Phosphoenolpyruvate carboxykinase [GTP]

Overview
NamePhosphoenolpyruvate carboxykinase [GTP]
Smed IDSMED30003468
Length (bp)2099
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoenolpyruvate carboxykinase [GTP] (SMED30003468) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoenolpyruvate carboxykinase [GTP] (SMED30003468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoenolpyruvate carboxykinase [GTP] (SMED30003468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoenolpyruvate carboxykinase [GTP] (SMED30003468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003468SMESG000073058.1 SMESG000003144.1 Contig39948uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003468SMESG000073058.1 SMESG000003144.1 Contig39948newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003468SMESG000073058.1 SMESG000003144.1 Contig35505uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003468SMESG000073058.1 SMESG000003144.1 Contig35505newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003468SMESG000073058.1 SMESG000003144.1 Contig9543uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003468SMESG000073058.1 SMESG000003144.1 Contig9543newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v6_536_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v6_536_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v6_536_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v6_536_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003468SMESG000073058.1 SMESG000003144.1 dd_Smed_v4_536_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK1 (phosphoenolpyruvate carboxykinase 1 [Source:HGNC Symbol;Acc:HGNC:8724])

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 376/602 (62.46%), Postives = 459/602 (76.25%), Query Frame = 1
Query:  202 KSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            +++ +++   A +CQPD IH+CDGSEEEN +++  +  +G +++L KY+NCWL  TDP DVAR+ESKT I T ++  T+P    G+   LG WMS    E   N RFPGCMKGR MYVIPFSMGP+G  +SK+G+E+TDSPYVVASMRIMTRMG+ VL+ +   + FVKC+HSVG PLP  + ++N WPC+PE T+IAHLP R EI SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y+ AAFPSACGKTNLAM+  SLPG+K+ECVGDDIAWMKFD +G L+AINPE GFFGVAPGTS KTNPNA++ IQKNTIFTNVAETSDGG +WEG+ DE     V+IT W+   W    G+  AHPNSRFCTPASQCPIID  WESP+GVPI  IIFGGRRP GVPLVYEA  W HGVFVGA+MRSE+TAAAE+K  IIMHDPFAMRPFFGYNFG YL HWLS ++  A +LP+I+HVNWFRK  K GKFLWPGFGEN RVLEW+  RID +   K + IG +P    +N+ G     I++ ELFS+   FW+KE ++IEKY ++QV   LP +I+ EI  LK+ +S
Sbjct:   25 QAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGL-SQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEAVGDGE-FVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGI-DEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRK-DKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGL--GHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRIS 620          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 359/597 (60.13%), Postives = 446/597 (74.71%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            D++   A +CQP+ IH+CDG+E EN   + +L  QG I+KL KY NCWL RTDP DVARVESKT I TP +  T+P    G RG LGNWMSPA  +  ++ RFPGCM+GR MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  FVKC+HSVG PL    + ++ WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT     KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NTIFTNVAETSDGG +WEG++  +    V++T W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+GVPLVYEA +W HGVFVG++MRSESTAAAE+K  IIMHDPFAMRPFFGYNFGHYLEHWLS    +  QLPRI+HVNWFR+  + G FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G     ID  +LFS+   FW++E  +I  Y  EQV + LP ++  E+  L+  +
Sbjct:   46 DFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVPLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLP-PGVTVTSWLGKPWKPGDKEPCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRR-DEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRA--IDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRV 637          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 359/597 (60.13%), Postives = 446/597 (74.71%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            D++   A +CQP+ IH+CDG+E EN   + +L  QG I+KL KY NCWL RTDP DVARVESKT I TP +  T+P    G RG LGNWMSPA  +  ++ RFPGCM+GR MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  FVKC+HSVG PL    + ++ WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT     KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NTIFTNVAETSDGG +WEG++  +    V++T W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+GVPLVYEA +W HGVFVG++MRSESTAAAE+K  IIMHDPFAMRPFFGYNFGHYLEHWLS    +  QLPRI+HVNWFR+  + G FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G     ID  +LFS+   FW++E  +I  Y  EQV + LP ++  E+  L+  +
Sbjct:   46 DFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVPLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLP-PGVTVTSWLGKPWKPGDKEPCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRR-DEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRA--IDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRV 637          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 309/508 (60.83%), Postives = 385/508 (75.79%), Query Frame = 1
Query:  481 MSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            MSPA  +  ++ RFPGCM+GR MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  FVKC+HSVG PL    + ++ WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT     KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NTIFTNVAETSDGG +WEG++  +    V++T W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+GVPLVYEA +W HGVFVG++MRSESTAAAE+K  IIMHDPFAMRPFFGYNFGHYLEHWLS    +  QLPRI+HVNWFR+  + G FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G     ID  +LFS+   FW++E  +I  Y  EQV + LP ++  E+  L+  +
Sbjct:    1 MSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLP-PGVTVTSWLGKPWKPGDKEPCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRR-DEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRA--IDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRV 503          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 309/508 (60.83%), Postives = 385/508 (75.79%), Query Frame = 1
Query:  481 MSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            MSPA  +  ++ RFPGCM+GR MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  FVKC+HSVG PL    + ++ WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT     KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NTIFTNVAETSDGG +WEG++  +    V++T W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+GVPLVYEA +W HGVFVG++MRSESTAAAE+K  IIMHDPFAMRPFFGYNFGHYLEHWLS    +  QLPRI+HVNWFR+  + G FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G     ID  +LFS+   FW++E  +I  Y  EQV + LP ++  E+  L+  +
Sbjct:    1 MSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLP-PGVTVTSWLGKPWKPGDKEPCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRR-DEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRA--IDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRV 503          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 334/600 (55.67%), Postives = 434/600 (72.33%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCK-SSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            +I  KA + +P  I +CDGS+ E  ++ID L+ +G + KL  YEN ++ RTDP DVARVESKT++ T  K  T+     G+   +G+W++P  +  EL++RFPGCM GR+MYVIPFSMGPVGG +SK+G+++TDS YVV SMRIMTR+ + V   +  +  FV+CIHSVG+P P  +++IN WPC+PE+ +IAH P   EI SFGSGYGGNSLLGKKC ALR+ S +   + W+AEHMLI+G+T     + +I AAFPSACGKTNLAMLE +LPG+K+ CVGDDIAWMKF   G L AINPE GFFGVAPGTS KTNP A+   QKN+IFTNVAET++G +FWEGLEDE+   +V IT W G  W   +   AAHPNSRF  PA+QCPII  DWESP GVPI AIIFGGRRP+GVPL+YE   W HGVF G+ ++SE+TAAAE+    +MHDP AMRPF GYNFG YL+HWL    D + ++P+IYHVNWFRK S   KFLWPGFG+N RV++WI++R+D   +    + IG +P    IN+ G    +++ +EL SV + +WK++A EI K+ DEQVG+ LP  ++ E+   ++ +  L
Sbjct:   60 FIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQD-FVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGEPGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTD-SRKMPKIYHVNWFRKDSNN-KFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGL--GEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 654          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 334/600 (55.67%), Postives = 434/600 (72.33%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCK-SSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            +I  KA + +P  I +CDGS+ E  ++ID L+ +G + KL  YEN ++ RTDP DVARVESKT++ T  K  T+     G+   +G+W++P  +  EL++RFPGCM GR+MYVIPFSMGPVGG +SK+G+++TDS YVV SMRIMTR+ + V   +  +  FV+CIHSVG+P P  +++IN WPC+PE+ +IAH P   EI SFGSGYGGNSLLGKKC ALR+ S +   + W+AEHMLI+G+T     + +I AAFPSACGKTNLAMLE +LPG+K+ CVGDDIAWMKF   G L AINPE GFFGVAPGTS KTNP A+   QKN+IFTNVAET++G +FWEGLEDE+   +V IT W G  W   +   AAHPNSRF  PA+QCPII  DWESP GVPI AIIFGGRRP+GVPL+YE   W HGVF G+ ++SE+TAAAE+    +MHDP AMRPF GYNFG YL+HWL    D + ++P+IYHVNWFRK S   KFLWPGFG+N RV++WI++R+D   +    + IG +P    IN+ G    +++ +EL SV + +WK++A EI K+ DEQVG+ LP  ++ E+   ++ +  L
Sbjct:   60 FIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQD-FVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGEPGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTD-SRKMPKIYHVNWFRKDSNN-KFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGL--GEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 654          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 334/600 (55.67%), Postives = 434/600 (72.33%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCK-SSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            +I  KA + +P  I +CDGS+ E  ++ID L+ +G + KL  YEN ++ RTDP DVARVESKT++ T  K  T+     G+   +G+W++P  +  EL++RFPGCM GR+MYVIPFSMGPVGG +SK+G+++TDS YVV SMRIMTR+ + V   +  +  FV+CIHSVG+P P  +++IN WPC+PE+ +IAH P   EI SFGSGYGGNSLLGKKC ALR+ S +   + W+AEHMLI+G+T     + +I AAFPSACGKTNLAMLE +LPG+K+ CVGDDIAWMKF   G L AINPE GFFGVAPGTS KTNP A+   QKN+IFTNVAET++G +FWEGLEDE+   +V IT W G  W   +   AAHPNSRF  PA+QCPII  DWESP GVPI AIIFGGRRP+GVPL+YE   W HGVF G+ ++SE+TAAAE+    +MHDP AMRPF GYNFG YL+HWL    D + ++P+IYHVNWFRK S   KFLWPGFG+N RV++WI++R+D   +    + IG +P    IN+ G    +++ +EL SV + +WK++A EI K+ DEQVG+ LP  ++ E+   ++ +  L
Sbjct:   24 FIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQD-FVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGEPGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTD-SRKMPKIYHVNWFRKDSNN-KFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGL--GEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 618          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 334/600 (55.67%), Postives = 434/600 (72.33%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCK-SSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            +I  KA + +P  I +CDGS+ E  ++ID L+ +G + KL  YEN ++ RTDP DVARVESKT++ T  K  T+     G+   +G+W++P  +  EL++RFPGCM GR+MYVIPFSMGPVGG +SK+G+++TDS YVV SMRIMTR+ + V   +  +  FV+CIHSVG+P P  +++IN WPC+PE+ +IAH P   EI SFGSGYGGNSLLGKKC ALR+ S +   + W+AEHMLI+G+T     + +I AAFPSACGKTNLAMLE +LPG+K+ CVGDDIAWMKF   G L AINPE GFFGVAPGTS KTNP A+   QKN+IFTNVAET++G +FWEGLEDE+   +V IT W G  W   +   AAHPNSRF  PA+QCPII  DWESP GVPI AIIFGGRRP+GVPL+YE   W HGVF G+ ++SE+TAAAE+    +MHDP AMRPF GYNFG YL+HWL    D + ++P+IYHVNWFRK S   KFLWPGFG+N RV++WI++R+D   +    + IG +P    IN+ G    +++ +EL SV + +WK++A EI K+ DEQVG+ LP  ++ E+   ++ +  L
Sbjct:   24 FIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQD-FVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGEPGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTD-SRKMPKIYHVNWFRKDSNN-KFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGL--GEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 618          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 334/600 (55.67%), Postives = 434/600 (72.33%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCK-SSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            +I  KA + +P  I +CDGS+ E  ++ID L+ +G + KL  YEN ++ RTDP DVARVESKT++ T  K  T+     G+   +G+W++P  +  EL++RFPGCM GR+MYVIPFSMGPVGG +SK+G+++TDS YVV SMRIMTR+ + V   +  +  FV+CIHSVG+P P  +++IN WPC+PE+ +IAH P   EI SFGSGYGGNSLLGKKC ALR+ S +   + W+AEHMLI+G+T     + +I AAFPSACGKTNLAMLE +LPG+K+ CVGDDIAWMKF   G L AINPE GFFGVAPGTS KTNP A+   QKN+IFTNVAET++G +FWEGLEDE+   +V IT W G  W   +   AAHPNSRF  PA+QCPII  DWESP GVPI AIIFGGRRP+GVPL+YE   W HGVF G+ ++SE+TAAAE+    +MHDP AMRPF GYNFG YL+HWL    D + ++P+IYHVNWFRK S   KFLWPGFG+N RV++WI++R+D   +    + IG +P    IN+ G    +++ +EL SV + +WK++A EI K+ DEQVG+ LP  ++ E+   ++ +  L
Sbjct:   24 FIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQD-FVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGEPGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTD-SRKMPKIYHVNWFRKDSNN-KFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGL--GEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 618          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Match: Pepck1 (gene:FBgn0003067 transcript:FBtr0086701)

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 373/593 (62.90%), Postives = 459/593 (77.40%), Query Frame = 1
Query:  235 TICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
             +CQPD +H+CDGSE+EN+ +I  LL  G I  L KY+NCWL RT+PADVARVES+TFI T ++E TIP    G++G+LGNW+SP+ M+  +  RFPGCMKGR MYV+PFSMGPVG  +SK+G+E+TDS YVVASMRIMTRMG+ VL+++ K++ FV+ +HSVG P    +     WPCDPE+TII H PA N I S+GSGYGGNSLLGKKC ALR+GS +  ++ WLAEHMLILGITD    K+YITAAFPSACGKTNLAML  SL  YK+ECVGDDIAWMKFD++G+L+AINPE GFFGVAPGTS +TNP AM  + KNTIFTNVA TSDGG FWEG+E  +   +V ITDW G PW K+ GK AAHPNSRFCTPA+QCPIID  WE P GVPISA++FGGRRP GVPL+YEARDW HGVF+GA+MRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG Y+ HWLS  K    Q+P+I+HVNWFRKS++ GKF+WPG+GEN RVLEWIL+R++       SAIG++P    +N+ G  K  +D++E+FS+   FW +E  +I  YF+ QVG  LP  I  ++ +L   +  L
Sbjct:   61 ALCQPDQVHICDGSEQENKVLIKSLLEAGTIVPLPKYDNCWLARTNPADVARVESRTFICTERREETIPTPVEGVKGTLGNWISPSDMDAAVQQRFPGCMKGRTMYVVPFSMGPVGSPLSKIGIELTDSAYVVASMRIMTRMGAAVLRQLAKKEEFVRALHSVGAPA-NGQVEQPSWPCDPERTIILHKPAENLIVSYGSGYGGNSLLGKKCFALRIGSTIAKQEGWLAEHMLILGITDPKGEKKYITAAFPSACGKTNLAMLNPSLANYKVECVGDDIAWMKFDSQGVLRAINPENGFFGVAPGTSMETNPIAMNTVFKNTIFTNVASTSDGGVFWEGMESSL-APNVQITDWLGKPWTKDSGKPAAHPNSRFCTPAAQCPIIDEAWEDPAGVPISAMLFGGRRPAGVPLIYEARDWTHGVFIGAAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGDYVAHWLSMEKRG--QVPKIFHVNWFRKSAE-GKFMWPGYGENSRVLEWILRRVNGESCYVDSAIGHIPAEGALNLDGM-KDKVDVKEIFSLPKEFWSQEVKDIRTYFESQVGADLPASIYQQLDELSSRVDNL 647          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Match: Pepck2 (gene:FBgn0034356 transcript:FBtr0086699)

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 370/599 (61.77%), Postives = 457/599 (76.29%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEK-EKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
             Y+     +CQP+ +H+CDG+E E++ +  I+L +G I  L KYENCWL RT+PADVARVE KTFIST  KE T+P       G LGNW++   M+  +  RFPGCMKGR MYVIPFSMGPVG  +SK+G+EITDSPYVV SM+IMTR G+ VL  ++  +  FVKC+HSVG P  +  + +  WPCDPE+TI+ H PA NEI S+GSGYGGNSLLGKKCLALR+GS +  ++ WLAEHMLILGIT+    K YI AAFPSACGKTNLAM+  +LPGYK+ECVGDDIAWMKFDNKG+L+AINPE GFFGVAPGTS  TNP AM  I +N++FTNVA TSDGG +WEG+E +  L  V++TDW G  W +  GK AAHPNSRFCTPASQCPIID  WE  +GVPISAI+FGGRRP GVPLVYEARDW HGVF+GA+MRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS   ++  Q+P+I+HVNWFRKSS+ GKFLWPGFGEN RVL+WI +R++     + S IG LP  + +N+   +  +IDL++LF +   FW++E   IE+YF+EQVG +LP  +  E+ +LK  ++
Sbjct:   45 QYVEKCVELCQPERVHICDGTEVESKLLQGIMLKKGTIIPLPKYENCWLARTNPADVARVEGKTFISTDSKEQTVPVTEKATPGMLGNWIAEKDMQAAIKERFPGCMKGRTMYVIPFSMGPVGSPLSKIGIEITDSPYVVESMKIMTRAGNPVLNYLQSGDGQFVKCLHSVGTP-KSGVQAMPSWPCDPERTIVLHKPAENEIVSYGSGYGGNSLLGKKCLALRIGSTIAKREGWLAEHMLILGITNPQGKKIYIAAAFPSACGKTNLAMMTPTLPGYKVECVGDDIAWMKFDNKGVLRAINPENGFFGVAPGTSRATNPIAMDTIFRNSVFTNVASTSDGGVYWEGMEKD-QLKGVTVTDWLGKLWSQESGKPAAHPNSRFCTPASQCPIIDPAWEDSEGVPISAILFGGRRPSGVPLVYEARDWKHGVFIGAAMRSEATAAAEFKGKVIMHDPFAMRPFFGYNFGDYLGHWLSM--EQRGQVPKIFHVNWFRKSSE-GKFLWPGFGENSRVLDWIFRRVEGEQCFEDSPIGRLPSKNSLNLDSLE--NIDLDQLFDLPKDFWEQEVAAIERYFEEQVGHHLPGAVAEELRELKARVA 636          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Match: Pepck2 (gene:FBgn0034356 transcript:FBtr0113093)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 359/568 (63.20%), Postives = 437/568 (76.94%), Query Frame = 1
Query:  307 LLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEK-EKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            +L +G I  L KYENCWL RT+PADVARVE KTFIST  KE T+P       G LGNW++   M+  +  RFPGCMKGR MYVIPFSMGPVG  +SK+G+EITDSPYVV SM+IMTR G+ VL  ++  +  FVKC+HSVG P  +  + +  WPCDPE+TI+ H PA NEI S+GSGYGGNSLLGKKCLALR+GS +  ++ WLAEHMLILGIT+    K YI AAFPSACGKTNLAM+  +LPGYK+ECVGDDIAWMKFDNKG+L+AINPE GFFGVAPGTS  TNP AM  I +N++FTNVA TSDGG +WEG+E +  L  V++TDW G  W +  GK AAHPNSRFCTPASQCPIID  WE  +GVPISAI+FGGRRP GVPLVYEARDW HGVF+GA+MRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS   ++  Q+P+I+HVNWFRKSS+ GKFLWPGFGEN RVL+WI +R++     + S IG LP  + +N+   +  +IDL++LF +   FW++E   IE+YF+EQVG +LP  +  E+ +LK  ++
Sbjct:    1 MLKKGTIIPLPKYENCWLARTNPADVARVEGKTFISTDSKEQTVPVTEKATPGMLGNWIAEKDMQAAIKERFPGCMKGRTMYVIPFSMGPVGSPLSKIGIEITDSPYVVESMKIMTRAGNPVLNYLQSGDGQFVKCLHSVGTP-KSGVQAMPSWPCDPERTIVLHKPAENEIVSYGSGYGGNSLLGKKCLALRIGSTIAKREGWLAEHMLILGITNPQGKKIYIAAAFPSACGKTNLAMMTPTLPGYKVECVGDDIAWMKFDNKGVLRAINPENGFFGVAPGTSRATNPIAMDTIFRNSVFTNVASTSDGGVYWEGMEKD-QLKGVTVTDWLGKLWSQESGKPAAHPNSRFCTPASQCPIIDPAWEDSEGVPISAILFGGRRPSGVPLVYEARDWKHGVFIGAAMRSEATAAAEFKGKVIMHDPFAMRPFFGYNFGDYLGHWLSM--EQRGQVPKIFHVNWFRKSSE-GKFLWPGFGENSRVLDWIFRRVEGEQCFEDSPIGRLPSKNSLNLDSLE--NIDLDQLFDLPKDFWEQEVAAIERYFEEQVGHHLPGAVAEELRELKARVA 561          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Match: pck1 (phosphoenolpyruvate carboxykinase 1 (soluble) [Source:ZFIN;Acc:ZDB-GENE-030909-11])

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 372/632 (58.86%), Postives = 467/632 (73.89%), Query Frame = 1
Query:  130 PRVAKKNLVKM-IDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSILNVD 2022
            PRV + +L  +     EF+  SVS             +CQPD++H+CDGSE+EN  ++ +L  QGAIK+L KY NCWL RTDP DVARVESKT I T ++  T+P    G    LG WM P   +  +N RFPGCMKGRVMYVIPFSMGPVG  +SK+GVE+TDSPYVVASMRIMTRMG  VL  +   + FV+C+HSVG PLP  + ++N WPC+PE T++AH+P + +I SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y  AAFPSACGKTNLAML+ SLPG+K+ECVGDDIAWMKFD +G L+AINPE GFFGVAPGTS KTNPNAM  I  NT+FTNVAE+SDGG FWEG+++++  + V++T W+  PW    G+  AHPNSRFCTPA+QCPIID  WESP+GVPI AIIFGGRRP+GVPLVYEA DW HGVFVGASMRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS  +    +LP+I+HVNWF +SS +G+FLWPGFGEN RVLEW+  R+    + +++A+G +P    +N+ G    D++  ELF V   FW +E  EI +YF  ++ + LP +++ ++  L+  L+  +V 
Sbjct:   13 PRVLQGDLASLSASVREFIDSSVS-------------LCQPDALHICDGSEQENSTILSLLEEQGAIKRLRKYSNCWLARTDPRDVARVESKTVIVTAEQRDTVPTPTGGGVSQLGRWMCPEEWDKAMNLRFPGCMKGRVMYVIPFSMGPVGSPLSKIGVELTDSPYVVASMRIMTRMGKTVLSALGNGE-FVRCLHSVGCPLPLRKPLVNNWPCNPELTLVAHIPDQRKIVSFGSGYGGNSLLGKKCFALRIASRIAKEEGWLAEHMLILGITNPAGQKKYFAAAFPSACGKTNLAMLKPSLPGWKVECVGDDIAWMKFDKEGNLRAINPENGFFGVAPGTSSKTNPNAMSTISCNTLFTNVAESSDGGVFWEGMDEDLP-EGVTLTSWKNQPWTPEDGEPCAHPNSRFCTPAAQCPIIDPQWESPEGVPIEAIIFGGRRPQGVPLVYEAFDWAHGVFVGASMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGQYLSHWLSMEQRPGAKLPKIFHVNWFGRSS-SGRFLWPGFGENIRVLEWMFGRLSGGAEARTTAVGLVPADGALNLHGL--PDVEPLELFRVSQEFWMQELQEIREYFSRELNRDLPQEMQRQLELLEHRLTHTHVS 626          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Match: pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-040426-2266])

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 359/604 (59.44%), Postives = 440/604 (72.85%), Query Frame = 1
Query:  205 SLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSF-SKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKS---SAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            S+ +++   A  C+P  +HV  G+ EE   ++  L  +G +KKL+KYENCWL RTDP DVARVESKT I T  +  TIP  + G++  LG+WMS    +     RFPGCM GR MYVIPFSMGPV  S++K GV++TDSPYVVASM IMTRMG+ V++++ +   FV+C HSVG PLP    ++N WPC+PEK +I+HLP   +I SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRYI AAFPSACGKTNLAM++ SLPG+K+ECVGDDIAWMKFD++G L+AINPE GFFGVAPGTS KTNP+AM  I +NT+FTNV ETSDGG +WEGLE       + +TDW G  W        AHPNSRFC PA QCPIID  WES +GVPI AI+FGGRRPEGVPLVYE+ +W HGVFVGA+MRSESTAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS  ++    QLP+I+HVNWFRK  KTG FLWPGFGEN RVLEWI KR  +  + ++   S +G +P    IN  G    +ID+  LF +   FW+KE  E+  YF++QVG  LP Q++ E+  L+E +
Sbjct:   34 SVAEFVSGAAAECKPAKVHVVTGTPEETADLLANLEKEGMVKKLAKYENCWLARTDPKDVARVESKTVIVTKNQRDTIPIPSGGVKSQLGSWMSEQDFQKAREDRFPGCMAGRTMYVIPFSMGPVNSSLAKFGVQVTDSPYVVASMGIMTRMGTPVMEKLAQGAEFVRCQHSVGRPLPLKGPLVNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYIAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSLKTNPHAMETISRNTVFTNVGETSDGGVWWEGLEPPA--PGIKLTDWHGKSWKYGDSTLCAHPNSRFCAPAGQCPIIDPLWESDEGVPIDAIVFGGRRPEGVPLVYESFNWRHGVFVGAAMRSESTAAAEHKGKVIMHDPFAMRPFFGYNFGDYLSHWLSMETRKGPTQLPKIFHVNWFRKDQKTGSFLWPGFGENARVLEWIFKRCGRTSENEAATKSIVGWIPQNGAINTEGLG-GNIDMGALFDLPKPFWQKETQELRTYFNQQVGADLPAQVEGELKALEERV 634          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Match: pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-040426-2266])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 359/604 (59.44%), Postives = 439/604 (72.68%), Query Frame = 1
Query:  205 SLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSF-SKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKS---SAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            S+ +++   A  C+P  +HV  G+ EE   ++  L  +G +KKL+KYENCWL RTDP DVARVESKT I T  +  TIP  + G +  LG+WMS    +     RFPGCM GR MYVIPFSMGPV  S++K GV++TDSPYVVASM IMTRMG+ V++++ +   FV+C HSVG PLP    ++N WPC+PEK +I+HLP   +I SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRYI AAFPSACGKTNLAM++ SLPG+K+ECVGDDIAWMKFD++G L+AINPE GFFGVAPGTS KTNP+AM  I +NT+FTNV ETSDGG +WEGLE       + +TDW G  W        AHPNSRFC PA QCPIID  WES +GVPI AI+FGGRRPEGVPLVYE+ +W HGVFVGA+MRSESTAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS  ++    QLP+I+HVNWFRK  KTG FLWPGFGEN RVLEWI KR  +  + ++   S +G +P    IN  G    +ID+  LF +   FW+KE  E+  YF++QVG  LP Q++ E+  L+E +
Sbjct:   34 SVAEFVSGAAAECKPAKVHVVTGTPEETADLLANLEKEGMVKKLAKYENCWLARTDPKDVARVESKTVIVTKNQRDTIPIPSGGAKSQLGSWMSEQDFQKAREDRFPGCMAGRTMYVIPFSMGPVNSSLAKFGVQVTDSPYVVASMGIMTRMGTPVMEKLAQGAEFVRCQHSVGRPLPLKGPLVNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYIAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSLKTNPHAMETISRNTVFTNVGETSDGGVWWEGLEPPA--PGIKLTDWHGKSWKYGDSTLCAHPNSRFCAPAGQCPIIDPLWESDEGVPIDAIVFGGRRPEGVPLVYESFNWRHGVFVGAAMRSESTAAAEHKGKVIMHDPFAMRPFFGYNFGDYLSHWLSMETRKGPTQLPKIFHVNWFRKDQKTGSFLWPGFGENARVLEWIFKRCGRTSENEAATKSIVGWIPQNGAINTEGLG-GNIDMGALFDLPKPFWQKETQELRTYFNQQVGADLPAQVEGELKALEERV 634          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Match: gca (grancalcin [Source:Xenbase;Acc:XB-GENE-983090])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 369/597 (61.81%), Postives = 445/597 (74.54%), Query Frame = 1
Query:  205 SLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLK 1995
            ++ ++++  A +C P +IH+CDGS  EN+ ++ +L  +G +KKL KY NCWL RTDP DVARVESKT I T     T+P    G++G LGNWMSP   E     RFPGCM+GR MYV+PFSMGPVG  +SK GV++TDSPYVVASMRIMTRMGS VL  +   + FVKC+HSVG PLP    ++N WPC+PEKTIIAH+P   EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRYI AAFPSACGKTNLAM+  SLPG+K++CVGDDIAWMKFD++G L+AINPE GFFGVAPGTS KTNPNA+  +++NTIFTNVAETSDGG +WEGL+  +    V++T W G  W     +  AHPNSRFC PA+QCPI+D  WESP+GVPI AIIFGGRRPEGVPLVYE+ +W HGVFVGASMRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS  K   LQLP+I+HVNWFRK +  G FLWPGFGEN RVL+WI +R++     + SAIG LP    +N+ G     +D   LFS+   FW+KE  ++ KY  EQV   LP QI  E+  L+
Sbjct:    7 AVREFVVKGAELCDPQNIHICDGSATENETIVTVLQQEGMLKKLHKYPNCWLARTDPKDVARVESKTVIVTENMRDTVPIPTTGVKGQLGNWMSPQDFERAKAERFPGCMRGRTMYVLPFSMGPVGSPLSKYGVQLTDSPYVVASMRIMTRMGSQVLDALGDGE-FVKCLHSVGQPLPLKAPLVNSWPCNPEKTIIAHVPDSREIVSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPAGRKRYIAAAFPSACGKTNLAMMRPSLPGWKVQCVGDDIAWMKFDSEGRLRAINPENGFFGVAPGTSAKTNPNALSTVERNTIFTNVAETSDGGVYWEGLDQPLP-PGVTVTSWLGKSWKPGDKEPCAHPNSRFCAPAAQCPIMDDAWESPEGVPIDAIIFGGRRPEGVPLVYESYNWNHGVFVGASMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGQYLSHWLSLQKRPGLQLPKIFHVNWFRKDAD-GGFLWPGFGENARVLDWIFRRVEGEESARQSAIGYLPAEGALNLQGL--GGVDTNALFSLPKGFWEKEVQDVGKYLTEQVTDDLPPQIMEELRGLE 598          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Match: slc5a6 (solute carrier family 5 (sodium/multivitamin and iodide cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-5737332])

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 364/603 (60.36%), Postives = 456/603 (75.62%), Query Frame = 1
Query:  205 SLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            ++ ++IL  A ICQPD IH+CDGSEEEN+K++ ++   G I++L KYENCWL RTDP DVAR+ESKT I T ++  T+P   +G +  LG WMS    +    +RFPGCMKGR MYVIPFSMGP+G  +SK+G+E+TDSPYVVASMRIMTRMG+ VL+ +   + FVKC+HSVG PLP  + ++N WPC+PE+T+IAH+P + EI SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y  AAFPSACGKTNLAM++ S+PG+KIECVGDDIAWMKFD  G L+AINPE GFFGVAPGTS KTNP AM  I+ NT+FTNV ETSDGG +WEG+ + +D   V++T W+   W    G+  AHPNSRFCTPASQCPIID +WES +GVPI  IIFGGRRP GVPLVYEA +W HGVFVG++MRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS     + ++P+I+HVNWFRK  K   FLWPG+GEN RVLEW+ KRI+     K + IG +P    +N+ G    D+++EELF +   FW+ E  +I+KY D+QV   LP +I+ E++ L+E L  L
Sbjct:   26 AVQNFILANAKICQPDYIHICDGSEEENKKLLHLMEETGMIRRLHKYENCWLARTDPQDVARIESKTVIVTQEQRDTVPLAKSG-QSQLGRWMSEEDFKKAFKSRFPGCMKGRTMYVIPFSMGPIGSPLSKIGIELTDSPYVVASMRIMTRMGTAVLETLGDGE-FVKCLHSVGCPLPLKKPLVNNWPCNPEQTLIAHIPEQREIISFGSGYGGNSLLGKKCFALRIASRIAKEEGWLAEHMLILGITNPEGEKKYFAAAFPSACGKTNLAMMKPSVPGWKIECVGDDIAWMKFDEHGNLRAINPENGFFGVAPGTSAKTNPYAMETIRNNTVFTNVGETSDGGIYWEGINESLD-PGVTLTSWKNKEWTPEDGEPCAHPNSRFCTPASQCPIIDPEWESQEGVPIEGIIFGGRRPTGVPLVYEALNWQHGVFVGSAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGKYLAHWLSMEHLPSTKMPKIFHVNWFRK-DKESNFLWPGYGENIRVLEWMFKRINGEDCAKETPIGYIPAEGALNLKGL--GDVNVEELFELSKEFWEDEVKDIKKYLDDQVNADLPYEIERELSALEERLKQL 622          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Match: gca (grancalcin [Source:Xenbase;Acc:XB-GENE-983090])

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 348/596 (58.39%), Postives = 421/596 (70.64%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEA--RDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLK 1995
            ++++  A +C P +IH+CDGS  EN+ ++ +L  +G +KKL KY NCWL RTDP DVARVESKT I T     T+P    G++G LGNWMSP   E     RFPGCM+GR MYV+PFSMGPVG  +SK GV++TDSPYVVASMRIMTRMGS VL  +   + FVKC+HSVG PLP    ++N WPC+PEKTIIAH+P   EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRYI AAFPSACGKTNLAM+  SLPG+K++CVGDDIAWMKFD++G L+AINPE GFFGVAPGTS KTNPNA+  +++NTIFTNVAETSDGG +WEGL+  +    V++T W G  W     +  AHPNSRFC PA+QCPI+D  WESP+GVPI AIIFGGRRPE + L Y +    W   +     M   S         +IMHDPFAMRPFFGYNFG YL HWLS  K   LQLP+I+HVNWFRK +  G FLWPGFGEN RVL+WI +R++     + SAIG LP    +N+ G     +D   LFS+   FW+KE  ++ KY  EQV   LP QI  E+  L+
Sbjct:   10 EFVVKGAELCDPQNIHICDGSATENETIVTVLQQEGMLKKLHKYPNCWLARTDPKDVARVESKTVIVTENMRDTVPIPTTGVKGQLGNWMSPQDFERAKAERFPGCMRGRTMYVLPFSMGPVGSPLSKYGVQLTDSPYVVASMRIMTRMGSQVLDALGDGE-FVKCLHSVGQPLPLKAPLVNSWPCNPEKTIIAHVPDSREIVSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPAGRKRYIAAAFPSACGKTNLAMMRPSLPGWKVQCVGDDIAWMKFDSEGRLRAINPENGFFGVAPGTSAKTNPNALSTVERNTIFTNVAETSDGGVYWEGLDQPLP-PGVTVTSWLGKSWKPGDKEPCAHPNSRFCAPAAQCPIMDDAWESPEGVPIDAIIFGGRRPEDM-LYYSSYKNAWSTVILF---MYVFSLLYFSSTGKVIMHDPFAMRPFFGYNFGQYLSHWLSLQKRPGLQLPKIFHVNWFRKDAD-GGFLWPGFGENARVLDWIFRRVEGEESARQSAIGYLPAEGALNLQGL--GGVDTNALFSLPKGFWEKEVQDVGKYLTEQVTDDLPPQIMEELRGLE 596          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck1 (phosphoenolpyruvate carboxykinase 1, cytosolic [Source:MGI Symbol;Acc:MGI:97501])

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 369/602 (61.30%), Postives = 454/602 (75.42%), Query Frame = 1
Query:  202 KSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            +++  ++   A +CQP+ IH+CDGSEEE  +++  +  +G I+KL KY+NCWL  TDP DVAR+ESKT I T ++  T+P    G+   LG WMS    E   N RFPGCMKGR MYVIPFSMGP+G  ++K+G+E+TDSPYVVASMRIMTRMG  VL+ +   + F+KC+HSVG PLP  + ++N W C+PE T+IAHLP R EI SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y+ AAFPSACGKTNLAM+  SLPG+K+ECVGDDIAWMKFD +G L+AINPE GFFGVAPGTS KTNPNA++ IQKNTIFTNVAETSDGG +WEG+ DE     V+IT W+   W     +  AHPNSRFCTPASQCPIID  WESP+GVPI  IIFGGRRPEGVPLVYEA  W HGVFVGA+MRSE+TAAAE+K  IIMHDPFAMRPFFGYNFG YL HWLS +   A +LP+I+HVNWFRK  K GKFLWPGFGEN RVLEW+  RI+     K + IG +P  + +N+ G     +++EELF +   FW+KE +EI++Y ++QV   LP +I+ E+  LK+ +S
Sbjct:   25 QAVRKFVEGNAQLCQPEYIHICDGSEEEYGQLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGL-SQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGISVLEALGDGE-FIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGI-DEPLAPGVTITSWKNKEWRPQDAEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGRRPEGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRK-DKDGKFLWPGFGENSRVLEWMFGRIEGEDSAKLTPIGYIPKENALNLKGL--GGVNVEELFGISKEFWEKEVEEIDRYLEDQVNTDLPYEIERELRALKQRIS 620          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 355/594 (59.76%), Postives = 447/594 (75.25%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLK 1995
            D++   A +CQP+ IH+CDG+E EN  ++ +L  QG I+KL KY+NCWL RTDP DVARVESKT I TP +  T+P L  G RG LGNWMSP   +  ++ RFPGCM+GR+MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  F+KC+HSVG PL      +  WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NT+FTNVAETSDGG +WEG++  +    V+IT W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+GVPLVYEA +W HGVFVG++MRSESTAAAE+K   IMHDPFAMRPFFGYNFG YLEHWLS    +  +LPRI+HVNWFR+  + G+FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G   S +D  +LFS+   FW++E  +I  Y  EQV + LP ++  E+  L+
Sbjct:   46 DFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLP-PGVTITSWLGKPWKPGDKEPCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRR-DEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGL--SAVDTSQLFSIPKDFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALE 634          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 355/594 (59.76%), Postives = 447/594 (75.25%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLK 1995
            D++   A +CQP+ IH+CDG+E EN  ++ +L  QG I+KL KY+NCWL RTDP DVARVESKT I TP +  T+P L  G RG LGNWMSP   +  ++ RFPGCM+GR+MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  F+KC+HSVG PL      +  WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NT+FTNVAETSDGG +WEG++  +    V+IT W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+GVPLVYEA +W HGVFVG++MRSESTAAAE+K   IMHDPFAMRPFFGYNFG YLEHWLS    +  +LPRI+HVNWFR+  + G+FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G   S +D  +LFS+   FW++E  +I  Y  EQV + LP ++  E+  L+
Sbjct:   73 DFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLP-PGVTITSWLGKPWKPGDKEPCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRR-DEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGL--SAVDTSQLFSIPKDFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALE 661          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 347/567 (61.20%), Postives = 433/567 (76.37%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEA 1914
            D++   A +CQP+ IH+CDG+E EN  ++ +L  QG I+KL KY+NCWL RTDP DVARVESKT I TP +  T+P L  G RG LGNWMSP   +  ++ RFPGCM+GR+MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  F+KC+HSVG PL      +  WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NT+FTNVAETSDGG +WEG++  +    V+IT W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+GVPLVYEA +W HGVFVG++MRSESTAAAE+K   IMHDPFAMRPFFGYNFG YLEHWLS    +  +LPRI+HVNWFR+  + G+FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G   S +D  +LFS+   FW++EA
Sbjct:   46 DFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLP-PGVTITSWLGKPWKPGDKEPCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRR-DEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGL--SAVDTSQLFSIPKDFWEQEA 607          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 330/594 (55.56%), Postives = 418/594 (70.37%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLK 1995
            D++   A +CQP+ IH+CDG+E EN  ++ +L  QG I+KL KY+NCWL RTDP DVARVESKT I TP +  T+P L  G RG LGNWMSP   +  ++ RFPGCM+GR+MYV+PFSMGPVG  +S++GV++TDS YVVASMRIMTR+G+ VL+ +  +  F+KC+HSVG PL      +  WPC+PEKT+I H+P + EI SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRY+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWM+FD++G L+AINPE GFFGVAPGTS  TNPNAM  IQ NT+FTNVAETSDGG +WEG++  +    V+IT W G PW     +  AHPNSRFC PA QCPI+D  WE+P+GVPI AIIFGGRRP+G                                  IMHDPFAMRPFFGYNFG YLEHWLS    +  +LPRI+HVNWFR+  + G+FLWPGFGEN RVL+WI +R++     + + IG +P    ++++G   S +D  +LFS+   FW++E  +I  Y  EQV + LP ++  E+  L+
Sbjct:   37 DFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQAL-GDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLP-PGVTITSWLGKPWKPGDKEPCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKG--------------------------------KTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRR-DEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGL--SAVDTSQLFSIPKDFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALE 593          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|P05153|PCKGC_CHICK (Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Gallus gallus OX=9031 GN=PCK1 PE=2 SV=1)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 381/600 (63.50%), Postives = 461/600 (76.83%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            ++I   A +CQP+SIH+CDGSEEEN+K++DI++ QG IKKLSKYENCWL  T+P DVAR+ESKT I T ++  TIP    G    LG WMS    E   NTRFPGCM+GR MYVIPFSMGP+G  ++K+G+E+TDSPYVVASMR+MTRMG+  LK +   + FVKC+HSVG PLP    +IN WPC+PE T+IAHLP R EI SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y  AAFPSACGKTNLAM+  S PG+KIECVGDDIAWMKFD  G L+AINPE GFFGVAPGTS KTNPNA++ I KNTIFTNVAETSDGG +WEG+ DE     V++T W+   W  + G+  AHPNSRFCTPASQCPI+D  WESP+GVPI  IIFGGRRP GVPLVYEA +W HGVF+GA+MRSE+TAAAE+K  IIMHDPFAMRPFFGYNFG YL HWLS +   A +LPRI+HVNWFRK S+ GKFLWPG+GEN RVLEW+  RI  +   KS+AIG +P  + +N+ G +  DI+L ELF++   FW+KE +EI++YF+ QV   LP +I+ E+  L+  +  L
Sbjct:   29 EFIESNAKLCQPESIHICDGSEEENKKILDIMVEQGMIKKLSKYENCWLALTNPRDVARIESKTVIITQEQRDTIPIPKTG-SSQLGRWMSEEDFEKAFNTRFPGCMQGRTMYVIPFSMGPIGSPLAKIGIELTDSPYVVASMRMMTRMGTAALKALGNGE-FVKCLHSVGCPLPLKEPLINNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRIAKEEGWLAEHMLILGITNPEGEKKYFAAAFPSACGKTNLAMMNPSRPGWKIECVGDDIAWMKFDELGNLRAINPENGFFGVAPGTSIKTNPNAIKTIFKNTIFTNVAETSDGGVYWEGI-DEPLPPGVTLTSWKNKDWTPDNGEPCAHPNSRFCTPASQCPIMDPAWESPEGVPIEGIIFGGRRPAGVPLVYEAFNWQHGVFIGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAHRPAAKLPRIFHVNWFRKDSQ-GKFLWPGYGENSRVLEWMFNRIQGKASAKSTAIGYIPADTALNLKGLE--DINLTELFNISKEFWEKEVEEIKQYFEGQVNADLPYEIERELLALEMRIKQL 622          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|P20007|PCKG_DROME (Phosphoenolpyruvate carboxykinase [GTP] OS=Drosophila melanogaster OX=7227 GN=Pepck PE=2 SV=2)

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 373/593 (62.90%), Postives = 459/593 (77.40%), Query Frame = 1
Query:  235 TICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
             +CQPD +H+CDGSE+EN+ +I  LL  G I  L KY+NCWL RT+PADVARVES+TFI T ++E TIP    G++G+LGNW+SP+ M+  +  RFPGCMKGR MYV+PFSMGPVG  +SK+G+E+TDS YVVASMRIMTRMG+ VL+++ K++ FV+ +HSVG P    +     WPCDPE+TII H PA N I S+GSGYGGNSLLGKKC ALR+GS +  ++ WLAEHMLILGITD    K+YITAAFPSACGKTNLAML  SL  YK+ECVGDDIAWMKFD++G+L+AINPE GFFGVAPGTS +TNP AM  + KNTIFTNVA TSDGG FWEG+E  +   +V ITDW G PW K+ GK AAHPNSRFCTPA+QCPIID  WE P GVPISA++FGGRRP GVPL+YEARDW HGVF+GA+MRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG Y+ HWLS  K    Q+P+I+HVNWFRKS++ GKF+WPG+GEN RVLEWIL+R++       SAIG++P    +N+ G  K  +D++E+FS+   FW +E  +I  YF+ QVG  LP  I  ++ +L   +  L
Sbjct:   61 ALCQPDQVHICDGSEQENKVLIKSLLEAGTIVPLPKYDNCWLARTNPADVARVESRTFICTERREETIPTPVEGVKGTLGNWISPSDMDAAVQQRFPGCMKGRTMYVVPFSMGPVGSPLSKIGIELTDSAYVVASMRIMTRMGAAVLRQLAKKEEFVRALHSVGAPA-NGQVEQPSWPCDPERTIILHKPAENLIVSYGSGYGGNSLLGKKCFALRIGSTIAKQEGWLAEHMLILGITDPKGEKKYITAAFPSACGKTNLAMLNPSLANYKVECVGDDIAWMKFDSQGVLRAINPENGFFGVAPGTSMETNPIAMNTVFKNTIFTNVASTSDGGVFWEGMESSL-APNVQITDWLGKPWTKDSGKPAAHPNSRFCTPAAQCPIIDEAWEDPAGVPISAMLFGGRRPAGVPLIYEARDWTHGVFIGAAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGDYVAHWLSMEKRG--QVPKIFHVNWFRKSAE-GKFMWPGYGENSRVLEWILRRVNGESCYVDSAIGHIPAEGALNLDGM-KDKVDVKEIFSLPKEFWSQEVKDIRTYFESQVGADLPASIYQQLDELSSRVDNL 647          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|P35558|PCKGC_HUMAN (Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Homo sapiens OX=9606 GN=PCK1 PE=1 SV=3)

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 376/602 (62.46%), Postives = 459/602 (76.25%), Query Frame = 1
Query:  202 KSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            +++ +++   A +CQPD IH+CDGSEEEN +++  +  +G +++L KY+NCWL  TDP DVAR+ESKT I T ++  T+P    G+   LG WMS    E   N RFPGCMKGR MYVIPFSMGP+G  +SK+G+E+TDSPYVVASMRIMTRMG+ VL+ +   + FVKC+HSVG PLP  + ++N WPC+PE T+IAHLP R EI SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y+ AAFPSACGKTNLAM+  SLPG+K+ECVGDDIAWMKFD +G L+AINPE GFFGVAPGTS KTNPNA++ IQKNTIFTNVAETSDGG +WEG+ DE     V+IT W+   W    G+  AHPNSRFCTPASQCPIID  WESP+GVPI  IIFGGRRP GVPLVYEA  W HGVFVGA+MRSE+TAAAE+K  IIMHDPFAMRPFFGYNFG YL HWLS ++  A +LP+I+HVNWFRK  K GKFLWPGFGEN RVLEW+  RID +   K + IG +P    +N+ G     I++ ELFS+   FW+KE ++IEKY ++QV   LP +I+ EI  LK+ +S
Sbjct:   25 QAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGL-SQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEAVGDGE-FVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGI-DEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRK-DKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGL--GHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRIS 620          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|Q5R5J1|PCKGC_PONAB (Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Pongo abelii OX=9601 GN=PCK1 PE=2 SV=1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 376/592 (63.51%), Postives = 453/592 (76.52%), Query Frame = 1
Query:  232 ATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            A +CQPD IH+CDGSEEEN +++  +  +G +++L KY+NCWL  TDP DVAR+ SKT I T ++  T+P    G+   LG WMS    E  LN RFPGCMKGR MYVIPFSMGP+G  +SK+G+E+TDSPYVVASMRIMTRMG+ VL+ +   + FVKC+HSVG PLP  + ++N WPC+PE T+IAHLP R EI SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y+ AAFPSACGKTNLAM+  SLPG+K+ECVGDDIAWMKFD +G L+AINPE GFFGVAPGTS KTNPNA++ IQKNTIFTNVAETSDGG +WEG+ DE     V+IT W+   W    G+  AHPNSRFCTPASQCPIID  WESP+GVPI  IIFGGRRP GVPLVYEA  W HGVFVGA+MRSE+TAAAE+K  IIMHDPFAMRPFFGYNFG YL HWLS ++  A +LP+I+HVNWFRK  K GKFLWPGFGEN RVLEW+  RID +   K + IG +P    +N+ G     I++ ELFS+   FW+KE ++IEKY ++QV   LP +I+ EI  LK+ +S
Sbjct:   35 AELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIGSKTVIVTQEQRDTVPIPKTGL-SQLGRWMSEEDFEKALNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEALGDGE-FVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGI-DEPLASGVTITSWKNKEWSPEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRK-DKEGKFLWPGFGENSRVLEWMFNRIDGKAGAKLTPIGYIPKEDALNLKGL--GHINVMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRIS 620          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|P07379|PCKGC_RAT (Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Rattus norvegicus OX=10116 GN=Pck1 PE=1 SV=1)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 368/592 (62.16%), Postives = 450/592 (76.01%), Query Frame = 1
Query:  232 ATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            A +CQP+ IH+CDGSEEE  +++  +  +G I+KL KY+NCWL  TDP DVAR+ESKT I T ++  T+P   +G +  LG WMS    E   N RFPGCMKGR MYVIPFSMGP+G  ++K+G+E+TDSPYVVASMRIMTRMG+ VL+ +   + F+KC+HSVG PLP  + ++N W C+PE T+IAHLP R EI SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILGIT+    K+Y+ AAFPSACGKTNLAM+  +LPG+K+ECVGDDIAWMKFD +G L+AINPE GFFGVAPGTS KTNPNA++ IQKNTIFTNVAETSDGG +WEG+ DE     V+IT W+   W     +  AHPNSRFCTPASQCPIID  WESP+GVPI  IIFGGRRP GVPLVYEA  W HGVFVGA+MRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS +   A +LP+I+HVNWFRK  K GKFLWPGFGEN RVLEW+  RI+     K + IG +P    +N+ G    D+++EELF +   FW+KE +EI+KY ++QV   LP +I+ E+  LK+ +S
Sbjct:   35 AQLCQPEYIHICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSG-QSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTSVLEALGDGE-FIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGI-DEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRK-DKNGKFLWPGFGENSRVLEWMFGRIEGEDSAKLTPIGYVPKEDALNLKGL--GDVNVEELFGISKEFWEKEVEEIDKYLEDQVNADLPYEIERELRALKQRIS 620          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A443RAW7 (Phosphoenolpyruvate carboxykinase-like: cytosolic [GTP] isoform X1 OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_09017 PE=3 SV=1)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 395/597 (66.16%), Postives = 477/597 (79.90%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            YI  K ++C+PD++++CDGS+ EN++++ +L  +G IK+LSKYENCWL RTDP DVARVESKTFI+T  +  TIP+  NG++G LGNWMSP  M   LN+RFPGCM+GR MYVIPFSMGPVG  +SK+GV++TDSPYVVASMRIMTRMG+ VLK +  ++ FVKC+HSVG PLP     +N WPC+PEKTIIAH+P  NEI SFGSGYGGNSLLGKKC ALRLGSI+  ++ W AEHMLILGIT+    K+YI AAFPSACGKTNLAM+  +LPGYKIECVGDDIAWMKFD+ G+L+AINPE GFFGVAPGTS KTNPNAM+ I KNTIFTNVAETS+GG +WEGLE E++  +V I  W    W    GK AAHPNSRFC PA QCPIID  WE P GVPISAIIFGGRRP+GVPLVYE+  W HGVFVGA+MRSE+TAAAE+KA +IMHDPFAMRPFFGYNFGHYL HWLSF +   L+LP+I+HVNWFRK S  GKFLWPGFGEN RVL+WI +R++       + IG +P    +N+ G  + +++L+ELF++ + FWKKE +EIE YFDEQVG+ LP  I+NE+  LK+ +S
Sbjct:   81 YIEEKISVCEPDAVYICDGSDAENEQLLRLLEREGQIKRLSKYENCWLARTDPKDVARVESKTFITTKDRRETIPNTKNGVKGQLGNWMSPEEMNQALNSRFPGCMRGRTMYVIPFSMGPVGSPLSKIGVQLTDSPYVVASMRIMTRMGASVLKALGDQE-FVKCLHSVGQPLPMQTPPVNNWPCNPEKTIIAHIPENNEIASFGSGYGGNSLLGKKCFALRLGSILAKREKWFAEHMLILGITNPKGEKKYIAAAFPSACGKTNLAMMNPTLPGYKIECVGDDIAWMKFDSDGVLRAINPENGFFGVAPGTSDKTNPNAMKTIVKNTIFTNVAETSEGGVYWEGLEHEIEGKNVKIKSWLNEDWTPGCGKPAAHPNSRFCAPAGQCPIIDPAWEDPKGVPISAIIFGGRRPQGVPLVYESFSWSHGVFVGAAMRSEATAAAEHKAKVIMHDPFAMRPFFGYNFGHYLSHWLSFEQTEGLKLPKIFHVNWFRKGSD-GKFLWPGFGENSRVLDWIFRRVNGENCATVTPIGLIPKEGSLNLEGLSE-NVNLKELFTLPTDFWKKECEEIENYFDEQVGEDLPEAIRNELISLKKRIS 674          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A132ADU8 (Uncharacterized protein (Fragment) OS=Sarcoptes scabiei OX=52283 GN=QR98_0076870 PE=3 SV=1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 394/622 (63.34%), Postives = 491/622 (78.94%), Query Frame = 1
Query:  148 NLVKMIDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENC--WLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            +LV+    ++ L DS+ +  +  +I  KA IC+PD I VCDG+EEEN+++I++++ QG ++KL KY+N   WL RTDPADVARVESKT ISTP +  TIP+   GI G+LG W+SP  +E  L+ RFPGCMKGR MYVIPFSMGP+G  +SK+G+++TDSPYVVASMRIMTRMGS VLK +     F++C+HSVG PLP +R + N WPC+PEKT+I H+P RNEI SFGSGYGGNSLLGKKC ALRLGSI+  ++ W AEHMLILGIT+    K+YI AAFPSACGKTNLAML  +LPGYK+ECVGDDIAWM+FD  G+L+AINPE+GFFGVAPGT+ KTNPNAM+ I  NT+FTNV +TSDGG +WEGLEDE D  ++SIT W G  +D++ GK AAHPNSRFC PA QCPIID +WE   GVPISAIIFGGRRPEGVPLVYE+ DW HGV VGAS+RSE+TAAAE+K  IIMHDPFAMRPFFGYNFGHYL HWLSF++   L+LP+I+HVNWFRK  ++GKFLWPGFGENCRVL+WI++R+D     ++S IG LP    + + G    D+D ++LF V   FWK+E + I KYFDEQVG+ LP ++ +++ +L++ L+
Sbjct:  106 SLVQARSLSQSLPDSLQNDYVRKFIEEKARICKPDQIQVCDGTEEENKQLIELMVKQGQLEKLEKYDNWYPWLARTDPADVARVESKTIISTPNRRDTIPNTKPGIDGTLGKWLSPNDLEKALDDRFPGCMKGRTMYVIPFSMGPIGSPLSKIGIQLTDSPYVVASMRIMTRMGSNVLKALGDRDDFIRCLHSVGCPLPLSRPLKNNWPCNPEKTLITHIPDRNEIISFGSGYGGNSLLGKKCFALRLGSILAKREGWFAEHMLILGITNPAGQKKYIVAAFPSACGKTNLAMLTPTLPGYKVECVGDDIAWMRFDENGVLRAINPEFGFFGVAPGTNNKTNPNAMKTIASNTVFTNVGKTSDGGVYWEGLEDETD-PNLSITTWLGEKFDRSSGKPAAHPNSRFCAPAGQCPIIDSNWEDSKGVPISAIIFGGRRPEGVPLVYESFDWKHGVLVGASLRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGHYLSHWLSFAEKPGLKLPKIFHVNWFRKDQQSGKFLWPGFGENCRVLDWIIRRVDNENIAENSPIGYLPTKQSLIMDGL---DVDYDKLFDVPKEFWKQEVNSIRKYFDEQVGEDLPKEMLSQLDQLEKRLN 723          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A183AAI6 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3971 PE=3 SV=1)

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 393/596 (65.94%), Postives = 471/596 (79.03%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKC-FVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKEN 2001
            Y+  KA +CQPD I+VCDGS+EE +K +  L   GAIKKL+ YENCWL RTDPADVARVESKT ISTP +  T+P +  G++G+LG WMSPA ++   + RFPGCMKGR MYVIPFSMGP+GG ISK+G+E+TDS YVVASMRIMTRMGS VLK ++K+   F+K +HSVG+P P +R +IN WPC+PE T+I+H+PA NEICSFGSGYGGNSLLGKKC ALRLGSI+  ++ WLAEHMLILG+      +RYI AAFPSACGKTNLAML+ SLPGYKI CVGDDIAWMKFD +G L+AINPE GFFGVAPGT+  TNPNAM  IQKNTIFTNVAE SDG F+WEGLE +VD + V +TDW G PWD + GK AAHPNSRFCTPASQCPIID DWE P+GVPI AIIFGGRRPEGVPLV ++ +W HGVF+GA MRSE+TAAAE+KA ++MHDPFAMRPFFGYNFG YLEHWLSF     L+LP+I+HVNWFRK S +GKF+WPGFGEN RVL+WIL+R D+ +    S  G +P   D+ + G +    D+  L S+   FWKKE  E++ YFDEQ+ + LP  ++ E+  L+E 
Sbjct:   22 YVEEKAVLCQPDHIYVCDGSDEEFKKCLTDLEKSGAIKKLTAYENCWLARTDPADVARVESKTVISTPDQRATVPKVKEGVKGTLGIWMSPADLDKAFSVRFPGCMKGRTMYVIPFSMGPLGGPISKIGIELTDSLYVVASMRIMTRMGSEVLKLLQKDDSHFIKALHSVGLPKPESRPVINHWPCNPELTLISHIPANNEICSFGSGYGGNSLLGKKCFALRLGSILAQREGWLAEHMLILGLKTPAGKQRYIAAAFPSACGKTNLAMLQPSLPGYKITCVGDDIAWMKFDKEGRLRAINPEAGFFGVAPGTAMDTNPNAMLTIQKNTIFTNVAELSDGRFYWEGLEKDVDFNKVKVTDWTGKPWDPSSGKPAAHPNSRFCTPASQCPIIDPDWEKPEGVPIDAIIFGGRRPEGVPLVMQSFNWRHGVFLGACMRSEATAAAEHKAKVVMHDPFAMRPFFGYNFGKYLEHWLSFENKPGLKLPKIFHVNWFRKDS-SGKFMWPGFGENLRVLDWILRRCDEEIPAVESIAGLVPRPEDLKLDGLNPKP-DIHTLLSLPPDFWKKEVQELKHYFDEQLPEDLPAAMREELKHLEER 615          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A443SNR8 (Phosphoenolpyruvate carboxykinase-like: cytosolic [GTP] OS=Leptotrombidium deliense OX=299467 GN=B4U80_07835 PE=3 SV=1)

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 396/598 (66.22%), Postives = 473/598 (79.10%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSI 2010
            Y+  K  +CQPDS+HVCDGS+ EN++++ +L   G I +L+KY NCWL RTDP DVARVES TFIST KK  T+P   NG++G LGNWMSP  M+N L +RFPGCMKGR M+VIPFSMGPVG  +SK+G+++TDSPYVV SMRIMTR+G+ VL  +   + FVKC+HSVG PLP     +N WPC+PEKT+IAH+P  NEI SFGSGYGGNSLLGKKC ALRLGSI+  ++ W AEHMLILGIT+    K+YI AAFPSACGKTNLAM+  +L GYKIECVGDDIAWM+F+ KG L+AINPE GFFGVAPGTS KTNPNAM+ I KNTIFTNVAET+DGG +WEGLEDE++  +  I  W G  W  + GK AAHPNSRFCTPASQCPIID  W+ P+GVPISAIIFGGRRPEGVPLVYEA DW HGVF+GASMRSESTAAAE+K  +IMHDPFAMRPFFGYNFGHYL+HWLSF  ++ L LP+I+HVNWFRK  + GKFLWPGFGEN RVL+WI +R++     + S IG LP    +NV G  K ++D+++LFS+   FW  E DEIEKYF+EQVG  LPN I+NE+  L++  S+
Sbjct:   61 YVEDKIAVCQPDSVHVCDGSDSENEELLRLLERNGMITRLNKYSNCWLARTDPKDVARVESLTFISTDKKRDTVPQTKNGVKGCLGNWMSPTDMQNALQSRFPGCMKGRTMFVIPFSMGPVGSPLSKIGIQLTDSPYVVVSMRIMTRIGTAVLNALGDGE-FVKCLHSVGQPLPMKTPAVNNWPCNPEKTLIAHIPDNNEIASFGSGYGGNSLLGKKCFALRLGSILAKRERWFAEHMLILGITNPKGEKKYIAAAFPSACGKTNLAMMNPTLDGYKIECVGDDIAWMRFNEKGELRAINPEAGFFGVAPGTSNKTNPNAMKTILKNTIFTNVAETADGGIYWEGLEDEIEEKNFPIKSWLGEDWKPDSGKVAAHPNSRFCTPASQCPIIDDAWQDPNGVPISAIIFGGRRPEGVPLVYEALDWKHGVFMGASMRSESTAAAEHKGKVIMHDPFAMRPFFGYNFGHYLQHWLSFENEKQLNLPKIFHVNWFRK-GENGKFLWPGFGENIRVLDWIFRRVNGEDCAQMSPIGLLPKQGCLNVNGL-KENVDVQQLFSLSPQFWLNECDEIEKYFNEQVGDDLPNAIRNELVSLRKRFSV 655          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: T1KI49 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107364458 PE=3 SV=1)

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 390/606 (64.36%), Postives = 480/606 (79.21%), Query Frame = 1
Query:  187 DSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            D +S K+  +++  KA IC+PDSIH+CDG+EEEN ++I++++ QG IKKL KYENCWL RTDPADVARVES TFIST  K  T+P+   G++G+LGNWMSP  ++  LN+RFP CMKGR MYVIPFSMGPVG  +SK+G+E+TDSPYV ASMRIMTRMG  VL  +  E  F+KC+HSVG PLP +R ++N WPC+PE+TIIAH P  NEI SFGSGYGGNSLLGKKC ALRLGSI+  ++ WLAEHMLILGIT  +  K+YI AAFPSACGKTNLAM+E +LPG+K+ECVGDDIAWM+FD+ G L+AINPEYGFFGVAPGTS KTNPNAM+ I  NTIFTNV ETSDGG +WEGL D+VD+ ++ +  W    W    GK AAHPNSRFC+PASQCPI+D +WESP+GVPISAIIFGGRRP GVPLVYEA +W HGV++GASMRSE+TAAAE+K+ ++M DPFAMRPFFGYNFGHYL+HWLSF     L LP+I+HVNWFRK S  GKFLWPGFGEN RVL+WI +R++Q    + + IG +P    +N+ G  +  I+++ELFS+   FW  E DE++ YF++QVG  LP ++  E+  L+  L
Sbjct:   67 DKLSSKAR-NFVEEKARICEPDSIHICDGTEEENNQLINLMVQQGMIKKLPKYENCWLSRTDPADVARVESLTFISTRNKRDTVPEPKPGVKGTLGNWMSPDDLDKALNSRFPKCMKGRTMYVIPFSMGPVGSPLSKIGIELTDSPYVAASMRIMTRMGKQVLDTLGNED-FIKCLHSVGCPLPASRTLVNNWPCNPERTIIAHKPDSNEIASFGSGYGGNSLLGKKCFALRLGSILAQREGWLAEHMLILGITSPSGAKKYIAAAFPSACGKTNLAMMEPTLPGWKVECVGDDIAWMRFDSNGTLRAINPEYGFFGVAPGTSSKTNPNAMKTILSNTIFTNVGETSDGGVYWEGL-DDVDVSNLGVKSWMNEDWTPGCGKNAAHPNSRFCSPASQCPIMDPNWESPEGVPISAIIFGGRRPAGVPLVYEAFNWSHGVYIGASMRSEATAAAEHKSKVVMFDPFAMRPFFGYNFGHYLDHWLSFGDKTGLNLPKIFHVNWFRKGSD-GKFLWPGFGENSRVLDWICRRVNQEDVAQKTPIGFIPKPGSLNLDGLTEK-INMDELFSLPKDFWLNECDEVQNYFEQQVGSDLPKKVMKELDSLRSRL 667          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Cavefish
Match: pck1 (phosphoenolpyruvate carboxykinase 1 [Source:NCBI gene;Acc:103029368])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 369/603 (61.19%), Postives = 459/603 (76.12%), Query Frame = 1
Query:  205 SLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            +L ++I    T+CQPD++H+CDGSEEEN+ ++  L  QG IK+L+KYENCWL RTDP DVARVESKT I T ++  T+P    G    LG WMS    +  +N RFPGCMKGR MYVIP+SMGPVG  +SK+GVE+TDSPYVV SMR+MTRMG  VL  +     FV+C+HSVG PLP  + ++N WPC+P  T+IAH+P + +I SFGSGYGGNSLLGKKC ALR+ S +  ++ WLAEHMLILG+T+    K+YI AAFPSACGKTNLAML+ +LPG+K+ECVGDDIAWMKFD++G L+AINPE GFFGVAPGTS K+NPNAM  I KNTIFTNVAETSDGG +WEG++ ++  + V+IT W+   W    G+  AHPNSRFCTPASQCPIID +WESP+GVPI AIIFGGRRPEGVPLVYE+  W HGVFVGA+MRSE+TAAAE+   +IMHDPFAMRPFFGYNFGHYL HWLS  +    +LP+I+HVNWFRKS  +G FLWPG+GEN RVLEWI  R++       SA+G LP    +N+ G  K  ++LEELF +   FW+KE ++I++YFD +V   LP ++K ++  LK  ++ L
Sbjct:   26 ALREFIESSMTLCQPDALHICDGSEEENKAILAHLQEQGMIKRLTKYENCWLARTDPRDVARVESKTVIVTQEQRDTVPSPCGGGISQLGRWMSQEEWDKAMNERFPGCMKGRTMYVIPYSMGPVGSPLSKIGVELTDSPYVVLSMRVMTRMGKAVLNALGNGD-FVRCLHSVGCPLPLKKPLVNNWPCNPPLTLIAHIPDQRKIVSFGSGYGGNSLLGKKCFALRIASRIAKEEGWLAEHMLILGVTNPAGEKKYIAAAFPSACGKTNLAMLKPTLPGWKVECVGDDIAWMKFDDEGNLRAINPENGFFGVAPGTSVKSNPNAMETICKNTIFTNVAETSDGGIYWEGMDHKLP-EGVTITSWKNKAWTPEDGEPCAHPNSRFCTPASQCPIIDPNWESPEGVPIEAIIFGGRRPEGVPLVYESFSWAHGVFVGAAMRSEATAAAEHTNKVIMHDPFAMRPFFGYNFGHYLSHWLSMEQRPNSKLPKIFHVNWFRKSP-SGGFLWPGYGENIRVLEWIFHRLNGEAGAMPSAVGYLPSERSLNLDGL-KDQVNLEELFDISRDFWEKEVEDIQQYFDREVNSDLPVEMKMQLEMLKLRVNHL 624          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Cavefish
Match: pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-040426-2266])

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 355/601 (59.07%), Postives = 434/601 (72.21%), Query Frame = 1
Query:  214 DYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSF-SKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVD---CKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            +++   A  C+P  +HV  G+ EE  +++  +   G +KKL+KY+NCWL RTDP DVARVESKT I T ++  TIP   N ++  LGNWMS +  +     RFP CM GR MYVIPFSMGPV  S++K GV++TDSPYVVASM IMTRMG+ V+ ++ +   FV+C HSVG PLP    ++N WPC+PEK +IAHLP   +I SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRYI AAFPSACGKTNLAM++ +LPG+K+ECVGDDIAWMKFD++G L+AINPE GFFGVAPGTS KTNP AM  I KNT+FTNV ETSDGG +WEGL+      ++ +TDW G  W        AHPNSRFC PA+QCPIID  WES +GVPI AIIFGGRRPEGVPLVYE+ +W HGVFVGA+MRSESTAAAE+K  ++MHDPFAMRPFFGYNFG YL HWLS  ++    QLP+I+HVNWFRK  K+  FLWPGFGEN RVLEWI  R  +  +    K S IG LP    IN  G   + +D+  LF +   FW+KE  E++ YF +QVG  LP Q+  E+  L+E +
Sbjct:   19 EFVSEAAAECKPAKVHVVTGTPEETAELLAGMEKDGMVKKLTKYQNCWLARTDPKDVARVESKTVIVTKQQRDTIPIPENNVKSQLGNWMSESEFQTAREDRFPSCMTGRTMYVIPFSMGPVNSSLAKYGVQVTDSPYVVASMGIMTRMGTPVMDKLAQGVEFVRCQHSVGRPLPLKAPLVNQWPCNPEKVLIAHLPDSRKIMSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYIAAAFPSACGKTNLAMMKPALPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSGKTNPYAMDTISKNTVFTNVGETSDGGIWWEGLDPPS--SNIGLTDWHGKTWKFGASTPCAHPNSRFCAPAAQCPIIDPLWESEEGVPIDAIIFGGRRPEGVPLVYESFNWRHGVFVGAAMRSESTAAAEHKGKVVMHDPFAMRPFFGYNFGDYLAHWLSMETRKGPTQLPKIFHVNWFRKDPKSNSFLWPGFGENARVLEWIFGRCGRTREEEAAKKSIIGWLPEEGAINTEGLG-AKVDMGALFDLPKHFWQKEVQELQAYFTQQVGADLPEQVAGELRALEERV 616          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005310.1 (pep scaffold:Pmarinus_7.0:GL478263:992:2267:1 gene:ENSPMAG00000004836.1 transcript:ENSPMAT00000005310.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.876 bits (590), Expect = 2.140e-72
Identity = 108/190 (56.84%), Postives = 141/190 (74.21%), Query Frame = 1
Query: 1438 GGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRA-LQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            GG    GVPLV+EA  W HGVFVGA+MRSE+TAAAEYK  +IMHDPFAMRPFFGYNFGHYL HWL  ++  +  QLPRIYHVNWFR+    G FLWPGFG+NCRVLEWI +R++ R +   +A+G +P   +++++G  + ++D E LFSV  AFW++EA EI  Y +E+VG  LP +I +E+  L+E +
Sbjct:    1 GGVLAAGVPLVFEAFSWQHGVFVGAAMRSEATAAAEYKGKVIMHDPFAMRPFFGYNFGHYLAHWLGMARRSSPAQLPRIYHVNWFRR-GPAGNFLWPGFGDNCRVLEWITRRLEGRAEGCRTAVGVVPAPGELDLSGLAE-EVDEEALFSVPRAFWEEEAAEIRSYLEEEVGDDLPREILDEMAALEERI 188          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO41588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S418])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 352/609 (57.80%), Postives = 437/609 (71.76%), Query Frame = 1
Query:  202 KSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLN---NGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNP-WDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSF---SKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKK-EADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            K + D++     +CQPD IH+CDGS EENQ ++D L+ +G   KL+K EN ++VRTDP DVARVESKTFI T  +   +PD     +G+ G LG W+S       L  RFPGCMKGR MYV+PFSMGPVG  I+K+G+++TDS YVV  MRIMTRMGS VLK +++   FVKC+HSVG PL    K +  WPCDP++TII H PA N I SFGSGYGGNSLLGKKC ALR+ S +  K+ WLAEHMLI+ +T+    K+YI AAFPSACGKTNLAML+ ++PG+K++CVGDDIAWM FD  G L+AINPE GFFGVAPGTS KTNP A++   K+TIFTN A TSDG F+WEGL D      VSIT W G   W    G KAAHPNSRFCTP++ C I+D DWE+P+GVPISAI+FGGRRP GVPLVY+A +W HGVF+ +S+ SE+TAAAE+K   IM DPFAMRPFFGYN+G YLEHWLS    +K    +LP I+HVNWFR + K G FLWPGFGENCRVLEWI +  +         +G +P    +N+ G DK  I+ +ELFSV   +W +   + + +Y+ +QVGK LP +I NE+  L++ L
Sbjct:   18 KKVQDFVTENVELCQPDKIHICDGSPEENQSLVDFLVKKGTCFKLTKRENSYVVRTDPGDVARVESKTFICTENERDAVPDFKKGKDGVVGQLGRWLSVEKANQALGERFPGCMKGRTMYVLPFSMGPVGSPIAKIGIQLTDSEYVVCCMRIMTRMGSHVLKALDQGD-FVKCLHSVGKPLKEGEKDVL-WPCDPDRTIITHFPADNYIKSFGSGYGGNSLLGKKCFALRIASNIALKEGWLAEHMLIMALTNPEGKKKYIAAAFPSACGKTNLAMLKPTIPGWKVDCVGDDIAWMWFDKTGQLRAINPESGFFGVAPGTSMKTNPEALKTCLKDTIFTNTAMTSDGDFWWEGLPDPP--KGVSITSWLGEENWSPESGSKAAHPNSRFCTPSANCEIMDKDWENPEGVPISAILFGGRRPRGVPLVYKAFNWQHGVFIASSLSSETTAAAEFKGKAIMRDPFAMRPFFGYNYGRYLEHWLSMADKTKHPNYKLPDIFHVNWFRVNEK-GHFLWPGFGENCRVLEWIFRCTEGEDISMECPVGLIPKPGTLNLDGLDK--INWDELFSVPKDYWLQIVCENLHQYYKDQVGKDLPKEITNELKALEDRL 619          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO41631 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S417])

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 337/616 (54.71%), Postives = 422/616 (68.51%), Query Frame = 1
Query:  190 SVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENEL-NTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNP-WDKNKG----KKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDK--SDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSIL 2013
            S   K + +++   A + +P  IH+CDGSE+ENQ  I IL+ +GA   L K+ NC+ V TDP DVARVESKTFI T  K   +P     + G L  WMS      +L   R+PGCM+GR MYV+PFSMGPVG  ISK+G+E+TDS YVV  MRIMTRMGS VLK +  +  FV+C+HSVG PL   +  +  WPCDPE+T+I H P   EI S+GSGYGGNSLLGKKC ALR+ S++   + WLAEHM+ILG+T+    K YI AAFPSACGKTNLAML  ++PG+K ECVGDDIAWM FD  G L+AINPE GFFGVAPGTSF +NP AM   QK+TIFTNVA+TSDG F+WEGL      D + I  W G+P W         K AAHPNSRFC P+  CPI+D DWE+P GVPISAI+FGGRRP GVPLV ++ +W HGVF+  S+ SE+TAAAE+K   +M DPFAMRPFFGYNFG YLEHWLS  KD   +LP I+HVNWFR  + T  FLWPGFGEN RVLEW+  R+    +   S +G +P    +N+   +   +   ++ELFS+   +W  E + + KYF +++G  LP  I NE+  L++ +  +
Sbjct:   17 SALPKKVREFVEENARLMKPAQIHICDGSEDENQNNIKILMDRGAAVPLEKHSNCYAVFTDPRDVARVESKTFICTKNKHDAVPHFKGEV-GQLARWMSLEEAHKKLYEERYPGCMEGRTMYVMPFSMGPVGSPISKIGIELTDSEYVVCCMRIMTRMGSHVLKAL-GDGDFVRCLHSVGGPLHDGKNNVP-WPCDPERTLITHFPETREIKSYGSGYGGNSLLGKKCFALRIASVIARDEGWLAEHMMILGLTNPEGKKIYIAAAFPSACGKTNLAMLTPTIPGWKCECVGDDIAWMWFDKDGTLRAINPECGFFGVAPGTSFLSNPIAMSTFQKDTIFTNVAKTSDGDFWWEGLNPPA--DGIKIRSWLGDPDWKPEVAGKTRKTAAHPNSRFCAPSDHCPIMDKDWENPAGVPISAILFGGRRPYGVPLVMQSFNWQHGVFLATSLSSETTAAAEFKGKAVMRDPFAMRPFFGYNFGKYLEHWLSMEKDPKKKLPLIFHVNWFRLDN-TEHFLWPGFGENSRVLEWVFNRVHNVDNADVSPVGLIPKQGALNLEQMETPVTPEAMKELFSIPKEYWLDEVESLRKYFQQEIGDDLPKAISNELDALEQRIKAI 626          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO41587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S416])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 335/607 (55.19%), Postives = 422/607 (69.52%), Query Frame = 1
Query:  202 KSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENEL-NTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNP-WDKNK-GKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLE---ELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            K + +++   A +  P  IH+CDGS+ EN+  I++LL++GA   L K+ENC+ V TDP DVARVES+TFI T  K+  +P     + G L  WMS      +L   R+PGCM GR MYV+PFSMGPVG  ISK+G+++TDS YVV  MRIMTRMGS VLK +  +  FV+ +HSVG PL    K +  WPCDPE+T+I H PA  EI S+GSGYGGNSLLGKKC ALR+ S + H + WLAEHM+I+G+T+    K YI AAFPSACGKTNLAML  ++PG+K ECVGDDI WM FD  G L+AINPE GFFGV PGT+F +NP AM+  QK+TIFTNVA TSDG F+WEGL      + + I  W+G+P W   + G  AAHPNSRFC P+  CPI+D DWE+P GVPISAI+FGGRRP GVPLV ++ +W HGVF+  S+ SE+TAAAE+K   +M DPFAMRPFFGYNFG YLEHWL+ SKD   +LP I+HVNWFR   K   FLWPGFGEN RVLEW+ +R+        S +G LP    +N+ G  K  +  E   E+FS+   +W +E  E+ KYF ++VG  LP  I++E+  L+  L
Sbjct:   16 KKVQEFVEENAKLMTPAQIHICDGSDAENKANIEVLLNKGAAVPLEKHENCYAVFTDPQDVARVESRTFICTKCKDDAVPHFKGKV-GKLARWMSLEEAHKKLYEERYPGCMTGRTMYVLPFSMGPVGSPISKIGIQLTDSEYVVCCMRIMTRMGSHVLKAL-GDGDFVRGVHSVGFPLKEGVKEVP-WPCDPERTLITHFPATREIKSYGSGYGGNSLLGKKCFALRIASNIAHDEGWLAEHMMIMGLTNPEGKKIYIAAAFPSACGKTNLAMLTPTIPGWKCECVGDDINWMWFDKDGTLRAINPESGFFGVCPGTTFTSNPIAMKTFQKDTIFTNVAVTSDGDFWWEGLAPPA--EGIKIRSWKGDPDWKPTENGPTAAHPNSRFCAPSDHCPIMDKDWENPAGVPISAILFGGRRPYGVPLVMQSFNWQHGVFLATSLSSETTAAAEFKGKAVMRDPFAMRPFFGYNFGKYLEHWLNLSKDPKKKLPLIFHVNWFR-LDKNEHFLWPGFGENSRVLEWVFRRVHGEEIADPSPVGLLPKYGSLNLDGL-KDPVTPEAWNEMFSIPKDYWLEELTELRKYFTDEVGIDLPKAIEDELNALENRL 615          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO26447 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC03])

HSP 1 Score: 93.5893 bits (231), Expect = 1.605e-23
Identity = 45/66 (68.18%), Postives = 53/66 (80.30%), Query Frame = 1
Query:  538 GRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPL 735
            GR MYV+PFSMGPVG  ISK+G+E+TDS YVV  MRIMTRMGS VLK +  +  FV+C+HSVG PL
Sbjct:    1 GRTMYVMPFSMGPVGSPISKIGIELTDSEYVVCCMRIMTRMGSHVLKAL-GDGDFVRCLHSVGGPL 65          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Medaka
Match: pck2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:NCBI gene;Acc:101158145])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 365/604 (60.43%), Postives = 438/604 (72.52%), Query Frame = 1
Query:  205 SLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRA-LQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVD---CKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            ++ D++   A  C+P ++HV  G+ EE   ++  L   G +K+L KYENCWL RTDP DVARVESKT I T  +  T+P    G++  LG+WMS +  E     RFPG M GR MYVIPFSMGPVG ++SK GV++TDSPYVVASM IMTRMGS VL+++ +   FV+C HSVG PLP T  + N WPC+PEK +I+HLP   +I SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRY+ AAFPSACGKTNLAM++ SLPG+K+ECVGDDIAWMKFD++G L+AINPE GFFGVAPGTS KTNP AM  I KNT+FTNV ETSDGG +WEGL+       +++TDW G  W        AHPNSRFC PA QCPIID  WES +GVPI AIIFGGRRPEGVPLVYE+ +W HGVFVGA+MRSE+TAAAE+K  +IMHDPFAMRPFFGYNFG YL HWLS    +A  QLPRI+HVNWFRK   TG FLWPGFGEN RVLEWI KR  +  +    K S IG LP    IN  G   S +D+  LF V  +FW+KE  E++ YF +QVG  LP Q+K E+  L++ +
Sbjct:   31 AVADFVKGAADECKPANVHVVTGTPEETANILAGLERDGMVKRLPKYENCWLARTDPKDVARVESKTVIVTKNQRDTVPIPAGGVKSQLGSWMSESDWERARRDRFPGSMAGRTMYVIPFSMGPVGSTLSKYGVQVTDSPYVVASMGIMTRMGSPVLQKLTEGVEFVRCQHSVGRPLPLTAPLNNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYVAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSNKTNPYAMATIVKNTVFTNVGETSDGGVWWEGLDPPP--AGITLTDWHGKSWKPGSSTPCAHPNSRFCAPAGQCPIIDPQWESEEGVPIDAIIFGGRRPEGVPLVYESFNWQHGVFVGAAMRSEATAAAEHKGKMIMHDPFAMRPFFGYNFGDYLTHWLSMQSRKAPTQLPRIFHVNWFRKDPATGAFLWPGFGENARVLEWIFKRCGREREDEAAKKSIIGWLPQEGAINTEGLG-SKVDMGALFDVPKSFWQKETKELQAYFTQQVGADLPAQMKAELKALEDRV 631          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Medaka
Match: pck2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:NCBI gene;Acc:101158145])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 346/604 (57.28%), Postives = 416/604 (68.87%), Query Frame = 1
Query:  205 SLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRA-LQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVD---CKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            ++ D++   A  C+P ++HV  G+ EE   ++  L   G +K+L KYENCWL RTDP DVARVESKT I T  +  T+P    G++  LG+WMS +  E     RFPG M GR MYVIPFSMGPVG ++SK GV++TDSPYVVASM IMTRMGS VL+++ +   FV+C HSVG PLP T  + N WPC+PEK +I+HLP   +I SFGSGYGGNSLLGKKC ALR+ S +   + WLAEHMLILGIT+    KRY+ AAFPSACGKTNLAM++ SLPG+K+ECVGDDIAWMKFD++G L+AINPE GFFGVAPGTS KTNP AM  I KNT+FTNV ETSDGG +WEGL+       +++TDW G  W        AHPNSRFC PA QCPIID  WES +GVPI AIIFGGRRPEG       R   H      S+R  S    +    +IMHDPFAMRPFFGYNFG YL HWLS    +A  QLPRI+HVNWFRK   TG FLWPGFGEN RVLEWI KR  +  +    K S IG LP    IN  G   S +D+  LF V  +FW+KE  E++ YF +QVG  LP Q+K E+  L++ +
Sbjct:   56 AVADFVKGAADECKPANVHVVTGTPEETANILAGLERDGMVKRLPKYENCWLARTDPKDVARVESKTVIVTKNQRDTVPIPAGGVKSQLGSWMSESDWERARRDRFPGSMAGRTMYVIPFSMGPVGSTLSKYGVQVTDSPYVVASMGIMTRMGSPVLQKLTEGVEFVRCQHSVGRPLPLTAPLNNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYVAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSNKTNPYAMATIVKNTVFTNVGETSDGGVWWEGLDPPP--AGITLTDWHGKSWKPGSSTPCAHPNSRFCAPAGQCPIIDPQWESEEGVPIDAIIFGGRRPEGA-----QRLGAH------SLRLTSFPPGK----MIMHDPFAMRPFFGYNFGDYLTHWLSMQSRKAPTQLPRIFHVNWFRKDPATGAFLWPGFGENARVLEWIFKRCGREREDEAAKKSIIGWLPQEGAINTEGLG-SKVDMGALFDVPKSFWQKETKELQAYFTQQVGADLPAQMKAELKALEDRV 641          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000003144.1 (SMESG000003144.1)

HSP 1 Score: 1286.94 bits (3329), Expect = 0.000e+0
Identity = 621/621 (100.00%), Postives = 621/621 (100.00%), Query Frame = 1
Query:  160 MIDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSILNVD 2022
            MIDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSILNVD
Sbjct:    1 MIDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSILNVD 621          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000060914.1 (SMESG000060914.1)

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 455/621 (73.27%), Postives = 533/621 (85.83%), Query Frame = 1
Query:  160 MIDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSILNVD 2022
            M +YN  + + +SD  +  Y+L  A ICQPDSI++CDGSEEENQKMIDILL +GAIKKL+KYENCWLVRTDPADVARVESKTFIST +KE TIP +NNG+ G LGNWMSP V+ +ELN RF GCMKGR MYVI FSMGP+GG +SK+G+E+TDSPYVV SM+IMTR+G  VL  + +   FV+ IHSVGVPLPTT+KIINGWPC+PEKTIIAH+P  NEICSFGSGYGGNSLLGKKC ALRLGSI+GH++ W AEHMLI+GITD NN KRYI AAFPSACGKTNLAML+S+LPGYKIECVGDDIAWMKFD  G L+AINPE GFFGVAPGTSFKTNPNAM CIQKNTIFTNVAETSDGGFFWEG+E+E+D +SV+ITDW+GN WDK++  KAAHPNSRFCTPASQCPIID DWES +GV ISAI+FGGRRPEGVPL+YE+ +W HGVF+GASMRSESTAAA++K+NIIMHDPFAMRPFFGYNFG YL+HWLSF     L+LPRIYHVNWFRKS  TG+F+WPGFG+NCRVLEWILKR+D  V C+ +AIG LP  +DIN+ G D+S I++EELFSV S +W++E  EI++YF+EQVG YLP +I  ++ +L++ L   N+D
Sbjct:    1 MNNYNSAI-NHLSD-PIKHYVLKNADICQPDSIYICDGSEEENQKMIDILLKEGAIKKLNKYENCWLVRTDPADVARVESKTFISTERKEETIPVVNNGVSGCLGNWMSPDVLRDELNQRFTGCMKGRTMYVIGFSMGPIGGELSKIGIELTDSPYVVMSMKIMTRIGKEVLMTLGQSNDFVRSIHSVGVPLPTTKKIINGWPCNPEKTIIAHIPNENEICSFGSGYGGNSLLGKKCFALRLGSILGHREGWFAEHMLIVGITDKNNVKRYIAAAFPSACGKTNLAMLQSTLPGYKIECVGDDIAWMKFDGNGELRAINPESGFFGVAPGTSFKTNPNAMLCIQKNTIFTNVAETSDGGFFWEGMENEIDFNSVTITDWQGNKWDKSQKTKAAHPNSRFCTPASQCPIIDRDWESTNGVVISAIVFGGRRPEGVPLIYESFNWEHGVFIGASMRSESTAAAKHKSNIIMHDPFAMRPFFGYNFGDYLQHWLSFRSKENLKLPRIYHVNWFRKSKSTGEFIWPGFGDNCRVLEWILKRLDGTVGCRMTAIGKLPNPTDINMEGLDQSKINIEELFSVPSQYWREEVKEIKRYFEEQVGDYLPTKIIEQVNELEKRLE--NID 617          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000032297.1 (SMESG000032297.1)

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 435/601 (72.38%), Postives = 509/601 (84.69%), Query Frame = 1
Query:  217 YILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLSILNV 2019
            Y+L KA ICQPDSI +CDGSEEEN KMI ILL +GAI+KL KYENCW VRTDPADVARVESKTFIST KKE TIP +NNG+ G LGNWM+P V+ +EL  RF GCMKGRVMYVI FSMGP+GG +SK+G+E+TDSP                    +K K FV+ IHS GVPLPTT+KIINGWPC+PE+TIIAH+PA+NEICSFGSGYGGNSLLGKKC ALRLGSI+GHK+ W AEHMLI+GI D NN KRYI AAFPSACGKTNLAML+S+LPGYKIECVGDDIAWMKFD+ G L+AINPE GFFGVAPGTSFKTNPNAM C QKNTIFTNVAETSDGGFFWEG+EDE+D +SV IT+W+GN W++N   KAAHPNSRFCTPASQCPIID DWESP GV ISAI+FGGRRPEGVPL+YE+ +W HGVFVGASM+SESTAAAE+K+N+IMHDPFAMRPFFGYNFG+YL+HWLSF +   L+LPRIYHVNWFRKS  TGKF+WPGFG+NCRVL+WILKR+D  V C+++AIGNLP  +DIN+ G D+S I+LEELFSV + +WK+E ++I++YF+EQ+G YLP +IK ++ +L++ L   N+
Sbjct:   18 YVLEKAEICQPDSICICDGSEEENNKMIAILLKEGAIRKLKKYENCWSVRTDPADVARVESKTFISTNKKEDTIPVVNNGVLGCLGNWMAPDVLRDELRERFTGCMKGRVMYVIGFSMGPIGGELSKIGIELTDSPR---------------FDGFKKNKDFVRAIHSFGVPLPTTKKIINGWPCNPEQTIIAHIPAKNEICSFGSGYGGNSLLGKKCFALRLGSILGHKEGWFAEHMLIVGIRDKNNVKRYIAAAFPSACGKTNLAMLQSTLPGYKIECVGDDIAWMKFDSNGDLRAINPESGFFGVAPGTSFKTNPNAMHCTQKNTIFTNVAETSDGGFFWEGMEDEIDFNSVRITNWQGNEWNRNCKTKAAHPNSRFCTPASQCPIIDKDWESPKGVIISAIVFGGRRPEGVPLIYESFNWDHGVFVGASMKSESTAAAEHKSNVIMHDPFAMRPFFGYNFGNYLQHWLSFREKENLKLPRIYHVNWFRKSKSTGKFIWPGFGDNCRVLQWILKRLDGTVGCRTTAIGNLPNPTDINMEGLDQSKINLEELFSVPNQYWKEEVEKIKRYFEEQIGDYLPIKIKEQVLELEKRLKHTNI 603          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000011426.1 (SMESG000011426.1)

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 415/611 (67.92%), Postives = 492/611 (80.52%), Query Frame = 1
Query:  178 FLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNG-IRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENLS 2007
            F K  V  K++ +Y++ +A  C P+ I VCDGSEEE+Q +I  L+ +G++KKL+KYENCWLVRTDP DVARVESKTFIST  K  TIP+ NNG I+G LGNWMS   ME ELN RFPGCMKGR M+VIPFSMGPVGG +SK+G+++TDSPYVV SM+IMTRMG  V+  +     FVK +HSVGVPLPT RKIINGWPC+PEKT+IAHLP  NEICSFGSGYGGNSLLGKKC ALRLGSI+   +  LAEHMLILGIT     K YITAAFPSACGKTNLAML+ ++PGYK+ECVGDDIAWMKFD++GIL+AINPE GFFGVAPGTS  TNPNAM CIQKNTIFTNVAETSDGG FWEGLEDEV+ + + I DW+G PW K+ G+ AAHPNSRFC PA QCPIID DWESP+GVPISA+IFGGRRPEGVPL+YEA +W HGVF+GAS+RSE+TAAAEYK  +IM+DPFAMRPFFGYNFG YL+HW+SF+   +L+LP I+HVNWFRKS + G FLWPG+GEN RVL+WI+KRI  +V    +A+G LP   ++N+ G   + +  +ELFS+   FW  E +E+EKYF EQVG  LP QIK E+   K+ L+
Sbjct:    2 FDKLKVLPKAVREYVIEQANKCLPNDIKVCDGSEEESQILIQNLVDEGSMKKLAKYENCWLVRTDPDDVARVESKTFISTKLKRTTIPETNNGEIKGKLGNWMSVDEMEKELNERFPGCMKGRTMFVIPFSMGPVGGPLSKIGIQLTDSPYVVCSMKIMTRMGQIVINSMTDSTSFVKALHSVGVPLPTDRKIINGWPCNPEKTLIAHLPETNEICSFGSGYGGNSLLGKKCFALRLGSILARDEERLAEHMLILGITPEFGKKIYITAAFPSACGKTNLAMLKPTIPGYKVECVGDDIAWMKFDSEGILRAINPESGFFGVAPGTSNTTNPNAMACIQKNTIFTNVAETSDGGVFWEGLEDEVNFNEIEILDWQGKPWAKDCGRPAAHPNSRFCCPAFQCPIIDPDWESPNGVPISAVIFGGRRPEGVPLIYEALNWQHGVFIGASLRSEATAAAEYKGKVIMNDPFAMRPFFGYNFGDYLKHWISFADKNSLKLPSIFHVNWFRKSKENGLFLWPGYGENSRVLDWIVKRIYGKVSGTKTAVGILPKYDEMNLDGLKLNKVQYDELFSLPKRFWINECEELEKYFVEQVGSDLPEQIKMELENFKKRLN 612          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000062650.1 (SMESG000062650.1)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 387/615 (62.93%), Postives = 471/615 (76.59%), Query Frame = 1
Query:  160 MIDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 2004
            M DY    K    D  +  ++L KA +CQPD IH+CDGS++EN +++ +L+S G IK LSKY+NCWL  TDP DVAR ESKT I T  +  T+P   +G+ G LGNWM     +  +   +PGCMKGR+MYVIPFSMGPVGG ISK GVE+TDS YVVASMRIMTR+G  VLK + K+  FVK  H+VG PLP T+ +IN WPC+PEK +IAH+P  NEI SFGSGYGGNSLLGKKC ALR+GSI+G  + WLAEHMLILGIT+    K+YITAAFPSACGKTNLAMLE +L  YK+ECVGDDIAWMKF++KG L+AINPE GFFGVAPGTS +TNPNAM+C+Q NTIFTNVA TSDGG+FWEGLE ++DL  V++TDW   PW K+    ++H NSRFCTPA QCPIID  WE+P+GV + AIIFGGRRPEGVPLVYE+  W HGVF+G ++RSE+TAAAE+K   IMHDPFAMRPFFGYNFGHY++HW+   K +  ++P+IYHVNWFRKS+K G+FLWPGFGENCRVL+WI +R++  V    S +G LP   DIN+TG   +  DLEE  S+  AFW+ EA EI KYF+EQVG  LP +I  E+  L+E +
Sbjct:    1 MADYATAAKSLPDD--VKSFVLSKAEMCQPDKIHICDGSDKENDELLKLLVSTGMIKPLSKYKNCWLALTDPQDVARNESKTVICTKDRRATVPIPKSGVTGLLGNWMDIEEFKKTVQLIYPGCMKGRIMYVIPFSMGPVGGPISKCGVELTDSAYVVASMRIMTRIGEPVLKLLAKKTPFVKGTHTVGCPLPLTKALINNWPCNPEKLLIAHIPDENEIMSFGSGYGGNSLLGKKCFALRIGSILGRNEGWLAEHMLILGITNPKKQKKYITAAFPSACGKTNLAMLEPTLKDYKVECVGDDIAWMKFNDKGELRAINPENGFFGVAPGTSNQTNPNAMKCLQSNTIFTNVAMTSDGGYFWEGLEKDIDLSKVTVTDWLNKPWTKDSKTPSSHANSRFCTPAKQCPIIDPKWEAPEGVHVEAIIFGGRRPEGVPLVYESLSWNHGVFIGGTVRSEATAAAEFKGKQIMHDPFAMRPFFGYNFGHYMKHWIELGK-KYPKVPKIYHVNWFRKSAK-GEFLWPGFGENCRVLDWIFRRLNNEVTAVESPVGLLPKSDDINITGLSMTKADLEEALSISKAFWQTEAKEIRKYFEEQVGDDLPPEIAKELKSLEERI 611          
The following BLAST results are available for this feature:
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCK10.000e+062.46phosphoenolpyruvate carboxykinase 1 [Source:HGNC S... [more]
PCK20.000e+060.13phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
PCK20.000e+060.13phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
PCK20.000e+060.83phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
PCK20.000e+060.83phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pck-20.000e+055.67Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+055.67Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+055.67Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+055.67Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+055.67Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pepck10.000e+062.90gene:FBgn0003067 transcript:FBtr0086701[more]
Pepck20.000e+061.77gene:FBgn0034356 transcript:FBtr0086699[more]
Pepck20.000e+063.20gene:FBgn0034356 transcript:FBtr0113093[more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pck10.000e+058.86phosphoenolpyruvate carboxykinase 1 (soluble) [Sou... [more]
pck20.000e+059.44phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
pck20.000e+059.44phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gca0.000e+061.81grancalcin [Source:Xenbase;Acc:XB-GENE-983090][more]
slc5a60.000e+060.36solute carrier family 5 (sodium/multivitamin and i... [more]
gca0.000e+058.39grancalcin [Source:Xenbase;Acc:XB-GENE-983090][more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pck10.000e+061.30phosphoenolpyruvate carboxykinase 1, cytosolic [So... [more]
Pck20.000e+059.76phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
Pck20.000e+059.76phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
Pck20.000e+061.20phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
Pck20.000e+055.56phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05153|PCKGC_CHICK0.000e+063.50Phosphoenolpyruvate carboxykinase, cytosolic [GTP]... [more]
sp|P20007|PCKG_DROME0.000e+062.90Phosphoenolpyruvate carboxykinase [GTP] OS=Drosoph... [more]
sp|P35558|PCKGC_HUMAN0.000e+062.46Phosphoenolpyruvate carboxykinase, cytosolic [GTP]... [more]
sp|Q5R5J1|PCKGC_PONAB0.000e+063.51Phosphoenolpyruvate carboxykinase, cytosolic [GTP]... [more]
sp|P07379|PCKGC_RAT0.000e+062.16Phosphoenolpyruvate carboxykinase, cytosolic [GTP]... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443RAW70.000e+066.16Phosphoenolpyruvate carboxykinase-like: cytosolic ... [more]
A0A132ADU80.000e+063.34Uncharacterized protein (Fragment) OS=Sarcoptes sc... [more]
A0A183AAI60.000e+065.94Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A443SNR80.000e+066.22Phosphoenolpyruvate carboxykinase-like: cytosolic ... [more]
T1KI490.000e+064.36Uncharacterized protein OS=Tetranychus urticae OX=... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pck10.000e+061.19phosphoenolpyruvate carboxykinase 1 [Source:NCBI g... [more]
pck20.000e+059.07phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005310.12.140e-7256.84pep scaffold:Pmarinus_7.0:GL478263:992:2267:1 gene... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO415880.000e+057.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416310.000e+054.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415870.000e+055.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264471.605e-2368.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pck20.000e+060.43phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
pck20.000e+057.28phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003144.10.000e+0100.00SMESG000003144.1[more]
SMESG000060914.10.000e+073.27SMESG000060914.1[more]
SMESG000032297.10.000e+072.38SMESG000032297.1[more]
SMESG000011426.10.000e+067.92SMESG000011426.1[more]
SMESG000062650.10.000e+062.93SMESG000062650.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003468 ID=SMED30003468|Name=Phosphoenolpyruvate carboxykinase [GTP]|organism=Schmidtea mediterranea sexual|type=transcript|length=2099bp
CGATCTGCTTGCAGTAAATACACACAAACTTTCAAACATTTCTATTTTTA
GCACATTTTATATCACTTTTAGAAAATCATATAAATACGAGTTCGTGCTT
GGGGGTCAATTTGTATTTCTGGAAACAGACCTAGAGTTGCAAAGAAAAAT
TTAGTGAAAATGATTGATTATAATGAATTTCTAAAGGATTCTGTGTCAGA
TAAAAGTCTCATAGACTACATTTTGTTGAAAGCTACAATCTGTCAACCGG
ATTCGATTCATGTTTGCGATGGATCAGAAGAGGAAAATCAGAAAATGATT
GATATTCTTTTGTCTCAAGGTGCAATAAAGAAACTGTCGAAATACGAAAA
CTGTTGGCTCGTTCGAACCGATCCCGCCGATGTAGCGAGAGTCGAATCGA
AAACGTTTATAAGTACTCCGAAAAAAGAAATGACAATACCGGATCTGAAT
AATGGAATTCGTGGTTCATTGGGAAATTGGATGTCACCAGCTGTTATGGA
GAACGAATTGAATACGCGCTTTCCCGGATGCATGAAAGGTCGAGTAATGT
ACGTGATTCCGTTTAGTATGGGTCCTGTTGGAGGGTCTATATCTAAACTC
GGTGTTGAGATTACTGACTCTCCATATGTCGTTGCTAGTATGCGTATAAT
GACACGAATGGGATCAGGAGTTTTGAAGGAAATAGAAAAAGAGAAATGTT
TTGTGAAATGCATTCATAGTGTGGGAGTTCCTTTGCCGACAACAAGAAAA
ATTATAAACGGTTGGCCATGTGATCCAGAGAAAACGATTATAGCTCATTT
GCCAGCAAGAAATGAAATTTGTAGTTTTGGTAGTGGTTATGGTGGAAACT
CACTTTTAGGGAAAAAATGTCTGGCTTTGAGACTTGGATCAATCATGGGA
CACAAGCAGCATTGGCTCGCAGAACACATGCTGATTCTTGGAATAACAGA
TGCAAACAATAACAAACGATATATTACAGCTGCATTTCCATCAGCATGTG
GGAAAACAAATTTAGCAATGCTTGAATCGAGTTTGCCAGGATATAAGATT
GAATGTGTAGGAGATGACATTGCTTGGATGAAATTCGACAACAAAGGCAT
ATTGAAGGCTATAAATCCTGAATATGGATTCTTCGGGGTCGCTCCTGGCA
CATCTTTTAAAACCAATCCAAATGCAATGAGATGCATTCAAAAAAATACA
ATTTTCACAAATGTAGCTGAAACTAGTGATGGTGGCTTCTTTTGGGAAGG
ATTAGAGGACGAGGTTGATCTGGATTCTGTTAGTATTACAGATTGGGAAG
GCAATCCATGGGATAAAAACAAAGGCAAAAAAGCTGCACATCCAAATTCA
CGATTTTGTACTCCGGCCTCTCAATGTCCAATTATTGATGGAGATTGGGA
ATCTCCCGATGGAGTTCCTATCAGTGCTATTATTTTTGGCGGTCGACGTC
CTGAAGGCGTACCACTGGTGTATGAAGCTAGAGATTGGGTTCATGGAGTT
TTTGTCGGGGCTTCAATGAGGTCTGAATCAACAGCAGCTGCTGAATACAA
GGCAAATATTATTATGCATGATCCGTTTGCAATGCGTCCATTTTTTGGAT
ACAATTTTGGCCATTACCTTGAACATTGGTTGAGTTTTTCAAAAGATAGA
GCACTGCAATTGCCTCGAATCTATCACGTAAATTGGTTTAGAAAATCCAG
TAAAACCGGGAAGTTTTTATGGCCGGGTTTCGGCGAAAACTGCCGAGTTC
TTGAATGGATCCTTAAGCGGATCGATCAGCGGGTTGACTGCAAATCGAGT
GCAATCGGAAATTTGCCGGTGCTATCGGATATCAATGTGACTGGATTTGA
CAAATCGGACATAGATTTAGAGGAACTGTTTAGCGTTGACTCGGCGTTTT
GGAAAAAAGAAGCTGACGAAATTGAGAAATATTTCGACGAACAAGTGGGA
AAGTATTTGCCCAATCAGATTAAAAATGAAATAACAAAATTAAAAGAAAA
CTTGTCCATCTTAAATGTAGATTGAGGATTTCTTATTTTTATTGCTCTTT
GGTAGATGAATCTTTCATTGATTTGAAAATAAATGTTTGTCCTTCTCTT
back to top

protein sequence of SMED30003468-orf-1

>SMED30003468-orf-1 ID=SMED30003468-orf-1|Name=SMED30003468-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=622bp
MIDYNEFLKDSVSDKSLIDYILLKATICQPDSIHVCDGSEEENQKMIDIL
LSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGI
RGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVE
ITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIIN
GWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQ
HWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECV
GDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFT
NVAETSDGGFFWEGLEDEVDLDSVSITDWEGNPWDKNKGKKAAHPNSRFC
TPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVG
ASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQ
LPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIG
NLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYL
PNQIKNEITKLKENLSILNVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035078PEP_carboxykinase_GTP_N
IPR035077PEP_carboxykinase_GTP_C
IPR008209PEP_carboxykinase_GTP
IPR008210PEP_carboxykinase_N
IPR013035PEP_carboxykinase_C
IPR018091PEP_carboxykin_GTP_CS
Vocabulary: biological process
TermDefinition
GO:0006094gluconeogenesis
Vocabulary: molecular function
TermDefinition
GO:0004611phosphoenolpyruvate carboxykinase activity
GO:0005525GTP binding
GO:0017076purine nucleotide binding
GO:0004613phosphoenolpyruvate carboxykinase (GTP) activity
GO:0000166nucleotide binding
GO:0016829lyase activity
GO:0016831carboxy-lyase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035078Phosphoenolpyruvate carboxykinase, GTP-utilising, N-terminalPFAMPF17297PEPCK_Ncoord: 20..247
e-value: 2.1E-94
score: 315.2
NoneNo IPR availableGENE3DG3DSA:2.170.8.10coord: 55..410
e-value: 1.3E-260
score: 867.5
NoneNo IPR availablePANTHERPTHR11561:SF1PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC [GTP]coord: 15..616
NoneNo IPR availableSUPERFAMILYSSF53795PEP carboxykinase-likecoord: 252..616
IPR008209Phosphoenolpyruvate carboxykinase, GTP-utilisingPIRSFPIRSF001348PEP_carboxykin_GTPcoord: 3..619
e-value: 4.6E-266
score: 881.3
IPR008209Phosphoenolpyruvate carboxykinase, GTP-utilisingPANTHERPTHR11561PHOSPHOENOLPYRUVATE CARBOXYKINASEcoord: 15..616
IPR008209Phosphoenolpyruvate carboxykinase, GTP-utilisingCDDcd00819PEPCK_GTPcoord: 17..611
e-value: 0.0
score: 968.249
IPR035077Phosphoenolpyruvate carboxykinase, C-terminal P-loop domainPFAMPF00821PEPCK_GTPcoord: 252..615
e-value: 2.0E-162
score: 540.1
IPR013035Phosphoenolpyruvate carboxykinase, C-terminalGENE3DG3DSA:3.90.228.20coord: 255..613
e-value: 1.3E-260
score: 867.5
IPR008210Phosphoenolpyruvate carboxykinase, N-terminalGENE3DG3DSA:3.40.449.10coord: 19..254
e-value: 1.3E-260
score: 867.5
IPR008210Phosphoenolpyruvate carboxykinase, N-terminalSUPERFAMILYSSF68923PEP carboxykinase N-terminal domaincoord: 12..250
IPR018091Phosphoenolpyruvate carboxykinase, GTP-utilising, conserved sitePROSITEPS00505PEPCK_GTPcoord: 276..284