPKELF-AAEKLSTQDIIEQN--RALMDDLGINANSGEETKASIFTGEEELFAFERTISRLTEMQTEDYW 466          
BLAST of Lactation elevated protein 1 vs. TrEMBL
Match: A0A151ILL9 (Putative ATPase N2B OS=Cyphomyrmex costatus OX=456900 GN=ALC62_03264 PE=4 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 1.592e-126
Identity = 202/411 (49.15%), Postives = 269/411 (65.45%), Query Frame = 2
Query:  197 ESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFR---KMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSH 1414
            + K+  G L DD  Q  +V +L  + Q +   K +    LEK F  K     KGLYIYG+VG GKTMLM+LFY+ C  ++KKRVHFH FM++VH ++HEVK     +   +K Q FDPIP VA  +     LLCFDEFQVTDIADAMILKRLF  +F +G+ ++ATSNR PDDLYK GLQR NF+PFI +LK +C V+ LDS IDYR   L S + N  +      + TN++  +F+    M ND+     I ++ GR V+F+KT G++L +TF ELC +PL A+DYL++S+ FHTV + D+PQL +  +++ RRFIT+ID+ YD+K+R + SAA    QLF+ SENE        +E+RILMDDL +      H+  +IFT EEE FA  RTVSRL EM+T QYW+   H
Sbjct:   50 QQKIARGELMDDTYQIKVVQSLQKIYQEVQDYKPQQLNLLEKWFGSKRRDAPKGLYIYGAVGGGKTMLMDLFYNCCQIENKKRVHFHSFMLDVHSRVHEVKKTIVRDATSTKLQPFDPIPPVASGIAEETWLLCFDEFQVTDIADAMILKRLFTELFDNGVIVVATSNRSPDDLYKNGLQRGNFVPFIKVLKDHCLVNNLDSGIDYR---LKSGSGNKKIYFIKGKDATNDVDKVFKYLCSMENDVIRPRTI-SIRGRNVTFRKTCGQVLDSTFEELCDRPLGASDYLQLSQIFHTVIIRDVPQLNLRLKSQARRFITLIDTLYDNKVRVVMSAAVPHTQLFL-SENESE----YTDEKRILMDDLKITHGSEDHK-ANIFTGEEEIFAFDRTVSRLAEMQTSQYWEQWEH 450          
BLAST of Lactation elevated protein 1 vs. TrEMBL
Match: A0A151XB77 (Putative ATPase N2B (Fragment) OS=Trachymyrmex zeteki OX=64791 GN=ALC60_03551 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.296e-124
Identity = 199/411 (48.42%), Postives = 268/411 (65.21%), Query Frame = 2
Query:  197 ESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFR---KMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSH 1414
            + K+  G L +D  Q  +   L  + Q +   K +    LEK F  K     KGLYIYG+VG GKTMLM+LFY+ C  ++KKRVHFH FM++VH ++HEVK     ++  +K Q FDPIP +A  +     LLCFDEFQVTDIADAMILKRLF  +F +G+ ++ATSNR PDDLYK GLQR NF+PFI +LK +C V  LDS IDYR   L S + N  +      + TN++  +F+    M ND+  S  I ++ GR V+F+KT G++L +TF ELC +PL A+DYL++S+ FHTV + D+PQL +  +++ RRFIT+ID+ YD+K+R + SAA    QLF+ SENE        +E+R+LMDDL +      H+  +IFT EEE FA  RTVSRL EM+T QYW+   H
Sbjct:   55 KQKIARGELMNDTYQTKVTQTLQQIYQEVQDYKPQQLNLLEKWFGSKRRDAPKGLYIYGAVGGGKTMLMDLFYNCCQIENKKRVHFHSFMLDVHSRVHEVKKTIVRDVTSTKLQPFDPIPPIASDIAEETWLLCFDEFQVTDIADAMILKRLFTELFDNGVIVVATSNRSPDDLYKNGLQRGNFVPFIKVLKDHCLVSNLDSGIDYR---LKSGSGNKKIYFIKGKDATNDVDKVFKYLCSMENDVIRSRTI-SIRGRNVTFRKTCGQVLDSTFEELCDRPLGASDYLQLSQIFHTVIIRDMPQLNLRLKSQARRFITLIDTLYDNKVRVVMSAAVPHTQLFL-SENESE----YTDEKRMLMDDLKITHGSEDHK-ANIFTGEEEIFAFDRTVSRLAEMQTSQYWEQWEH 455          
BLAST of Lactation elevated protein 1 vs. TrEMBL
Match: A0A195F167 (Putative ATPase N2B OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_11314 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 5.309e-124
Identity = 199/411 (48.42%), Postives = 267/411 (64.96%), Query Frame = 2
Query:  197 ESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFR---KMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSH 1414
            + K+  G L +D  Q  +   L  + Q +   K +    LEK F  K     KGLYIYG+VG GKTMLM+LFY+ C  ++KKRVHFH FM++VH ++HEVK     ++  +K Q FDPIP VA  +     LLCFDEFQVTDIADAMILKRLF  +F +G+ ++ATSNR PDDLYK GLQR NF+PFI +LK +C V  LDS IDYR   L S + N  +      + TN++  +F+    M ND+     I ++ GR V+F+KT G++L +TF ELC +PL A+DYL++S+ FHTV + D+PQL +  +++ RRFIT+ID+ YD+K+R + SAA    QLF+ SENE        +E+R+LMDDL +      H+  +IFT EEE FA  RTVSRL EM+T QYW+   H
Sbjct:   50 KQKIARGELMNDTYQTKVAQTLQQIYQEVQDYKPQQLNLLEKWFYSKRRDAPKGLYIYGAVGGGKTMLMDLFYNCCQIENKKRVHFHSFMLDVHSRVHEVKKTIVRDMTSTKLQPFDPIPPVASGIAEETWLLCFDEFQVTDIADAMILKRLFTELFDNGVIVVATSNRSPDDLYKNGLQRGNFVPFIKVLKDHCFVSNLDSGIDYR---LKSGSGNKKIYFIKGKDATNDVDKVFKYLCSMENDVIRPRTI-SIRGRNVTFRKTCGQVLDSTFEELCDRPLGASDYLQLSQIFHTVIIRDMPQLNLRLKSQARRFITLIDTLYDNKVRVVMSAAVPHTQLFL-SENESE----YTDEKRMLMDDLKITHGSEDHK-ANIFTGEEEIFAFDRTVSRLAEMQTSQYWEQWEH 450          
BLAST of Lactation elevated protein 1 vs. TrEMBL
Match: A0A0M9A8A8 (Putative ATPase N2B OS=Melipona quadrifasciata OX=166423 GN=WN51_05795 PE=4 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 2.669e-123
Identity = 192/408 (47.06%), Postives = 268/408 (65.69%), Query Frame = 2
Query:  197 ESKVNSGALKDDCVQRSIVTALNSLNQSIA--KTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSH 1414
            ++K+  G L +D  Q  +   L S+ + I   K E    L+K   RK     KGLYIYG+VG GKTMLM+LFY+ C  ++KKRVHFH FM++VH K+HEVK     +I  +K Q FDPIP VAK +     LLCFDEFQVTDIADAM+LKRLF  +F +G+ +IATSNR PDDLYK GLQR NF+PFI +LK YC ++ LDS IDYR     +  +  ++   ++++  +++        ND+  S  I ++ GR V+F++T G++L +TF ELC +PL A DYLE+S+ FHTV + D+PQL    +++ RRFIT+ID+ YD+K+R + SAA    +LF+    E +N Y   +E+R+LMDDL +      H+ +++FT EEE FA  RT+SRL EM+T +YW+   H
Sbjct:   48 KNKIAKGELMEDEHQIKVAKTLQSIYEEINGYKPEEFNLLDKWLGRKRKQPPKGLYIYGAVGGGKTMLMDLFYECCQIENKKRVHFHSFMVDVHNKVHEVKKNIVRDISSTKLQPFDPIPPVAKSITEEAWLLCFDEFQVTDIADAMLLKRLFTELFNNGVIVIATSNRAPDDLYKNGLQRGNFIPFIQVLKNYCIINSLDSGIDYRLKTGLTDEKIYFIKGKDATSDVDKVFKYLCSQENDVVRSRTI-SIRGRNVTFERTCGQVLDSTFAELCDRPLGAGDYLELSQAFHTVIIRDVPQLDFRLKSQTRRFITLIDTLYDNKVRVVISAAVPHTKLFVP---EGDNEYT--DEKRMLMDDLKISHGSDDHK-SNLFTGEEELFAFDRTISRLSEMQTARYWEQWQH 448          
BLAST of Lactation elevated protein 1 vs. Ensembl Cavefish
Match: afg1la (AFG1-like ATPase [Source:NCBI gene;Acc:103026430])

HSP 1 Score: 358.221 bits (918), Expect = 1.064e-118
Identity = 193/416 (46.39%), Postives = 266/416 (63.94%), Query Frame = 2
Query:  170 SYHKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTEN--KGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMT---NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLK-DADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            S+   L+ Y + + SG L++D  QR+++  L+ + + +    N  + F  K+F+++     KG+YIYG VG+GKTM+M++FY      +KKRVHFH FMI+VHK++H +K   P       ++ +DPI  VA+ +     LLCFDEFQVTDIADAMILK+LFE +F  G+ ++ATSNR PDDLYK GLQR NF+PFI +LK YC    LDS IDYRK   P+A +  Y +S ++   T  L  +F ++    ND+ T    L V GR ++  K  G I   TF ELC +PL A+DYLE+S  F TVF+ +IP L ++++ + RRFIT+ID+FYD K+R +  A    E+LF+       N   +E+E  IL+DDLGLK D+ SS    SIFT EEE FA  RTVSRL EM+T +YW
Sbjct:   62 SFSGPLEHYNNLIQSGLLQEDQQQRAVLQELDLMQKKLKGYNNHPESFFSKLFSKQKPP--KGVYIYGDVGTGKTMVMDMFYSHVEMSNKKRVHFHGFMIDVHKRIHRLKQSLPKRKAGKMAKAYDPIAPVAEEISEEASLLCFDEFQVTDIADAMILKQLFENLFLHGVVVVATSNRPPDDLYKNGLQRVNFVPFIAVLKNYCRTLRLDSGIDYRKRNRPAAGKLFYHSSEDNVQAT--LDKLFDELAFKQNDI-TRPRPLKVHGRTLTLNKACGTIADCTFEELCDRPLGASDYLEMSTVFDTVFIRNIPLLTLNKKTQARRFITLIDAFYDHKVRVVLEAEAPLEELFV-------NEGHHEDESHILIDDLGLKRDSASS---LSIFTGEEEVFAFQRTVSRLTEMQTEEYW 462          
BLAST of Lactation elevated protein 1 vs. Ensembl Cavefish
Match: afg1lb (AFG1 like ATPase [Source:NCBI gene;Acc:103023529])

HSP 1 Score: 298.516 bits (763), Expect = 5.725e-95
Identity = 157/358 (43.85%), Postives = 229/358 (63.97%), Query Frame = 2
Query:  347 KGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPI-PVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNE--LQTMFRKMT---NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENER-RILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            +G YI+G VG+GKTMLM+LF        KKR+HF+ FM+++H+++H +K   P      K  ++DPI PV  ++    C LLC DEFQV DIADAMILK+LF  +F  G+ ++ATSNR P++LYK GLQRA F+PFI +LK+ C    LD+ IDYR+  +    +  Y+    SS P  E  + T+F ++    ND+     +LTV GR+++  +T G I   TF ELC +PL A+DYLE+ ++F TV + ++P+LK+  ++++RRFIT+ID FYD K+R +  A    + LF+            E ER R+++D+LGL   + S ++ ++FT EEE FA  RT+SRL EM+T QYW
Sbjct:  173 RGCYIHGGVGTGKTMLMDLFNSHVTNSRKKRLHFNSFMLDIHRRIHRLKQSLPKR-QIGKMTIYDPIFPVAMEIASETC-LLCLDEFQVVDIADAMILKQLFSGLFSCGVVLVATSNRPPEELYKNGLQRAAFVPFIGVLKENCRTLSLDTGIDYRRREMLPPEKYYYI----SSEPDAEAAVNTLFDELAYRQNDVMRPR-VLTVQGRQLTLSRTCGTIADCTFQELCDRPLGASDYLELVRHFDTVIIRNVPRLKVGLKDQVRRFITLIDIFYDQKVRVVVLAEAPLQLLFVGGP------LSGEEERDRLMLDELGL--TNESWKRLTLFTAEEEIFALQRTLSRLTEMQTEQYW 515          
BLAST of Lactation elevated protein 1 vs. Ensembl Cavefish
Match: afg1lb (AFG1 like ATPase [Source:NCBI gene;Acc:103023529])

HSP 1 Score: 285.804 bits (730), Expect = 2.516e-90
Identity = 152/349 (43.55%), Postives = 222/349 (63.61%), Query Frame = 2
Query:  374 GSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPI-PVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNE--LQTMFRKMT---NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENER-RILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            G+GKTMLM+LF        KKR+HF+ FM+++H+++H +K   P      K  ++DPI PV  ++    C LLC DEFQV DIADAMILK+LF  +F  G+ ++ATSNR P++LYK GLQRA F+PFI +LK+ C    LD+ IDYR+  +    +  Y+    SS P  E  + T+F ++    ND+     +LTV GR+++  +T G I   TF ELC +PL A+DYLE+ ++F TV + ++P+LK+  ++++RRFIT+ID FYD K+R +  A    + LF+            E ER R+++D+LGL   + S ++ ++FT EEE FA  RT+SRL EM+T QYW
Sbjct:  163 GTGKTMLMDLFNSHVTNSRKKRLHFNSFMLDIHRRIHRLKQSLPKR-QIGKMTIYDPIFPVAMEIASETC-LLCLDEFQVVDIADAMILKQLFSGLFSCGVVLVATSNRPPEELYKNGLQRAAFVPFIGVLKENCRTLSLDTGIDYRRREMLPPEKYYYI----SSEPDAEAAVNTLFDELAYRQNDVMRPR-VLTVQGRQLTLSRTCGTIADCTFQELCDRPLGASDYLELVRHFDTVIIRNVPRLKVGLKDQVRRFITLIDIFYDQKVRVVVLAEAPLQLLFVGGP------LSGEEERDRLMLDELGL--TNESWKRLTLFTAEEEIFALQRTLSRLTEMQTEQYW 496          
BLAST of Lactation elevated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010123.1 (pep scaffold:Pmarinus_7.0:GL488924:337:3164:1 gene:ENSPMAG00000009163.1 transcript:ENSPMAT00000010123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 1.935e-31
Identity = 65/162 (40.12%), Postives = 94/162 (58.02%), Query Frame = 2
Query:  935 ILTVFGRKVSFKKTIGRILYATFPELCQ--QPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSH 1414
            +L V GR++  ++  G +   TF E     QPL A+DYLE+ ++F TVFV  +P+L ++QR + RRFIT +D+ YD+K+    S A  P  L  +SE + +         R LMDDLG+  A++S    S+F  +EE FA  RT SRL EM T  YW + + 
Sbjct:    6 LLRVGGRELRLRRACGDVADCTFSERVSPSQPLGASDYLELCRHFRTVFVRRVPRLALAQRTQARRFITFVDTLYDAKVATPLS-AEVPLSLLFASEPDGSMD-------RELMDDLGI--AEASAASLSVFGGQEETFAFARTTSRLTEMHTHAYWSAGTR 157          
BLAST of Lactation elevated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010124.1 (pep scaffold:Pmarinus_7.0:GL488924:337:2233:1 gene:ENSPMAG00000009163.1 transcript:ENSPMAT00000010124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 2.123e-31
Identity = 65/162 (40.12%), Postives = 94/162 (58.02%), Query Frame = 2
Query:  935 ILTVFGRKVSFKKTIGRILYATFPELCQ--QPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSH 1414
            +L V GR++  ++  G +   TF E     QPL A+DYLE+ ++F TVFV  +P+L ++QR + RRFIT +D+ YD+K+    S A  P  L  +SE + +         R LMDDLG+ +A ++    S+F  +EE FA  RT SRL EM T  YW+   H
Sbjct:    6 LLRVGGRELRLRRACGDVADCTFSERVSPSQPLGASDYLELCRHFRTVFVRRVPRLALAQRTQARRFITFVDTLYDAKVATPLS-AEVPLSLLFASEPDGSMD-------RELMDDLGIAEASAA--SLSVFGGQEETFAFARTTSRLTEMHTHAYWNQYRH 157          
BLAST of Lactation elevated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010126.1 (pep scaffold:Pmarinus_7.0:GL488924:346:2559:1 gene:ENSPMAG00000009163.1 transcript:ENSPMAT00000010126.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 6.139e-31
Identity = 65/157 (41.40%), Postives = 92/157 (58.60%), Query Frame = 2
Query:  935 ILTVFGRKVSFKKTIGRILYATFPELCQ--QPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            +L V GR++  ++  G +   TF E     QPL A+DYLE+ ++F TVFV  +P+L ++QR + RRFIT +D+ YD+K+    S A  P  L  +SE + +         R LMDDLG+  A++S    S+F  +EE FA  RT SRL EM T  YW
Sbjct:    3 LLRVGGRELRLRRACGDVADCTFSERVSPSQPLGASDYLELCRHFRTVFVRRVPRLALAQRTQARRFITFVDTLYDAKVATPLS-AEVPLSLLFASEPDGSMD-------RELMDDLGI--AEASAASLSVFGGQEETFAFARTTSRLTEMHTHAYW 149          
BLAST of Lactation elevated protein 1 vs. Ensembl Yeast
Match: AFG1 (Protein that may act as a chaperone for cytochrome c oxidase subunits; conserved protein; may act as a chaperone in the degradation of misfolded or unassembled cytochrome c oxidase subunits; localized to matrix face of the mitochondrial inner membrane; member of the AAA family but lacks a protease domain [Source:SGD;Acc:S000000778])

HSP 1 Score: 253.447 bits (646), Expect = 1.076e-78
Identity = 162/480 (33.75%), Postives = 250/480 (52.08%), Query Frame = 2
Query:  146 KFQFLKLNSYHKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQS-------IAKTENK-----GFL---EKIFTRK--------------NSTINKGLYIYGSVGSGKTMLMNLFYDACAEQ-SKKRVHFHEFMIEVHKKMHE-VKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQS--GIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQT-----------MFRKM--TNDLATSEAI--------LTVFGRKVSFKK-TIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKD--------ADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQY 1396
            ++Q  K N     L +Y+  V  G L+DD  QR I+++L  L  S       + KT N      G+L   + +F+R                ++I +G+Y+YG VG GKTMLM+LFY       +KKR+HFH+FM  VHK+ HE V+ +    +  +K +  D +P +A  + +N  +LCFDEFQVTD+ADAMIL+RL   +     G+ + ATSNRHPD+LY  G+QR +F+P I+L+K   +V  L+S  DYRK+  P ++   + +  +    + E +T            F +   T+D   S  +        LT++GR+    K T  R+   TF +LC +PL+A DYL ++K F    V DIP L I  R+ +RRFIT +D+ YDS  +   + A +   LF+  E   N+  +    +     D G+ D        +    +++ +F  +EE FA  R +SRL +M +  +
Sbjct:   24 RYQSTKSNKCLTPLQEYDRLVKLGKLRDDTYQRGIISSLGDLYDSLVKYVPPVVKTPNAVDQVGGWLNGLKSVFSRGKPKNIGAYVDVSKIGNSIPRGVYLYGDVGCGKTMLMDLFYTTIPNHLTKKRIHFHQFMQYVHKRSHEIVREQNLKELGDAKGKEIDTVPFLAAEIANNSHVLCFDEFQVTDVADAMILRRLMTALLSDDYGVVLFATSNRHPDELYINGVQRQSFIPCIELIKHRTKVIFLNSPTDYRKIPRPVSSVYYFPSDTSIKYASKECKTRRETHIKEWYNYFAQASHTDDSTDSHTVHKTFYDYPLTIWGREFKVPKCTPPRVAQFTFKQLCGEPLAAGDYLTLAKNFEAFIVTDIPYLSIYVRDEVRRFITFLDAVYDSGGKLATTGAADFSSLFVEPEQILNDFELRPTTKEPDSVDTGMVDEMVEKHGFSKEIAKKSQMFALDEERFAFARALSRLSQMSSTDW 503          
BLAST of Lactation elevated protein 1 vs. Ensembl Nematostella
Match: EDO33877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR07])

HSP 1 Score: 362.073 bits (928), Expect = 2.498e-121
Identity = 204/426 (47.89%), Postives = 264/426 (61.97%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSI----AKTENKGFLEKIFT-RKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRS-KSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNP-TN-ELQTMFRKMTN---DLATSEA-ILTVFG--RKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSE-NEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSHP 1417
            L DY+  V SG L  D  QR IV  L  L   +        + G + KIF+  K + + KGLY+YGSVG GKTMLM+LFYDA   Q K RVHF+ FM+ VH ++H++K   P     S +SQ FDPIP VA+ +     LLCFDEFQVTDIADAMIL+RLF  +F  G+ +IATSNRHPDDLYK GLQR+NF+PFI +LKK C V CLDS IDYR        R L      S +P TN EL  +FR +T+   D   + A  + V G  R +   +T  R+   TF ELC +PL AADYL + K+F  +F+ DIPQ+ + ++   RRFIT+ID+ YD+++R +CSA   P  LF +S  + K+  +     +R+LMDDL L    + + + SIFT EEE FA  RTVSR+ EM+T QYW S   P
Sbjct:   10 LRDYDELVESGQLSIDKHQRQIVEKLQGLYNDVRNYHPDNGSGGIISKIFSLNKAAKVPKGLYLYGSVGCGKTMLMDLFYDAVPIQKKVRVHFNSFMLNVHSQIHKLKKALPPRDPLSVRSQPFDPIPPVAEEISLKSWLLCFDEFQVTDIADAMILRRLFTALFDKGVVVIATSNRHPDDLYKNGLQRSNFVPFIPILKKNCTVLCLDSGIDYR-------LRGLSTLIFRSHDPRTNKELDGIFRNLTDYEEDTCKTRARDIPVLGGARTLHAPRTCDRVADFTFEELCARPLGAADYLALCKHFDVIFIRDIPQMTLYKKTEARRFITLIDTLYDNRVRLVCSAEASPSDLFQASPLSTKDLEF-----QRMLMDDLSLSSDSADNSKASIFTAEEEIFAFERTVSRITEMQTEQYWTSGVKP 423          
BLAST of Lactation elevated protein 1 vs. Ensembl Nematostella
Match: EDO32020 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWA6])

HSP 1 Score: 208.379 bits (529), Expect = 1.373e-60
Identity = 144/427 (33.72%), Postives = 217/427 (50.82%), Query Frame = 2
Query:  194 YESKVNSGALKDDCVQRSIVTALNSLNQSIAK----TEN--KGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPV--VAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFL-----PFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTN-DLATSEAILTVFGR----KVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFI-----SSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDS 1405
            Y S ++   L  D  QR  V  L  L   I +    T+N  KG    +       + KGLY+YG VGSGKT+LM++FYD    +SK+RVHF+ FM++++ +++      P +        FD  P+  +A  + ++ KLLCFDE QVTD     +L+ +F  +F  G+ ++ATSNR P DL      R             LL +YC+   ++S +DYR +  P   +  Y   N+ ++    L + F  +       +   L V+GR     V+ +  + R    +F ELC+ PL  ADY+ I   +HTVF+E+IPQ+ I Q+N  RR ++ ID+ Y+S+++  C+AA+ PE LF      S E+    H     E   L  DL L   D +     I T EEE F+  R +SRL EM++  Y  S
Sbjct:   39 YRSYLDQKLLVPDEYQRRAVNELQGLYHRIVEYGTATQNTSKGDPPPV-------VPKGLYLYGGVGSGKTILMDMFYDTVPIKSKRRVHFYSFMLQLYSEINRWNLCFPED-----ESTFDVTPIQDIASRLINDNKLLCFDEMQVTDYGSVRLLEGIFCSMFDQGVIVVATSNRSPSDLGASSFGRETEAEETASSLTRLLVRYCDKFEMNSGMDYRTVQRP-GKKTYYHPINSDTDAI--LNSAFCDVVGAGTKLTRTSLQVYGRNVVVPVASQNGVARF---SFDELCRSPLGPADYITICNNYHTVFLENIPQMNIYQKNEARRLLSFIDAVYESRVKLYCTAASAPEDLFQLIPRNSQEDPDKMHLEMIGE---LAYDLQLSKLDLAS--LGILTGEEEIFSFKRCISRLNEMQSEIYQQS 442          
BLAST of Lactation elevated protein 1 vs. Ensembl Nematostella
Match: EDO25512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW98])

HSP 1 Score: 80.1073 bits (196), Expect = 3.811e-17
Identity = 47/194 (24.23%), Postives = 88/194 (45.36%), Query Frame = 2
Query:  671 IFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQR-----------------------------NRLRRFITMIDSFYDSKI 1165
            + ++ATSN+ P+ LY  G  R  FLP +  L+++ +V  ++ + D+R  + P      Y  +  +    + L   F ++     +S+  LT+  R V   +    +L+  F +LC+QPL+A D++ +   F  + + ++P L   QR                             + +RRFI ++D  YD K+
Sbjct:    1 MVLVATSNQPPELLYAEGFNRERFLPAVAALQRHMQVVSINGEEDHR--LHPGTAHTRYWVA--TPGLPSVLSRTFSQLAAGKPSSDQPLTLGNRSVQALRHCDGVLWCRFADLCEQPLAAPDFIALCDRFQAILLSEVPNLSSPQRAAKIARGTEDAVERVQAGDRQLPALSVKDDSVRRFIALVDECYDRKV 190          
BLAST of Lactation elevated protein 1 vs. Ensembl Medaka
Match: afg1la (lactation elevated protein 1 homolog B-like [Source:NCBI gene;Acc:101162185])

HSP 1 Score: 353.599 bits (906), Expect = 5.423e-117
Identity = 188/419 (44.87%), Postives = 260/419 (62.05%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTEN--KGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMT---NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW---DSSSHP 1417
            LD Y   +  G L+DD  QR+++  L  L +++    N       +IFT+  +   +G YIYG VG+GKTM+M+LFY     + K+RVHFH FM++VHK++H +K   P       ++ +DPI  VA+ +     LLCFDEFQVTDIADAMILK+LFE +F +G+ ++ATSNR P+DLYK GLQR NF+PFI +LKKYC+   LDS IDYRK   PSA +  +L+S      T  L  MF ++    ND+ T   +L V  RKV   K  G +   TF ELC +PL A+DYLE+S+ F T+F+  IP L ++Q+ + RR IT++D+ Y+ K+R +  A +  E+LF+  E          ++   LMDDLGLK  ++  R  SIF+ EEE FA  RTVSRL EM++ +YW   D SS P
Sbjct:   52 LDHYSRLIRDGTLRDDQRQRAVLQELEQLQRTLRGYSNTPPSIFSRIFTKPKNL--RGFYIYGDVGTGKTMVMDLFYSYVETERKRRVHFHGFMLDVHKRIHRLKQSLPKRKAGKMAKAYDPIAPVAEEISEEACLLCFDEFQVTDIADAMILKQLFEHLFLNGVVVVATSNRPPEDLYKNGLQRVNFVPFIAVLKKYCQTLRLDSGIDYRKQNRPSAGKLYFLSSEPDVEAT--LDKMFDELAFRQNDI-TRPRVLNVHNRKVVLSKACGTVADCTFQELCDRPLGASDYLEMSRLFDTIFIRHIPLLSLNQKTQARRLITLVDALYEQKVRVVLLADHPLEELFVHEEG------AGHDDSHALMDDLGLKREEA--RTLSIFSGEEERFAFQRTVSRLTEMQSEEYWLEGDRSSKP 457          
BLAST of Lactation elevated protein 1 vs. Ensembl Medaka
Match: afg1lb (AFG1 like ATPase [Source:NCBI gene;Acc:101156455])

HSP 1 Score: 258.07 bits (658), Expect = 1.429e-80
Identity = 158/433 (36.49%), Postives = 229/433 (52.89%), Query Frame = 2
Query:  185 LDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTENKGFLE------------------KIFTRKNS-----TINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLF--DPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNELQTMFRKMT--NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENER-RILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
            +D ++  V  G+L+ D  QR ++  L  L  ++    N+ +L                    IFT KN         KG YIYG VG+GKTMLM+LFY       KKRVHF+ FM+++HK++H+ K   P    R   ++F  DPI  VA  + +   LLCFDEFQV               I + G+F+           Y        +L  +  ++ YC   CLDS IDYR L  P+A +  YL+    +     L ++F ++T      T+  ++TV GR+++ +KT G +   TF ELC +PL A DYLEI++ F TVF+  +P L +S ++++RRF T+ID+ YD K+R +  AA   ++LF+        H   E+ER R L+DDLGL   +++ R T +FT EEE FA  RTVSRL EM+T  YW
Sbjct:    9 VDHFDRLVQGGSLRIDAQQRRVILRLAQLQLTLKTYSNRPYLNTTTMESNDESIQRQDGKTSIFTAKNRRPAPVPPPKGFYIYGDVGTGKTMLMDLFYSHVEHSCKKRVHFNAFMLDIHKRIHQRKQSLP---QRRLGKMFTYDPISPVAMEIANETSLLCFDEFQV---------------ITKGGLFVCG--------FYFGSFDWIFYLFLLFCVQNYCHTVCLDSGIDYRTLDQPAAGKLYYLSGEPGAEA--HLDSLFEELTLRQKTVTAPRVITVLGRRLTLQKTCGSVADCTFDELCGRPLGAVDYLEIARLFDTVFIRHVPTLTLSLKDQVRRFTTLIDNLYDRKVRVVLLAAAPLDRLFV--------HTGGEDERDRQLLDDLGLS-GEAAERLT-LFTAEEEIFAFQRTVSRLREMQTESYW 403          
BLAST of Lactation elevated protein 1 vs. Ensembl Medaka
Match: afg1lb (AFG1 like ATPase [Source:NCBI gene;Acc:101156455])

HSP 1 Score: 236.113 bits (601), Expect = 6.613e-72
Identity = 152/436 (34.86%), Postives = 215/436 (49.31%), Query Frame = 2
Query:  182 FLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTENKGFLE------------------KIFTRKNS-----TINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLF--DPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLTSNNSSNPTNE--LQTMFRKMT--NDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENER-RILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYW 1399
             +D ++  V  G+L+ D  QR ++  L  L  ++    N+ +L                    IFT KN         KG YIYG VG+GKTMLM+LFY       KKRVHF+ FM+++HK++H+ K   P    R   ++F  DPI  VA  + +   LLCF                                                     D  + YC   CLDS IDYR L  P+A +  YL    S  P  E  L ++F ++T      T+  ++TV GR+++ +KT G +   TF ELC +PL A DYLEI++ F TVF+  +P L +S ++++RRF T+ID+ YD K+R +  AA   ++LF+        H   E+ER R L+DDLGL   +++ R T +FT EEE FA  RTVSRL EM+T  YW
Sbjct:   58 IVDHFDRLVQGGSLRIDAQQRRVILRLAQLQLTLKTYSNRPYLNTTTMESNDESIQRQDGKTSIFTAKNRRPAPVPPPKGFYIYGDVGTGKTMLMDLFYSHVEHSCKKRVHFNAFMLDIHKRIHQRKQSLP---QRRLGKMFTYDPISPVAMEIANETSLLCF-----------------------------------------------------DEFQNYCHTVCLDSGIDYRTLDQPAAGKLYYL----SGEPGAEAHLDSLFEELTLRQKTVTAPRVITVLGRRLTLQKTCGSVADCTFDELCGRPLGAVDYLEIARLFDTVFIRHVPTLTLSLKDQVRRFTTLIDNLYDRKVRVVLLAAAPLDRLFV--------HTGGEDERDRQLLDDLGLS-GEAAERLT-LFTAEEEIFAFQRTVSRLREMQTESYW 423          
BLAST of Lactation elevated protein 1 vs. Planmine SMEST
Match: SMESG000074214.1 (SMESG000074214.1)

HSP 1 Score: 486.878 bits (1252), Expect = 5.872e-173
Identity = 234/237 (98.73%), Postives = 235/237 (99.16%), Query Frame = 2
Query:  143 MKFQFLKLNSYHKFLDDYESKVNSGALKDDCVQRSIVTALNSLNQSIAKTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLT 853
            MKFQFLKLNSYHKFLDDY+SKVNSGALKDD VQRSIVTALNSLNQSIAKTENKGF EKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLT
Sbjct:    1 MKFQFLKLNSYHKFLDDYKSKVNSGALKDDYVQRSIVTALNSLNQSIAKTENKGFFEKIFTRKNSTINKGLYIYGSVGSGKTMLMNLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPIPVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNRHPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLYLT 237          
BLAST of Lactation elevated protein 1 vs. Planmine SMEST
Match: SMESG000074209.1 (SMESG000074209.1)

HSP 1 Score: 406.757 bits (1044), Expect = 1.116e-141
Identity = 195/197 (98.98%), Postives = 196/197 (99.49%), Query Frame = 2
Query:  848 LTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSHPLLAAGIS 1438
             +SNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSHPLLAAGIS
Sbjct:   19 FSSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYATFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDSFYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDADSSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSHPLLAAGIS 215          
The following BLAST results are available for this feature:
BLAST of Lactation elevated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AFG1L3.644e-12247.47AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:1641... [more]
AFG1L2.467e-10949.86AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:1641... [more]
AFG1L2.510e-2241.96AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:1641... [more]
AFG1L1.622e-1846.34AFG1 like ATPase [Source:HGNC Symbol;Acc:HGNC:1641... [more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C30F12.27.945e-10441.57pep chromosome:WBcel235:I:6967672:6970190:-1 gene:... [more]
C30F12.27.945e-10441.57pep chromosome:WBcel235:I:6967670:6970145:-1 gene:... [more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG85201.813e-10442.69gene:FBgn0033734 transcript:FBtr0303222[more]
CG85201.813e-10442.69gene:FBgn0033734 transcript:FBtr0087926[more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
afg1la3.788e-11144.04AFG1 like ATPase a [Source:ZFIN;Acc:ZDB-GENE-09100... [more]
afg1lb9.618e-10238.90AFG1 like ATPase b [Source:NCBI gene;Acc:555926][more]
afg1la1.838e-8247.46AFG1 like ATPase a [Source:ZFIN;Acc:ZDB-GENE-09100... [more]
afg1lb4.151e-5438.87AFG1 like ATPase b [Source:NCBI gene;Acc:555926][more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lix1l7.673e-11844.66limb and CNS expressed 1 like [Source:Xenbase;Acc:... [more]
lix1l4.088e-11744.89limb and CNS expressed 1 like [Source:Xenbase;Acc:... [more]
lix1l9.522e-11744.74limb and CNS expressed 1 like [Source:Xenbase;Acc:... [more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Afg1l3.990e-12146.96AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:214880... [more]
Afg1l2.130e-10849.27AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:214880... [more]
Afg1l2.560e-5948.00AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:214880... [more]
Afg1l1.170e-1847.44AFG1 like ATPase [Source:MGI Symbol;Acc:MGI:214880... [more]
back to top
BLAST of Lactation elevated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WV93|AFG1L_HUMAN1.750e-12147.47AFG1-like ATPase OS=Homo sapiens OX=9606 GN=AFG1L ... [more]
sp|Q3V384|AFG1L_MOUSE2.791e-12046.96AFG1-like ATPase OS=Mus musculus OX=10090 GN=Afg1l... [more]
sp|Q32PX9|AFG1L_RAT6.349e-11945.91AFG1-like ATPase OS=Rattus norvegicus OX=10116 GN=... [more]
sp|P46441|N2B_HAEIR3.771e-10942.19Putative ATPase N2B OS=Haematobia irritans OX=7368... [more]
sp|Q5TYS0|LCE1B_DANRE7.260e-10138.90Lactation elevated protein 1 homolog B OS=Danio re... [more]
back to top
BLAST of Lactation elevated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JT025.954e-12748.89AFG1-like ATPase OS=Lingula unguis OX=7574 GN=LOC1... [more]
A0A151ILL91.592e-12649.15Putative ATPase N2B OS=Cyphomyrmex costatus OX=456... [more]
A0A151XB771.296e-12448.42Putative ATPase N2B (Fragment) OS=Trachymyrmex zet... [more]
A0A195F1675.309e-12448.42Putative ATPase N2B OS=Trachymyrmex septentrionali... [more]
A0A0M9A8A82.669e-12347.06Putative ATPase N2B OS=Melipona quadrifasciata OX=... [more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
afg1la1.064e-11846.39AFG1-like ATPase [Source:NCBI gene;Acc:103026430][more]
afg1lb5.725e-9543.85AFG1 like ATPase [Source:NCBI gene;Acc:103023529][more]
afg1lb2.516e-9043.55AFG1 like ATPase [Source:NCBI gene;Acc:103023529][more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000010123.11.935e-3140.12pep scaffold:Pmarinus_7.0:GL488924:337:3164:1 gene... [more]
ENSPMAT00000010124.12.123e-3140.12pep scaffold:Pmarinus_7.0:GL488924:337:2233:1 gene... [more]
ENSPMAT00000010126.16.139e-3141.40pep scaffold:Pmarinus_7.0:GL488924:346:2559:1 gene... [more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
AFG11.076e-7833.75Protein that may act as a chaperone for cytochrome... [more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO338772.498e-12147.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320201.373e-6033.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255123.811e-1724.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Lactation elevated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
afg1la5.423e-11744.87lactation elevated protein 1 homolog B-like [Sourc... [more]
afg1lb1.429e-8036.49AFG1 like ATPase [Source:NCBI gene;Acc:101156455][more]
afg1lb6.613e-7234.86AFG1 like ATPase [Source:NCBI gene;Acc:101156455][more]
back to top
BLAST of Lactation elevated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000074214.15.872e-17398.73SMESG000074214.1[more]
SMESG000074209.11.116e-14198.98SMESG000074209.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003480 ID=SMED30003480|Name=Lactation elevated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1535bp
TTTAAATGGTATTCGATTTAACAAAAATATTAAGTTGATGAGATTAATGA
TTTTCATTGATGAGTATATTTAATATTTGAACTAATTTTTTTGTACAATG
TTTTATAAGAAATCAGTTTATTATTTTATCTTTCATAACAAAATGAAATT
TCAATTTTTGAAATTAAACAGTTATCACAAATTTCTTGATGACTATGAAT
CAAAAGTTAATTCTGGTGCTTTAAAAGACGATTGCGTGCAGAGAAGTATT
GTTACAGCTTTAAATTCATTGAACCAATCTATAGCGAAAACCGAAAATAA
AGGATTCCTCGAAAAAATTTTTACTCGAAAGAACTCAACTATTAATAAAG
GTTTATATATTTATGGAAGTGTCGGATCCGGCAAAACTATGCTAATGAAT
TTGTTTTACGATGCATGCGCTGAACAATCTAAAAAACGAGTTCATTTCCA
TGAATTTATGATAGAAGTTCATAAAAAAATGCACGAAGTTAAAAGTAAAA
AACCCACCAATATCCATAGAAGTAAATCTCAGTTATTTGATCCTATACCA
GTTGTTGCAAAGATGATGTGTCATAATTGCAAGTTGCTCTGTTTTGATGA
GTTTCAGGTAACAGATATTGCTGATGCTATGATTTTGAAGAGATTATTCG
AATTTATTTTTCAATCCGGCATATTTATTATAGCTACATCAAACAGACAT
CCAGATGATCTCTACAAGCGAGGGTTACAAAGAGCTAATTTTCTACCATT
CATTGATCTTCTCAAAAAATATTGCGAAGTTCATTGTCTTGATTCAAAGA
TTGATTATCGCAAATTAATTTTACCGTCAGCCACACGAAATCTTTATTTA
ACTAGCAATAATTCATCAAATCCAACAAATGAGCTTCAAACCATGTTTAG
AAAAATGACAAATGATTTAGCAACTTCAGAGGCGATTTTAACAGTATTTG
GAAGAAAGGTCTCTTTTAAAAAAACTATTGGTCGAATTTTATATGCAACT
TTTCCAGAGTTATGTCAACAACCATTATCAGCTGCAGATTATTTAGAGAT
AAGCAAATATTTCCATACCGTTTTCGTTGAAGATATCCCTCAATTGAAGA
TCAGCCAGAGAAATCGACTTAGGAGATTTATTACTATGATAGATTCATTT
TATGATAGCAAAATCAGATTTATTTGTAGTGCAGCTAATGAACCGGAACA
ACTTTTTATTTCCTCAGAAAATGAAAAAAATAATCATTATATAAATGAAA
ATGAAAGGCGGATTTTGATGGACGATCTTGGATTAAAAGATGCTGATTCT
TCTCATCGACAGACTAGTATATTCACAGATGAAGAAGAGGAATTTGCCCA
TCATCGAACCGTAAGTCGGCTAATGGAAATGCGCACAAGACAATATTGGG
ATTCCAGTAGCCATCCGTTATTAGCAGCTGGTATTTCATAGGAAATACAT
ATTTAAGATGGGCTGACTTTAGTTCTTTTTAACATTAGCTTTTATATTTT
AAAGAGAAAATAAATTATTTTCATTTAAAAAAAAA
back to top

protein sequence of SMED30003480-orf-1

>SMED30003480-orf-1 ID=SMED30003480-orf-1|Name=SMED30003480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MFYKKSVYYFIFHNKMKFQFLKLNSYHKFLDDYESKVNSGALKDDCVQRS
IVTALNSLNQSIAKTENKGFLEKIFTRKNSTINKGLYIYGSVGSGKTMLM
NLFYDACAEQSKKRVHFHEFMIEVHKKMHEVKSKKPTNIHRSKSQLFDPI
PVVAKMMCHNCKLLCFDEFQVTDIADAMILKRLFEFIFQSGIFIIATSNR
HPDDLYKRGLQRANFLPFIDLLKKYCEVHCLDSKIDYRKLILPSATRNLY
LTSNNSSNPTNELQTMFRKMTNDLATSEAILTVFGRKVSFKKTIGRILYA
TFPELCQQPLSAADYLEISKYFHTVFVEDIPQLKISQRNRLRRFITMIDS
FYDSKIRFICSAANEPEQLFISSENEKNNHYINENERRILMDDLGLKDAD
SSHRQTSIFTDEEEEFAHHRTVSRLMEMRTRQYWDSSSHPLLAAGIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005654ATPase_AFG1-like
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005654ATPase, AFG1-likePFAMPF03969AFG1_ATPasecoord: 32..377
e-value: 1.3E-98
score: 330.2
IPR005654ATPase, AFG1-likePANTHERPTHR12169ATPASE N2Bcoord: 25..438
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 42..217
e-value: 3.3E-24
score: 87.7
NoneNo IPR availablePANTHERPTHR12169:SF6AFG1-LIKE ATPASEcoord: 25..438
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 81..229